Citrus Sinensis ID: 047929

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790

MGCLESERVALIKLKQDFKDPSNHLASWIGDVDCCEWGGVVCNNITGHVLELNLERSELGGKINPALVDLKHLNLLDLSGNDFQGIQIPEYIGSMDNLRYLNLSGAGFAGWIPHQLGNLSNLMHLDLSGSYYELRVEDISWLAGPSLLEHLDTSDVDLIKASDWLLVINSLPSLKVLKLFSCKLHHFAPLASANFSSLNALDLSGNLFGKTSIPSWVFGLSDLVFLDLSSNIFRGPIPDGFKNLTSLRYLDLSYNQFNSTISDCFSNFDDLEYLSLGYNRLQGTISSIGLENLTFIKTLDLSFNELGQDISEILDIISACAAFELESLFLRGCKISGQLTNQLGLFKNLHTLALSDNSVSGPLPPASGELSSLTYLDLSNNNLNGMISEIHFGNLTELAFFYANGNSVNFKINSKWVPPFQLLALRLRSCHLGPHFPSWLHSQKHLSKLDISNTRISDIIPRWFWNSIYQDTIPDCWMNWPDLRVLNLGNNKFTGSIPISMGTLTSLRSLNLRSNRLSGIIPVPFENCSQLVALDMGENEFVGNIPTWMGERFSRLRILNLRSNKLHGIFPIQICHLSSLQILDVAYNRLSGSVPKCINNFTAMATIGSHHQVKAIYHASFENDYIVEEISLVMKGFMVEYNSILNLVRSIDISMNNFSGEIPMEVTNLKGLQSLNLSHNSFIGKIPETIGNMRSIESLDLSGNQISGKIPQSMSSLSFLNHLNLSDNKLVGKIPSSTQLQSFGASSITGNDLCGAPLSNCTEKNVLALCLSAGDGGTSTVISWMALGRG

cccHHHHHHHHHHHHccccccccccccccccccccccccEEEccccccEEEEEcccccccCCccccccccccccEEEccccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccCCcccccccccccccEEEcccccccccccHHHHHcccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHcccccccEEEccccccCECcccccccccccccEEEcccccccEEccHHHHHHcccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccCECcccccccccccccEEEccccCEEECccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccEEEccccccCECccccccccccccEEEccccCEECcccHHHcccccccEEEcccccccccccHHHHHHcccccEEEccccccCECccccccccccccEEEcccccccccccHHHHHHHHcccccccccEEEEEEcccccccEEEEEEEEEccccHHHHHHccccEEEEcccccccccccHHHcccccccccccccccccccccccccccccccEEEcccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcEEEEEEc

MGCLESERVALIKLKQDFKDPSNHLASWIGDVDCCEWGGVVCNNITGHVLELNLERSELGGKINPALVDLKHLNLLDLSGNDFQGIQIPEYIGSMDNLRYLNLSGAGFAGWIPHQLGNLSNLMHLDLSGSYYELRVEDISWLAGPSLLEHLDTSDVDLIKASDWLLVINSLPSLKVLKLFSCKLHHFAPLASANFSSLNALDLSGNLFGKTSIPSWVFGLSDLVFLDLSSNIFRGPIPDGFKNLTSLRYLDLSYNQFNSTISDCFSNFDDLEYLSLGYNRLQGTISSIGLENLTFIKTLDLSFNELGQDISEILDIISACAAFELESLFLRGCKISGQLTNQLGLFKNLHTLALSDNSVSGPLPPASGELSSLTYLDLSNNNLNGMISEIHFGNLTELAFFYANGNSVNFKINSKWVPPFQLLALRLRSCHLGPHFPSWLHSQKHLSKLDISNTRISDIIPRWFWNSIYQDTIPDCWMNWPDLRVLNLGNNKFTGSIPISMGTLTSLRSLNLRSNRLSGIIPVPFENCSQLVALDMGENEFVGNIPTWMGERFSRLRILNLRSNKLHGIFPIQICHLSSLQILDVAYNRLSGSVPKCINNFTAMATIGS**QVKAIYHASFENDYIVEEISLVMKGFMVEYNSILNLVRSIDISMNNFSGEIPMEVTNLKGLQSLNLSHNSFIGKIPETIGNMRSIESLDLSGNQISGKIPQSMSSLSFLNHLNLSDNKLVGKIPSSTQLQSFGASSITGNDLCGAPLSNCTEKNVLALCLSAGDGGTSTVISWMALGRG

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1OGQ, chain A
Confidence level:very confident
Coverage over the Query: 2-133,186-293,323-382
View the alignment between query and template
View the model in PyMOL

Template: 2Z66, chain A
Confidence level:very confident
Coverage over the Query: 35-44,57-308
View the alignment between query and template
View the model in PyMOL

Template: 2Z62, chain A
Confidence level:very confident
Coverage over the Query: 481-603,648-737
View the alignment between query and template
View the model in PyMOL

Template: 2XOT, chain A
Confidence level:very confident
Coverage over the Query: 446-460,475-598,644-683
View the alignment between query and template
View the model in PyMOL

Template: 3T6Q, chain A
Confidence level:very confident
Coverage over the Query: 52-140,167-384,434-460,473-600,645-736
View the alignment between query and template
View the model in PyMOL

Template: 1XKU, chain A
Confidence level:very confident
Coverage over the Query: 348-394,419-461,476-603,648-725
View the alignment between query and template
View the model in PyMOL

Template: 1OGQ, chain A
Confidence level:very confident
Coverage over the Query: 444-459,471-602,648-762
View the alignment between query and template
View the model in PyMOL

Template: 1JL5, chain A
Confidence level:very confident
Coverage over the Query: 96-132,146-459,474-540
View the alignment between query and template
View the model in PyMOL

Template: 3RGZ, chain A
Confidence level:very confident
Coverage over the Query: 4-294,324-459,473-765
View the alignment between query and template
View the model in PyMOL