Citrus Sinensis ID: 047985


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930
MLWPLCHGDERSALLQFKESLIISESKEIDTLYGPIFCHPKAASWKPEEGNNIDCCSWDGVQCNENTGHVIKLDLSSSCLQGSINSSSSLFKLVHLEWLDLAFNDFDGSEIPPEIINLSSLSYLNLSSAAFSGQIPSEILELSKLAYLDLSHNSYYDPVELRKPSLGNLADKLTNLKELVLGDVTISSPIPHNLTYLSSLTTLSLSGCDLRGRIPSSLGNITRLIHLDLSFNKLSDELPTFIGTLGSLKELDLLQNNLSGELPNSIGNLASLEQVDLSLNRFLGKVPSSLGNLTQLHWLSLASNDFSGELPASFGNLRSLRTLDVYECKFSGQIPSSLSNLTHLSFLDFSLNNFSGKMDLDIFLVNHKLLYHLFLSTNRLSLLTKATSNTTSHRFRAVSLCSCDLTEIPKFLKNQHHLELLDLASNKINGKVPKWLLDPSMQNFGHLNLSHNFLTGFDQHPNTVNYLVSNNSLTGEIPSWICNLSNRLESLDLSYNNLSGLLPQCLGNFSDWLSILDLQHNKFSGTIPDNLLKGNILKVIDLSDNLLQGRIPRSLANCSNLEFLDLGDNQIRDIFPSWLGTLPDLNVLILKSNKFHGLIREPKTDCGFPKLRIIDLSKNRFTGKLPSMAFQCWNAMKVVNASELRYMQEVIPFNEGNGIYDYSLTMSNKGQMMSYKKIPDILTAVILSSNRFDGEIPTSISNLKGLQILSLADNSLHGHIPSCLGNLTDLESLDLSNNRFSGQIPQQLVELTFLEFFNVSDNHFTGPIPQGKQFATFDKTSFDGNSGLCGRPLSSECEISEAPTNEDQIEDSEESLLSGVSDWKIILIGYAGGLIVGVEAMGGSLFTISMQFVFSLIFFNFTIANFTSSMLSPLCHGYERSALLQFKESLTIIRKTSYYIWDPCHPKTASWKPEEANIDCCSQWRTQKLK
cccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccEEEccccccEEEEEcccccccEEEcccccccccccccEEEccccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccHHHHHcccccccEEEcccccccccccHHccccccccEEEcccccccccccccccccccccEEEcccccccccccHHccccccccEEEcccccccccccHHHHccccccEEEcccccccccccccccccccccEEEccccccEEEccccccccccccEEEcccccccccccHHccccccccEEEccccccEEEEcccccccccccccEEEccccEEEEEcccccccccccccEEEEcccccccccHHHcccccccEEEcccccccccccHHHHccccccccEEEccccccccccccccccEEEEEccccEEEccHHHHHccccccEEEccccccccccccHHHHccccccEEEccccccEEEccccccccccccEEEccccEEcccccHHHHHcccccEEEcccccccccccHHccccccccEEEccccccEEEccccccccccccccEEEcccccccccccHHHHHHHHHHHcccccccccccccccccccccEEEEEEEEEEccccccccccccccEEEEcccccccccccHHHHccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEcEEEEEEEHHHHcccccHHHHHHHHHHccccEEccccccccccccccccccEEEEEEEEEEccccccccccccccccccccccccccccHHHHHHccc
cccccccHcHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccEEEEcccccEEEEEEccccccEEEcccccHHcccccccEEEccccccccccccHHHccccccEEEEcccccccccccHHHHcccccEEEEccccccccccccccccHHHHHHHcccccEEEcccccccccccHHHHHcccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccEEccccccccccccEEEcccccccEEccccccccccccEEEccccccccccHHHHcccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHHHHccccccEEEccccccccccccHccccccccEEEEccccccccccHHHcccccccEEEcccccccccccHHHHccccccHHHHccccccccccccccccEEEEEccccccccccHHHHccccccEEEEcccccccccccHHHHcHHcHcEEEEcccccccccccHHHccccccEEEEcccccccccccHHHHcccccEEEEcccccccccccHHHccccccEEEEEcccccccccccccccccccccEEEEEccccccccccHHHHHHHHHHHHHcccccccccccccccccccEEEHHHEEccccccHHHHcccccEEEEEcccccccccccHHHHcHHHHcEEEccccccccccccHccccccccEEEccccccEEcccHHHHHcccccEEEccccEEEEEccccccHHHccHHHcccccEEEcccccccccccccccccccccccccccccccccEEEEEEEHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHccccccccccccHccHHHHHHHHHHccccEEccccccccccccccccccEcccccccccccccccHccc
