Citrus Sinensis ID: 047846

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-

LDGIRTFERTVVLLLRSGTRHPQEGPFGVVINRPLHKKIKHMKPTNHELATTFADCSLHFGGPLEASMFLLKTGQSKLPGFEEVIPGLCFGARNSLDEAAALVKKGVLKPQDFRFFVGYAGWQLDQLREEIESDYWYVAACSSDLICGATSDTSSESLWEEILQLMGGHYSELSRKPKQDM

cccccccccEEEEEEcccccccccccEEEEEcccccccHHHHcccccccccccccccEECcccccccEEEEECccccccccEEECccEEEECcccHHHHHHHHHcccccccCEEEEEEEccccccHHHHHHHcccEEEEcccccccccccccccHHHHHHHHHHHccccHHHHcccccccc

LDGIRTFERTVVLLLRSGTRHPQEGPFGVVINRPLHKKIKHMKPTNHELATTFADCSLHFGGPLEASMFLLKTGQSKLPGFEEVIPGLCFGARNSLDEAAALVKKGVLKPQDFRFFVGYAGWQLDQLREEIESDYWYVAACSSDLICGATSDTSSESLWEEILQLMGGHYSELSRKPKQ**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

LDGIRTFERTVVLLLRSGTRHPQEGPFGVVINRPLHKKIKHMKPTNHELATTFADCSLHFGGPLEASMFLLKTGQSKLPGFEEVIPGLCFGARNSLDEAAALVKKGVLKPQDFRFFVGYAGWQLDQLREEIESDYWYVAACSSDLICGATSDTSSESLWEEILQLMGGHYSELSRKPKQDM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
UPF0301 protein CT0663		probable	Q8KEM4
UPF0301 protein Cpha266_0885		probable	A1BEV6
UPF0301 protein CHU_1773		probable	Q11U74

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2GZO, chain A
Confidence level:very confident
Coverage over the Query: 3-180
View the alignment between query and template
View the model in PyMOL