Citrus Sinensis ID: 047952


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350----
MASNGANQPLLSGFVDSTPQTNNKDAPKRRRLRRCRSAPQTDVAALDINEKDSTHLSESLFGKPRPNFKRVLVYLAAYLGGGSLSFYAVNSQIEGLKTNEILDSIYFCIVTMTTVGYGDLVPNSVVSKLLSCAFVFTGMGLVGMFLSKAADYLVDKQEILLVKALHRYQKVGPTDILKEIETNKVRYKCIIMLVLELVLILVGTIFLVVVEKMSFVDAFYCVCSTITTLGYGDKSFSTTGGRAFGVVWISSSTMTLAQFFLYVAEFNTEKRQKALVNWVLTRKMTHVDLEAADIDEDGVVSAAEFIIYKLKEMGKISQEDIALVMEEFQDLDFDQSGTLSPSDLFLAQDSQTKS
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEEEEEEEEcECccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHccccccccccHHHHHHHHHHHcccccHHHHHHHHHHHccccccccccccHHHHHHHHcccccc
**********LSGFVD**********************************************KPRPNFKRVLVYLAAYLGGGSLSFYAVNSQIEGLKTNEILDSIYFCIVTMTTVGYGDLVPNSVVSKLLSCAFVFTGMGLVGMFLSKAADYLVDKQEILLVKALHRYQKVGPTDILKEIETNKVRYKCIIMLVLELVLILVGTIFLVVVEKMSFVDAFYCVCSTITTLGYGDKSFSTTGGRAFGVVWISSSTMTLAQFFLYVAEFNTEKRQKALVNWVLTRKMTHVDLEAADIDEDGVVSAAEFIIYKLKEMGKISQEDIALVMEEFQDLDFDQSGTLSPSD***********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASNGANQPLLSGFVDSTPQTNNKDAPKRRRLRRCRSAPQTDVAALDINEKDSTHLSESLFGKPRPNFKRVLVYLAAYLGGGSLSFYAVNSQIEGLKTNEILDSIYFCIVTMTTVGYGDLVPNSVVSKLLSCAFVFTGMGLVGMFLSKAADYLVDKQEILLVKALHRYQKVGPTDILKEIETNKVRYKCIIMLVLELVLILVGTIFLVVVEKMSFVDAFYCVCSTITTLGYGDKSFSTTGGRAFGVVWISSSTMTLAQFFLYVAEFNTEKRQKALVNWVLTRKMTHVDLEAADIDEDGVVSAAEFIIYKLKEMGKISQEDIALVMEEFQDLDFDQSGTLSPSDLFLAQDSQTKS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Two pore potassium channel a Highly selective inward-rectifying potassium channel that is specifically located in the tonoplast of large vacuoles. Functions independently of the voltage difference across the membrane.probableQ850M0
Two-pore potassium channel 1 Voltage-independent, large conductance and potassium-selective tonoplast ion channel. Regulated by cytoplasmic calcium and pH. Does not mediate slow-vacuolar (SV) ionic currents, but essential to establish VK currents. Has some permeability for Rb(+) and NH(4)(+), but none for Na(+), Cs(+) or Li(+). Involved in intracellular K(+) redistribution and/or K(+) retranslocation between different tissues.probableQ8LBL1

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3UM7, chain A
Confidence level:very confident
Coverage over the Query: 86-269
View the alignment between query and template
View the model in PyMOL
Template: 1LNQ, chain A
Confidence level:very confident
Coverage over the Query: 193-267,290-314
View the alignment between query and template
View the model in PyMOL
Template: 3LL8, chain B
Confidence level:probable
Coverage over the Query: 290-346
View the alignment between query and template
View the model in PyMOL