mlwplchgderSALLQFKESLIISEskeidtlygpifchpkaaswkpeegnnidccswdgvqcnentghvikldlsssclqgsinssssLFKLVHLEWLdlafndfdgseippeiiNLSSlsylnlssaafsgqipSEILELSKLAYldlshnsyydpvelrkpslgnlADKLTNlkelvlgdvtisspiphnltylsslttlslsgcdlrgripsslgnITRLIHLDLSFNKLSDELPTFIGTLGSLKELDLLQnnlsgelpnsignlASLEQVDLSLNRFLgkvpsslgnltqlHWLSLasndfsgelpasfgnlrslrtldvyeckfsgqipsslsnlthlsfldfslnnfsgkmdldiFLVNHKLLYHLFLSTNRLSLLTkatsnttshrfravslcscdlteipkflknqHHLELLDLASnkingkvpkwlldpsmqnfghlnlshnfltgfdqhpntvnylvsnnsltgeipSWICNLSNRLESLDLsynnlsgllpqclgnfSDWLSILDLQhnkfsgtipdnllkgniLKVIdlsdnllqgriprslancsnlefldlgdnqirdifpswlgtlpdlnvlilksnkfhglirepktdcgfpklrIIDLsknrftgklpsmAFQCWNAMKVVNASELRYMQevipfnegngiydysltmsnkgqmmsykkIPDILTAVILssnrfdgeiptsisnlkglqilsladnslhghipsclgnltdlesldlsnnrfsgqipqQLVELTFLEffnvsdnhftgpipqgkqfatfdktsfdgnsglcgrplsseceiseaptnedqieDSEESLLSGVSDWKIILIGYAGGLIVGVEAMGGSLFTISMQFVFSLIFFNFTIAnftssmlsplchgyerSALLQFKESLTIirktsyyiwdpchpktaswkpeeanidcCSQWRTQKLK
mlwplchgdeRSALLQFKESLIISESKEIDTLYGPIFCHPKAASWKPEEGNNIDCCSWDGVQCNENTGHVIKLDLSSSCLQGSINSSSSLFKLVHLEWLDLAFNDFDGSEIPPEIINLSSLSYLNLSSAAFSGQIPSEILELSKLAYLDLSHNSYYDPVELRKPSLGNLADKLTNLKELVLGDVTISSPIPHNLTYLSSLTTLSLSGCDLRGRIPSSLGNITRLIHLDLSFNKLSDELPTFIGTLGSLKELDLLQNNLSGELPNSIGNLASLEQVDLSLNRFLGKVPSSLGNLTQLHWLSLASNDFSGELPASFGNLRSLRTLDVYECKFSGQIpsslsnltHLSFLDFSLNNFSGKMDLDIFLVNHKLLYHLFLSTNRLSLLTKatsnttshrfRAVSLCSCDLTEIPKFLKNQHHLELLDLASNKINGKVPKWLLDPSMQNFGHLNLSHNFLTGFDQHPNTVNYLVSNNSLTGEIPSWICNLSNRLESLDLSYNNLSGLLPQCLGNFSDWLSILDLQHNKFSGTIPDNLLKGNILKVIDLSDNLLQGRIPRSLANCSNLEFLDLGDNQIRDIFPSWLGTLPDLNVLILKSNKFhglirepktdcgfpkLRIIDLSKNRFTGKLPSMAFQCWNAMKVVNASELRYMQEVIPFNEGNGIYDYSLTMSNKGQMMSYKKIPDILTAVILSSNRFDGEIPTSISNLKGLQILSLADNSLHGHIPSCLGNLTDLESLDLSNNRFSGQIPQQLVELTFLEFFNVSDNHFTGPIPQGKQFATFDKTSFDGNSGLCGRPLSSECEISeaptnedqieDSEESLLSGVSDWKIILIGYAGGLIVGVEAMGGSLFTISMQFVFSLIFFNFTIANFTSSMLSPLCHGYERSALLQFKESLTIIRKTSYYIWDPCHpktaswkpeeanIDCCSQWRTQKLK
MLWPLCHGDERSALLQFKESLIISESKEIDTLYGPIFCHPKAASWKPEEGNNIDCCSWDGVQCNENTGHVIKLDLSSSCLQGSINSSSSLFKLVHLEWLDLAFNDFDGSEIPPEIInlsslsylnlssAAFSGQIPSEILELSKLAYLDLSHNSYYDPVELRKPSLGNLADKLTNLKELVLGDVTISSPIPHNltylsslttlslsGCDLRGRIPSSLGNITRLIHLDLSFNKLSDELPTFIGTLGSLKELDLLQNNLSGELPNSIGNLASLEQVDLSLNRFLGKVPSSLGNLTQLHWLSLASNDFSGELPASFGNLRSLRTLDVYECKFSGQIPSSLSNLTHLSFLDFSLNNFSGKMDLDIFLVNHKLLYHLFLSTNRLSLLTKATSNTTSHRFRAVSLCSCDLTEIPKFLKNQHHLELLDLASNKINGKVPKWLLDPSMQNFGHLNLSHNFLTGFDQHPNTVNYLVSNNSLTGEIPSWICNLSNRLESLDLSYNNLSGLLPQCLGNFSDWLSILDLQHNKFSGTIPDNLLKGNILKVIDLSDNLLQGRIPRSLANCSNLEFLDLGDNQIRDIFPSWLGTLPDLNVLILKSNKFHGLIREPKTDCGFPKLRIIDLSKNRFTGKLPSMAFQCWNAMKVVNASELRYMQEVIPFNEGNGIYDYSLTMSNKGQMMSYKKIPDILTAVILSSNRFDGEIPTSISNLKGLQILSLADNSLHGHIPSCLGNLTDLESLDLSNNRFSGQIPQQLVELTFLEFFNVSDNHFTGPIPQGKQFATFDKTSFDGNSGLCGRPLSSECEISEAPTNEDQIEDSEESLLSGVSDWKIILIGYAGGLIVGVEAMGGSLFTISMQFVFSLIFFNFTIANFTSSMLSPLCHGYERSALLQFKESLTIIRKTSYYIWDPCHPKTASWKPEEANIDCCSQWRTQKLK
