Citrus Sinensis ID: 047888


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270----
MTLTDGELTVNANGNAFMELMTHSSSFLLPSTPTDSRPSLTYALVVLNQRLPRFAPLLWQHAKLRLCADGGANRVYDELPQLFPHEDPSDIRRRYKPDLIKGDMDSIRKEVMDFYASLGTKVVDESHDQDTTDLHKCVAYIRDCTPNLEKSNLRILVAGALGGRFDHEAGNINVLYRFSDIRIILLSDDCHIQLLPKTHRHDIYIQSSVEGPHCGLIPIGMPSGSTSTTGLQWDLDNTETRFGGLVSTSNIVKGEKVTVRSDSDLLWTISIKNQ
cccccccCEEEcccccccccEECccccccccccccccccccEEEEEEcccccccHHHHHHHccEEEEEccHHHHHHHHHcccccccccHHccccccccEEEcccccccHHHHHHHHHcccEEEEcccccccHHHHHHHHHHHHHcccccccccEEEEEcccccHHHHHHHHHHHHHHccccEEEEEEcccEEEEECcccEEEEECcccccccEEEEECcccccccEEEccECcccccccEECccEEEEccCECccEEEEEECccEEEEEEEccc
*******LTVNANGNAFMELMTHSSSFLLPSTPTDSRPSLTYALVVLNQRLPRFAPLLWQHAKLRLCADGGANRVYDELPQLFPHEDPSDIRRRYKPDLIKGDMDSIRKEVMDFYASLGTKVVDESHDQDTTDLHKCVAYIRDCTPNLEKSNLRILVAGALGGRFDHEAGNINVLYRFSDIRIILLSDDCHIQLLPKTHRHDIYIQSSVEGPHCGLIPIGMPSGSTSTTGLQWDLDNTETRFGGLVSTSNIVKGEKVTVRSDSDLLWTISIKN*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTLTDGELTVNANGNAFMELMTHSSSFLLPSTPTDSRPSLTYALVVLNQRLPRFAPLLWQHAKLRLCADGGANRVYDELPQLFPHEDPSDIRRRYKPDLIKGDMDSIRKEVMDFYASLGTKVVDESHDQDTTDLHKCVAYIRDCTPNLEKSNLRILVAGALGGRFDHEAGNINVLYRFSDIRIILLSDDCHIQLLPKTHRHDIYIQSSVEGPHCGLIPIGMPSGSTSTTGLQWDLDNTETRFGGLVSTSNIVKGEKVTVRSDSDLLWTISIKNQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Thiamin pyrophosphokinase 1 Catalyzes the phosphorylation of thiamine to thiamine pyrophosphate. Can also catalyze the phosphorylation of pyrithiamine to pyrithiamine pyrophosphate.probableQ9R0M5
Thiamin pyrophosphokinase 1 Catalyzes the phosphorylation of thiamine to thiamine pyrophosphate. Can also catalyze the phosphorylation of pyrithiamine to pyrithiamine pyrophosphate.probableQ5E9T4
Thiamin pyrophosphokinase 1 Catalyzes the phosphorylation of thiamine to thiamine pyrophosphate. Can also catalyze the phosphorylation of pyrithiamine to pyrithiamine pyrophosphate.probableQ9H3S4

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3S4Y, chain A
Confidence level:very confident
Coverage over the Query: 39-272
View the alignment between query and template
View the model in PyMOL
Template: 2G9Z, chain A
Confidence level:very confident
Coverage over the Query: 21-28,41-273
View the alignment between query and template
View the model in PyMOL