Citrus Sinensis ID: 047985

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930
MLWPLCHGDERSALLQFKESLIISESKEIDTLYGPIFCHPKAASWKPEEGNNIDCCSWDGVQCNENTGHVIKLDLSSSCLQGSINSSSSLFKLVHLEWLDLAFNDFDGSEIPPEIINLSSLSYLNLSSAAFSGQIPSEILELSKLAYLDLSHNSYYDPVELRKPSLGNLADKLTNLKELVLGDVTISSPIPHNLTYLSSLTTLSLSGCDLRGRIPSSLGNITRLIHLDLSFNKLSDELPTFIGTLGSLKELDLLQNNLSGELPNSIGNLASLEQVDLSLNRFLGKVPSSLGNLTQLHWLSLASNDFSGELPASFGNLRSLRTLDVYECKFSGQIPSSLSNLTHLSFLDFSLNNFSGKMDLDIFLVNHKLLYHLFLSTNRLSLLTKATSNTTSHRFRAVSLCSCDLTEIPKFLKNQHHLELLDLASNKINGKVPKWLLDPSMQNFGHLNLSHNFLTGFDQHPNTVNYLVSNNSLTGEIPSWICNLSNRLESLDLSYNNLSGLLPQCLGNFSDWLSILDLQHNKFSGTIPDNLLKGNILKVIDLSDNLLQGRIPRSLANCSNLEFLDLGDNQIRDIFPSWLGTLPDLNVLILKSNKFHGLIREPKTDCGFPKLRIIDLSKNRFTGKLPSMAFQCWNAMKVVNASELRYMQEVIPFNEGNGIYDYSLTMSNKGQMMSYKKIPDILTAVILSSNRFDGEIPTSISNLKGLQILSLADNSLHGHIPSCLGNLTDLESLDLSNNRFSGQIPQQLVELTFLEFFNVSDNHFTGPIPQGKQFATFDKTSFDGNSGLCGRPLSSECEISEAPTNEDQIEDSEESLLSGVSDWKIILIGYAGGLIVGVEAMGGSLFTISMQFVFSLIFFNFTIANFTSSMLSPLCHGYERSALLQFKESLTIIRKTSYYIWDPCHPKTASWKPEEANIDCCSQWRTQKLK
cccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccEEEccccccEEEEEcccccccEECcccccccccccccEEEccccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccHHHHHcccccccEEEcccccccccccHHccccccccEEEcccccccccccccccccccccEEEcccccccccccHHccccccccEEEccccccccccccHHcccccccEEEcccccccccccccccccccccEEEccccccCECccccccccccccEEEcccccccccccHHccccccccEEEccccccCEECcccccccccccccEEEccccEEEEEcccccccccccccEEECcccccccccHHHcccccccEEEcccccccccccHHHHccccccccEECccccccccccccccccEEEECccccCECccHHHHHccccccEEEccccccccccccHHHcccccccEEEccccccCECccccccccccccEEEccccCCcccccHHHHccccccEEEcccccccccccHHccccccccEEEccccccCECccccccccccccccEEEcccccccccccHHHHHHHHHHHcccccccccccccccccccccEEEEEEEEECccccccccccccccEEEEcccccccccccHHHHccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEcEEEEEEEHHHHcccccHHHHHHHHHHccccECccccccccccccccccccEEEEEEEEECccccccccccccccccccccccccccccHHHHHHccc
M*WPLCHGDERSALLQFKESLIISESKEIDTLYGPIFCHPKAASWKPEEGNNIDCCSWDGVQCNENTGHVIKLDLSSSCLQGSINSSSSLFKLVHLEWLDLAFNDFDGSEIPPEIINLSSLSYLNLSSAAFSGQIPSEILELSKLAYLDLSHNSYYDPVELRKPSLGNLADKLTNLKELVLGDVTISSPIPHNLTYLSSLTTLSLSGCDLRGRIPSSLGNITRLIHLDLSFNKLSDELPTFIGTLGSLKELDLLQNNLSGELPNSIGNLASLEQVDLSLNRFLGKVPSSLGNLTQLHWLSLASNDFSGELPASFGNLRSLRTLDVYECKFSGQIPSSLSNLTHLSFLDFSLNNFSGKMDLDIFLVNHKLLYHLFLSTNRLSLLTKATSNTTSHRFRAVSLCSCDLTEIPKFLKNQHHLELLDLASNKINGKVPKWLLDPSMQNFGHLNLSHNFLTGFDQHPNTVNYLVSNNSLTGEIPSWICNLSNRLESLDLSYNNLSGLLPQCLGNFSDWLSILDLQHNKFSGTIPDNLLKGNILKVIDLSDNLLQGRIPRSLANCSNLEFLDLGDNQIRDIFPSWLGTLPDLNVLILKSNKFHGLIREPKTDCGFPKLRIIDLSKNRFTGKLPSMAFQCWNAMKVVNASELRYMQEVIPFNEGNGIYDYSLTMSNKGQMMSYKKIPDILTAVILSSNRFDGEIPTSISNLKGLQILSLADNSLHGHIPSCLGNLTDLESLDLSNNRFSGQIPQQLVELTFLEFFNVSDNHFTGPIPQGKQFATFDKTSFDGNSGLCGRPL************************SGVSDWKIILIGYAGGLIVGVEAMGGSLFTISMQFVFSLIFFNFTIANFTSSMLSPLCHGYERSALLQFKESLTIIRKTSYYIWDPCHPKTASWKPEEANIDCCSQWRTQK**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLWPLCHGDERSALLQFKESLIISESKEIDTLYGPIFCHPKAASWKPEEGNNIDCCSWDGVQCNENTGHVIKLDLSSSCLQGSINSSSSLFKLVHLEWLDLAFNDFDGSEIPPEIINLSSLSYLNLSSAAFSGQIPSEILELSKLAYLDLSHNSYYDPVELRKPSLGNLADKLTNLKELVLGDVTISSPIPHNLTYLSSLTTLSLSGCDLRGRIPSSLGNITRLIHLDLSFNKLSDELPTFIGTLGSLKELDLLQNNLSGELPNSIGNLASLEQVDLSLNRFLGKVPSSLGNLTQLHWLSLASNDFSGELPASFGNLRSLRTLDVYECKFSGQIPSSLSNLTHLSFLDFSLNNFSGKMDLDIFLVNHKLLYHLFLSTNRLSLLTKATSNTTSHRFRAVSLCSCDLTEIPKFLKNQHHLELLDLASNKINGKVPKWLLDPSMQNFGHLNLSHNFLTGFDQHPNTVNYLVSNNSLTGEIPSWICNLSNRLESLDLSYNNLSGLLPQCLGNFSDWLSILDLQHNKFSGTIPDNLLKGNILKVIDLSDNLLQGRIPRSLANCSNLEFLDLGDNQIRDIFPSWLGTLPDLNVLILKSNKFHGLIREPKTDCGFPKLRIIDLSKNRFTGKLPSMAFQCWNAMKVVNASELRYMQEVIPFNEGNGIYDYSLTMSNKGQMMSYKKIPDILTAVILSSNRFDGEIPTSISNLKGLQILSLADNSLHGHIPSCLGNLTDLESLDLSNNRFSGQIPQQLVELTFLEFFNVSDNHFTGPIPQGKQFATFDKTSFDGNSGLCGRPLSSECEISEAPTNEDQIEDSEESLLSGVSDWKIILIGYAGGLIVGVEAMGGSLFTISMQFVFSLIFFNFTIANFTSSMLSPLCHGYERSALLQFKESLTIIRKTSYYIWDPCHPKTASWKPEEANIDCCSQWRTQKLK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4FCG, chain A
Confidence level:very confident
Coverage over the Query: 5-27,41-153,185-236,262-352
View the alignment between query and template
View the model in PyMOL
Template: 4FCG, chain A
Confidence level:very confident
Coverage over the Query: 41-153,185-228,239-382
View the alignment between query and template
View the model in PyMOL
Template: 3O53, chain A
Confidence level:very confident
Coverage over the Query: 486-649,674-770
View the alignment between query and template
View the model in PyMOL
Template: 3T6Q, chain A
Confidence level:very confident
Coverage over the Query: 98-153,185-355,382-383,396-455,476-632,679-790
View the alignment between query and template
View the model in PyMOL
Template: 2Z66, chain A
Confidence level:very confident
Coverage over the Query: 97-363
View the alignment between query and template
View the model in PyMOL
Template: 3J0A, chain A
Confidence level:very confident
Coverage over the Query: 119-318,340-359,377-452,472-630,673-801
View the alignment between query and template
View the model in PyMOL
Template: 3RGZ, chain A
Confidence level:very confident
Coverage over the Query: 5-25,41-382,407-451,471-801
View the alignment between query and template
View the model in PyMOL
Template: 3RIZ, chain A
Confidence level:confident
Coverage over the Query: 57-107,131-190,220-381,406-432,454-673,684-802
View the alignment between query and template
View the model in PyMOL