**WPLCHGDERSALLQFKESLIISESKEIDTLYGPIFCHPKAASWKPEEGNNIDCCSWDGVQCNENTGHVIKLDL***************FKLVHLEWLDLAFNDFDGSEIPPEIINLSSLSYLNLSSAAFSGQIPSEILELSKLAYLDLSHNSYYDPVELRKPSLGNLADKLTNLKELVLGDVTISSPIPHNLTYLSSLTTLSLSGCDLRGRIPSSLGNITRLIHLDLSFNKLSDELPTFIGTLGSLKELDLLQNNLSGELPNSIGNLASLEQVDLSLNRFLGKVPSSLGNLTQLHWLSLASNDFSGELPASFGNLRSLRTLDVYECKFSGQIPSSLSNLTHLSFLDFSLNNFSGKMDLDIFLVNHKLLYHLFLSTNRLSLLTKATSNTTSHRFRAVSLCSCDLTEIPKFLKNQHHLELLDLASNKINGKVPKWLLDPSMQNFGHLNLSHNFLTGFDQHPNTVNYLVSNNSLTGEIPSWICNLSNRLESLDLSYNNLSGLLPQCLGNFSDWLSILDLQHNKFSGTIPDNLLKGNILKVIDLSDNLLQGRIPRSLANCSNLEFLDLGDNQIRDIFPSWLGTLPDLNVLILKSNKFHGLIREPKTDCGFPKLRIIDLSKNRFTGKLPSMAFQCWNAMKVVNASELRYMQEVIPFNEGNGIYDYSLTMSNKGQMMSYKKIPDILTAVILSSNRFDGEIPTSISNLKGLQILSLADNSLHGHIPSCLGNLTDLESLDLSNNRFSGQIPQQLVELTFLEFFNVSDNHFTGPIPQGKQFATFDK*************************************LSGVSDWKIILIGYAGGLIVGVEAMGGSLFTISMQFVFSLIFFNFTIANFTSSMLSPLCHGYERSALLQFKESLTIIRKTSYYIWDPCHPKTASWKPEEANIDCCSQW******
M*WPLCHGDERSALLQFKESLIISESKEIDTLYGPIFCHPKAASWKPEEGNNIDCCSWDGVQCNENTGHVIKLDLSSSCLQGSINSSSSLFKLVHLEWLDLAFNDFDGSEIPPEIINLSSLSYLNLSSAAFSGQIPSEILELSKLAYLDLSHNSYYDPVELRKPSLGNLADKLTNLKELVLGDVTISSPIPHNLTYLSSLTTLSLSGCDLRGRIPSSLGNITRLIHLDLSFNKLSDELPTFIGTLGSLKELDLLQNNLSGELPNSIGNLASLEQVDLSLNRFLGKVPSSLGNLTQLHWLSLASNDFSGELPASFGNLRSLRTLDVYECKFSGQIPSSLSNLTHLSFLDFSLNNFSGKMDLDIFLVNHKLLYHLFLSTNRLSLLTKATSNTTSHRFRAVSLCSCDLTEIPKFLKNQHHLELLDLASNKINGKVPKWLLDPSMQNFGHLNLSHNFLTGFDQHPNTVNYLVSNNSLTGEIPSWICNLSNRLESLDLSYNNLSGLLPQCLGNFSDWLSILDLQHNKFSGTIPDNLLKGNILKVIDLSDNLLQGRIPRSLANCSNLEFLDLGDNQIRDIFPSWLGTLPDLNVLILKSNKFHGLIREPKTDCGFPKLRIIDLSKNRFTGKLPSMAFQCWNA*************EVIPFNEGNGIYDYSLTMSNKGQMMSYKKIPDILTAVILSSNRFDGEIPTSISNLKGLQILSLADNSLHGHIPSCLGNLTDLESLDLSNNRFSGQIPQQLVELTFLEFFNVSDNHFTGPIPQGKQFATFDKTSFDGNSGLCGRPL**************************VSDWKIILIGYAGGLIVGVEAMGGSLFTISMQFVFSLIFFNFTIANFTSSMLSPLCHGYERSALLQFKESLTIIRKTSYYIWDPCHPKTASWKPEEANIDCCSQWRTQK**
MLWPLCHGDERSALLQFKESLIISESKEIDTLYGPIFCHPKAASWKPEEGNNIDCCSWDGVQCNENTGHVIKLDLSSSCLQGSINSSSSLFKLVHLEWLDLAFNDFDGSEIPPEIINLSSLSYLNLSSAAFSGQIPSEILELSKLAYLDLSHNSYYDPVELRKPSLGNLADKLTNLKELVLGDVTISSPIPHNLTYLSSLTTLSLSGCDLRGRIPSSLGNITRLIHLDLSFNKLSDELPTFIGTLGSLKELDLLQNNLSGELPNSIGNLASLEQVDLSLNRFLGKVPSSLGNLTQLHWLSLASNDFSGELPASFGNLRSLRTLDVYECKFSGQIPSSLSNLTHLSFLDFSLNNFSGKMDLDIFLVNHKLLYHLFLSTNRLSLLTKATSNTTSHRFRAVSLCSCDLTEIPKFLKNQHHLELLDLASNKINGKVPKWLLDPSMQNFGHLNLSHNFLTGFDQHPNTVNYLVSNNSLTGEIPSWICNLSNRLESLDLSYNNLSGLLPQCLGNFSDWLSILDLQHNKFSGTIPDNLLKGNILKVIDLSDNLLQGRIPRSLANCSNLEFLDLGDNQIRDIFPSWLGTLPDLNVLILKSNKFHGLIREPKTDCGFPKLRIIDLSKNRFTGKLPSMAFQCWNAMKVVNASELRYMQEVIPFNEGNGIYDYSLTMSNKGQMMSYKKIPDILTAVILSSNRFDGEIPTSISNLKGLQILSLADNSLHGHIPSCLGNLTDLESLDLSNNRFSGQIPQQLVELTFLEFFNVSDNHFTGPIPQGKQFATFDKTSFDGNSGLCGRPLSSECE******************LSGVSDWKIILIGYAGGLIVGVEAMGGSLFTISMQFVFSLIFFNFTIANFTSSMLSPLCHGYERSALLQFKESLTIIRKTSYYIWDPCHPKTASWKPEEANIDCCSQWRTQKLK
*LWPLCHGDERSALLQFKESLIISESKEIDTLYGPIFCHPKAASWKPEEGNNIDCCSWDGVQCNENTGHVIKLDLSSSCLQGSINSSSSLFKLVHLEWLDLAFNDFDGSEIPPEIINLSSLSYLNLSSAAFSGQIPSEILELSKLAYLDLSHNSYYDPVELRKPSLGNLADKLTNLKELVLGDVTISSPIPHNLTYLSSLTTLSLSGCDLRGRIPSSLGNITRLIHLDLSFNKLSDELPTFIGTLGSLKELDLLQNNLSGELPNSIGNLASLEQVDLSLNRFLGKVPSSLGNLTQLHWLSLASNDFSGELPASFGNLRSLRTLDVYECKFSGQIPSSLSNLTHLSFLDFSLNNFSGKMDLDIFLVNHKLLYHLFLSTNRLSLLTKATSNTTSHRFRAVSLCSCDLTEIPKFLKNQHHLELLDLASNKINGKVPKWLLDPSMQNFGHLNLSHNFLTGFDQHPNTVNYLVSNNSLTGEIPSWICNLSNRLESLDLSYNNLSGLLPQCLGNFSDWLSILDLQHNKFSGTIPDNLLKGNILKVIDLSDNLLQGRIPRSLANCSNLEFLDLGDNQIRDIFPSWLGTLPDLNVLILKSNKFHGLIREPKTDCGFPKLRIIDLSKNRFTGKLPSMAFQCWNAMKVVNASELRYMQEVIPFNEGNGIYDYSLTMSNKGQMMSYKKIPDILTAVILSSNRFDGEIPTSISNLKGLQILSLADNSLHGHIPSCLGNLTDLESLDLSNNRFSGQIPQQLVELTFLEFFNVSDNHFTGPIPQGKQFATFDKTSFDGNSGLCGRPLSSECE*******************SGVSDWKIILIGYAGGLIVGVEAMGGSLFTISMQFVFSLIFFNFTIANFTSSMLSPLCHGYERSALLQFKESLTIIRKTSYYIWDPCHPKTASWK*****IDCCSQWRT*KLK
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLWPLCHGDERSALLQFKESLIISESKEIDTLYGPIFCHPKAASWKPEEGNNIDCCSWDGVQCNENTGHVIKLDLSSSCLQGSINSSSSLFKLVHLEWLDLAFNDFDGSEIPPEIINLSSLSYLNLSSAAFSGQIPSEILELSKLAYLDLSHNSYYDPVELRKPSLGNLADKLTNLKELVLGDVTISSPIPHNLTYLSSLTTLSLSGCDLRGRIPSSLGNITRLIHLDLSFNKLSDELPTFIGTLGSLKELDLLQNNLSGELPNSIGNLASLEQVDLSLNRFLGKVPSSLGNLTQLHWLSLASNDFSGELPASFGNLRSLRTLDVYECKFSGQIPSSLSNLTHLSFLDFSLNNFSGKMDLDIFLVNHKLLYHLFLSTNRLSLLTKATSNTTSHRFRAVSLCSCDLTEIPKFLKNQHHLELLDLASNKINGKVPKWLLDPSMQNFGHLNLSHNFLTGFDQHPNTVNYLVSNNSLTGEIPSWICNLSNRLESLDLSYNNLSGLLPQCLGNFSDWLSILDLQHNKFSGTIPDNLLKGNILKVIDLSDNLLQGRIPRSLANCSNLEFLDLGDNQIRDIFPSWLGTLPDLNVLILKSNKFHGLIREPKTDCGFPKLRIIDLSKNRFTGKLPSMAFQCWNAMKVVNASELRYMQEVIPFNEGNGIYDYSLTMSNKGQMMSYKKIPDILTAVILSSNRFDGEIPTSISNLKGLQILSLADNSLHGHIPSCLGNLTDLESLDLSNNRFSGQIPQQLVELTFLEFFNVSDNHFTGPIPQGKQFATFDKTSFDGNSGLCGRPLSSECEISEAPTNEDQIEDSEESLLSGVSDWKIILIGYAGGLIVGVEAMGGSLFTISMQFVFSLIFFNFTIANFTSSMLSPLCHGYERSALLQFKESLTIIRKTSYYIWDPCHPKTASWKPEEANIDCCSQWRTQKLK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query930 2.2.26 [Sep-21-2011]
Q9C9H7847 Receptor-like protein 12 no no 0.808 0.887 0.342 1e-119
Q9FL28 1173 LRR receptor-like serine/ no no 0.748 0.593 0.319 8e-81
Q9LVP0 1102 Probable leucine-rich rep no no 0.746 0.629 0.330 1e-76
Q9LP24 1120 Probable leucine-rich rep no no 0.717 0.595 0.315 1e-73
O49318 1124 Probable leucine-rich rep no no 0.708 0.586 0.322 6e-73
C0LGQ5 1249 LRR receptor-like serine/ no no 0.724 0.539 0.327 1e-69
P93194 1109 Receptor-like protein kin N/A no 0.667 0.559 0.311 8e-66
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.705 0.523 0.299 3e-64
Q9FZ59 1088 Leucine-rich repeat recep no no 0.689 0.589 0.317 1e-63
Q9LYN8 1192 Leucine-rich repeat recep no no 0.660 0.515 0.304 8e-63
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function desciption
 Score =  429 bits (1102), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 296/864 (34%), Positives = 443/864 (51%), Gaps = 112/864 (12%)

Query: 5   LCHGDERSALLQFKESLIISESKEIDTLYGPIFCHPKAASWKPEEGNNIDCCSWDGVQCN 64
            C  D+R ALL+F+    I+ S  I               W+     + DCC W+GV CN
Sbjct: 33  FCRDDQRDALLEFRGEFPINASWHI------------MNQWRGPWNKSTDCCLWNGVTCN 80

Query: 65  ENTGHVIKLDLSSSCLQGSINSSSSLFKLVHLEWLDLAFNDFDGSEIPPEIINLSSLSYL 124
           + +G VI LD+ ++ L   + ++SSLFKL +L  LDL                       
Sbjct: 81  DKSGQVISLDIPNTFLNNYLKTNSSLFKLQYLRHLDL----------------------- 117

Query: 125 NLSSAAFSGQIPSEILELSKLAYLDLSHNSYYDPVELRKPSLGNLADKLTNLKELVLGDV 184
             ++    G+IPS +  LS L  ++L  N +   +     S+GNL      L+ L+L + 
Sbjct: 118 --TNCNLYGEIPSSLGNLSHLTLVNLYFNKFVGEI---PASIGNL----NQLRHLILANN 168

Query: 185 TISSPIPHNLTYLSSLTTLSLSGCDLRGRIPSSLGNITRLIHLDLSFNKLSDELPTFIGT 244
                                    L G IPSSLGN++RL++L+L  N+L  ++P  IG 
Sbjct: 169 V------------------------LTGEIPSSLGNLSRLVNLELFSNRLVGKIPDSIGD 204

Query: 245 LGSLKELDLLQNNLSGELPNSIGNLASLEQVDLSLNRFLGKVPSSLGNLTQLHWLSLASN 304
           L  L+ L L  NNL GE+P+S+GNL++L  + L+ N+ +G+VP+S+GNL +L  +S  +N
Sbjct: 205 LKQLRNLSLASNNLIGEIPSSLGNLSNLVHLVLTHNQLVGEVPASIGNLIELRVMSFENN 264

Query: 305 DFSGELPASFGNLRSLRTLDVYECKFSGQIPSSLSNLTHLSFLDFSLNNFSGKMDLDIFL 364
             SG +P SF NL  L    +    F+   P  +S   +L + D S N+FSG     + L
Sbjct: 265 SLSGNIPISFANLTKLSIFVLSSNNFTSTFPFDMSIFHNLEYFDVSYNSFSGPFPKSLLL 324

Query: 365 VNHKLLYHLFLSTNRLSLLTKATSNTTSHRFRAVSLCSCDL-TEIPKFLKNQHHLELLDL 423
           +    L  ++L  N+ +   +  + ++S + + + L    L   IP+ +    +LE LD+
Sbjct: 325 I--PSLESIYLQENQFTGPIEFANTSSSTKLQDLILGRNRLHGPIPESISRLLNLEELDI 382

Query: 424 ASNKINGKVPKWLLDPSMQNFGHLNLSHNFLTG------------------FDQHPNT-- 463
           + N   G +P  +    + N  HL+LS N L G                  F    NT  
Sbjct: 383 SHNNFTGAIPPTI--SKLVNLLHLDLSKNNLEGEVPACLWRLNTMVLSHNSFSSFENTSQ 440

Query: 464 ----VNYL-VSNNSLTGEIPSWICNLSNRLESLDLSYNNLSGLLPQCLGNFSDWLSILDL 518
               +  L +++NS  G IP  IC LS+ L  LDLS N  SG +P C+ NFS  +  L+L
Sbjct: 441 EEALIEELDLNSNSFQGPIPYMICKLSS-LGFLDLSNNLFSGSIPSCIRNFSGSIKELNL 499

Query: 519 QHNKFSGTIPDNLLKGNILKVIDLSDNLLQGRIPRSLANCSNLEFLDLGDNQIRDIFPSW 578
             N FSGT+PD   K   L  +D+S N L+G+ P+SL NC  LE +++  N+I+DIFPSW
Sbjct: 500 GDNNFSGTLPDIFSKATELVSLDVSHNQLEGKFPKSLINCKALELVNVESNKIKDIFPSW 559

Query: 579 LGTLPDLNVLILKSNKFHGLIREPKTDCGFPKLRIIDLSKNRFTGKLPSMAFQCWNAMKV 638
           L +LP L+VL L+SNKF+G +       GF  LRIID+S N F+G LP   F  W  M  
Sbjct: 560 LESLPSLHVLNLRSNKFYGPLYHRHASIGFQSLRIIDISHNNFSGTLPPYYFSNWKDMTT 619

Query: 639 VNASELRYMQEVIPFNEGNGIYDYSLTMSNKGQMMSYKKIPDILTAVILSSNRFDGEIPT 698
           +     +YM E   + +    Y + + M NKG  MS+++I     A+  S N+ +G IP 
Sbjct: 620 LTEEMDQYMTEFWRYADS---YYHEMEMVNKGVDMSFERIRRDFRAIDFSGNKINGNIPE 676

Query: 699 SISNLKGLQILSLADNSLHGHIPSCLGNLTDLESLDLSNNRFSGQIPQQLVELTFLEFFN 758
           S+  LK L++L+L+ N+    IP  L NLT LE+LD+S N+ SGQIPQ L  L+FL + N
Sbjct: 677 SLGYLKELRVLNLSGNAFTSVIPRFLANLTKLETLDISRNKLSGQIPQDLAALSFLSYMN 736

Query: 759 VSDNHFTGPIPQGKQFATFDKTSFDGNSGLCGRPLSSECEISEA--PTNE--DQIEDSEE 814
            S N   GP+P+G QF     +SF  N GL G  L   C  + A  PT++  + + ++EE
Sbjct: 737 FSHNLLQGPVPRGTQFQRQKCSSFLDNPGLYG--LEDICRDTGALNPTSQLPEDLSEAEE 794

Query: 815 SLLSGVSDWKIILIGYAGGLIVGV 838
           ++     +W    I Y  G++ G+
Sbjct: 795 NMF----NWVAAAIAYGPGVLCGL 814




Involved in the perception of CLV3 and CLV3-like peptides, that act as extracellular signals regulating meristems maintenance.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function description
>sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|P93194|RPK1_IPONI Receptor-like protein kinase OS=Ipomoea nil GN=INRPK1 PE=2 SV=2 Back     alignment and function description
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|Q9FZ59|PEPR2_ARATH Leucine-rich repeat receptor-like protein kinase PEPR2 OS=Arabidopsis thaliana GN=PEPR2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query930
359485824973 PREDICTED: receptor-like protein 12-like 0.884 0.845 0.495 0.0
359490156886 PREDICTED: receptor-like protein 12-like 0.864 0.907 0.495 0.0
359485822993 PREDICTED: receptor-like protein 12-like 0.878 0.822 0.465 0.0
255548694984 serine/threonine-protein kinase bri1, pu 0.875 0.827 0.435 0.0
147782974 1719 hypothetical protein VITISV_036826 [Viti 0.902 0.488 0.450 0.0
224140517979 predicted protein [Populus trichocarpa] 0.880 0.836 0.451 0.0
224140513947 predicted protein [Populus trichocarpa] 0.882 0.866 0.458 0.0
1478046701004 hypothetical protein VITISV_022039 [Viti 0.883 0.818 0.445 0.0
224140509961 predicted protein [Populus trichocarpa] 0.882 0.854 0.432 0.0
147766212925 hypothetical protein VITISV_018438 [Viti 0.887 0.891 0.458 0.0
>gi|359485824|ref|XP_003633343.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  744 bits (1920), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/923 (49%), Positives = 561/923 (60%), Gaps = 100/923 (10%)

Query: 1   MLWPLCHGDERSALLQFKESLIISESKEIDTLYGPIFCHPKAASWKPE---EGNNIDCCS 57
           M  PLCH  E SALLQFK+S +I E        G    +PK A WK     E    DCCS
Sbjct: 31  MHRPLCHDSEGSALLQFKQSFLIDEHAS-----GNPSAYPKVAMWKSHGEGEREGSDCCS 85

Query: 58  WDGVQCNENTGHVIKLDLSSSCLQGSINSSSSLFKLVHLEWLDLAFNDFDGSEIPPEIIN 117
           WDGV+C+  TGHVI L L+SSCL GSINSSS+LF LVHL+ LDL+ NDF+ SEIP  +  
Sbjct: 86  WDGVECDRETGHVIGLHLASSCLYGSINSSSTLFSLVHLQRLDLSDNDFNYSEIPFGVGQ 145

Query: 118 LSSLSYLNLSSAAFSGQIPSEILELSKLAYLDLSHNSYYDPVELRKPSLGNLADKLTNLK 177
           LS L  L+LS + FSGQIPSE+L LSKL +LDLS N     ++L+KP L NL   LT+LK
Sbjct: 146 LSRLRSLDLSFSGFSGQIPSELLALSKLVFLDLSANP---KLQLQKPGLRNLVQNLTHLK 202

Query: 178 ELVLGDVTISSPIPHNLTYLSSLTTLSLSGCDLRGRIPSSLGNITRLIHL---------- 227
           +L L  V ISS IP+ L  LSSLT+L L  C L G  P  +  +  L +L          
Sbjct: 203 KLHLSQVNISSTIPYELASLSSLTSLFLGECGLHGEFPMKIFQLPSLQYLTVRDNLDLIS 262

Query: 228 --------------DLSFNKLSDELPTFIGTLGSLKELDLLQNNLSGELPNSIGNLASLE 273
                         DL+    S ELPT IG LGSL ELD+   N +G +P+S+G+L  L 
Sbjct: 263 YLPEFQETSPLKMLDLAGTSFSGELPTSIGRLGSLTELDISSCNFTGSVPSSLGHLTQLY 322

Query: 274 QVDLSLNRFLGKVPSSLGNLTQLHWLSLASNDFS------------------------GE 309
            +DLS N F G++PSS+ NLTQL +LSL+ NDF+                        GE
Sbjct: 323 YLDLSNNHFSGQIPSSMANLTQLIYLSLSWNDFNVGTLSWLGQQTKLTYLYLNQINLIGE 382

Query: 310 LPASFGNLRSLRTLDVYECKFSGQIPSSLSNLTHLSFLDFSLNNFSGKMDLDIFLVNHKL 369
           +P S  N+  L  L + + + SGQIPSSL  L +L  L    N  +G ++L + L   K 
Sbjct: 383 IPFSLVNMSQLNILSLSDNQLSGQIPSSLFELVNLQGLYLLSNYLNGTVELQL-LSKLKN 441

Query: 370 LYHLFLSTNRLSLLTKATSNTTSHRFRAVSLCSCDLTEIPKFLKNQHHLELLDLASNKIN 429
           L +L LS NRLS L+   +N T  +F+ + L SC+LTE P FL+NQH LE++ L+ NKI+
Sbjct: 442 LIYLQLSDNRLSFLSYTRTNATLPKFKHLGLGSCNLTEFPDFLQNQHELEIITLSENKIH 501

Query: 430 GKVPKWLLDPSMQNFGHLNLSHNFLTGFDQHP---------------------------N 462
           G +PKW+ + S +    L LS NFLTGFDQ P                           +
Sbjct: 502 GPIPKWVWNISKETLVTLELSENFLTGFDQRPFVLPWSKLHTLRLDSNMLQGPLPVPPPS 561

Query: 463 TVNYLVSNNSLTGEIPSWICNLSNRLESLDLSYNNLSGLLPQCLGNFSDWLSILDLQHNK 522
           TV YLVS N LTGEI   ICN+++ LE LDLS NNLSG +PQCL NFS  L +LDL  N 
Sbjct: 562 TVEYLVSGNKLTGEISPLICNMTS-LELLDLSSNNLSGRIPQCLANFSRSLFVLDLGSNS 620

Query: 523 FSGTIPDNLLKGNILKVIDLSDNLLQGRIPRSLANCSNLEFLDLGDNQIRDIFPSWLGTL 582
             G IP+     + L VIDL DN  QG+IPRSL NC+ LE L LG+N+I DIFP WLG L
Sbjct: 621 LDGPIPEICTVSHNLNVIDLGDNQFQGQIPRSLVNCTMLEHLVLGNNKINDIFPFWLGAL 680

Query: 583 PDLNVLILKSNKFHGLIREPKTDCGFPKLRIIDLSKNRFTGKLPSMAFQCWNAMKVVN-A 641
           P L VLIL+SN+FHG I    T+  FPKLRIIDLS N F G LPS  FQ W+AMK+ + A
Sbjct: 681 PQLQVLILRSNRFHGAIGSWHTNFRFPKLRIIDLSDNEFIGDLPSEYFQNWDAMKLTDIA 740

Query: 642 SELRYMQEVIPFNEGNGI----YDYSLTMSNKGQMMSYKKIPDILTAVILSSNRFDGEIP 697
           S LRYMQ     +  N +    Y YS+TM+NKG    Y++I D   A+  S N F G+IP
Sbjct: 741 SGLRYMQISPMIDLKNNVMITGYMYSMTMTNKGMQRFYERILDTFMAIDFSGNNFKGQIP 800

Query: 698 TSISNLKGLQILSLADNSLHGHIPSCLGNLTDLESLDLSNNRFSGQIPQQLVELTFLEFF 757
           TSI +LKG+ +L+L  N L GHIPS LGNLT LESLDLS N+ SG+IP QL  LTFLEFF
Sbjct: 801 TSIGSLKGIHLLNLGGNDLTGHIPSSLGNLTQLESLDLSQNKLSGEIPWQLTRLTFLEFF 860

Query: 758 NVSDNHFTGPIPQGKQFATFDKTSFDGNSGLCGRPLSSECEISEA--PTNEDQIEDSEES 815
           NVS NH TG IPQGKQFATF+  SFDGN GLCG PLS EC  SEA  PT+    + S   
Sbjct: 861 NVSHNHLTGHIPQGKQFATFENASFDGNLGLCGSPLSRECGSSEALPPTSSSSKQGSTTK 920

Query: 816 LLSGVSDWKIILIGYAGGLIVGV 838
                 DWKI+L+GY  GL++GV
Sbjct: 921 F-----DWKIVLMGYGSGLLIGV 938




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359490156|ref|XP_003634044.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359485822|ref|XP_003633342.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255548694|ref|XP_002515403.1| serine/threonine-protein kinase bri1, putative [Ricinus communis] gi|223545347|gb|EEF46852.1| serine/threonine-protein kinase bri1, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147782974|emb|CAN66148.1| hypothetical protein VITISV_036826 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224140517|ref|XP_002323629.1| predicted protein [Populus trichocarpa] gi|222868259|gb|EEF05390.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224140513|ref|XP_002323627.1| predicted protein [Populus trichocarpa] gi|222868257|gb|EEF05388.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147804670|emb|CAN66864.1| hypothetical protein VITISV_022039 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224140509|ref|XP_002323625.1| predicted protein [Populus trichocarpa] gi|222868255|gb|EEF05386.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147766212|emb|CAN63381.1| hypothetical protein VITISV_018438 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query930
TAIR|locus:2078102875 RLP33 "receptor like protein 3 0.878 0.933 0.361 9.6e-128
TAIR|locus:2144392957 RLP53 "receptor like protein 5 0.803 0.780 0.373 3.7e-119
TAIR|locus:2074633943 RLP35 "AT3G11080" [Arabidopsis 0.804 0.793 0.359 9.4e-114
TAIR|locus:2085537894 RLP34 "AT3G11010" [Arabidopsis 0.811 0.844 0.359 2.6e-111
TAIR|locus:2055772983 RLP19 "receptor like protein 1 0.815 0.771 0.351 6.1e-110
TAIR|locus:2090754711 RLP43 "receptor like protein 4 0.619 0.810 0.415 2.4e-108
TAIR|locus:2129246891 RLP50 "receptor like protein 5 0.877 0.915 0.347 8.1e-108
TAIR|locus:2078112868 RLP32 "receptor like protein 3 0.737 0.790 0.369 1.2e-104
TAIR|locus:2119430741 RLP47 "receptor like protein 4 0.745 0.935 0.375 5.3e-104
TAIR|locus:2046357890 RLP23 "receptor like protein 2 0.852 0.891 0.342 3e-101
TAIR|locus:2078102 RLP33 "receptor like protein 33" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1254 (446.5 bits), Expect = 9.6e-128, P = 9.6e-128
 Identities = 312/864 (36%), Positives = 467/864 (54%)

Query:    14 LLQFKESLIISESKEIDTLYGPIFCHPKAASWKPEEGNNIDCCSWDGVQCNENTGHVIKL 73
             L  F++   + E K    +  P F  P     K  E N  DCC WDG+ C+  TG VI++
Sbjct:    29 LCHFEQRDALLEFKNEFKIKKPCFGCPSPLKTKSWE-NGSDCCHWDGITCDAKTGEVIEI 87

Query:    74 DLSSSCLQGSINSSSSLFKL--VH-LEWLDLAFNDFDGSEIPPEIIXXXXXXXXXXXXAA 130
             DL  SCL G  +S+S+L  L   H L  LDL++N   G +I   I               
Sbjct:    88 DLMCSCLHGWFHSNSNLSMLQNFHFLTTLDLSYNHLSG-QISSSIGNLSHLTTLDLSGNN 146

Query:   131 FSGQIPSEILELSKLAYLDLSHNSYYDPVELRKPSLGNLADKLTNLKELVLGDVTISSPI 190
             FSG IPS +  L  L  L L  N++   +     SLGNL+  LT L    L        I
Sbjct:   147 FSGWIPSSLGNLFHLTSLHLYDNNFGGEIP---SSLGNLS-YLTFLD---LSTNNFVGEI 199

Query:   191 PHNXXXXXXXXXXXXXGCDLRGRIPSSLGNITRLIHLDLSFNKLSDELPTFIGTLGSLKE 250
             P +                L G +P  + N+T+L  + LS N+ +  LP  I +L  L+ 
Sbjct:   200 PSSFGSLNQLSILRLDNNKLSGNLPLEVINLTKLSEISLSHNQFTGTLPPNITSLSILES 259

Query:   251 LDLLQNNLSGELPNSIGNLASLEQVDLSLNRFLGKVP-SSLGNLTQLHWLSLASNDFSGE 309
                  NN  G +P+S+  + S+  + L  N+  G +   ++ + + L  L L  N+  G 
Sbjct:   260 FSASGNNFVGTIPSSLFTIPSITLIFLDNNQLSGTLEFGNISSPSNLLVLQLGGNNLRGP 319

Query:   310 LPASFGNLRSLRTLDVYECKFSGQIPSSL-SNLTHLSFLDFSLNNFSGKMDLDIFLVNHK 368
             +P S   L +LRTLD+      GQ+  ++ S+L  L  L  S +N +  +DL+  L   K
Sbjct:   320 IPTSISRLVNLRTLDLSHFNIQGQVDFNIFSHLKLLGNLYLSHSNTTTTIDLNAVLSCFK 379

Query:   369 LLYHLFLSTNRLSLLTKAT-SNTTSHRFRAVSLCSCDLTEIPKFLKNQHHLELLDLASNK 427
             +L  L LS N + +  K++ S+       +++L  C +TE P  L+ Q  +  LD+++NK
Sbjct:   380 MLISLDLSGNHVLVTNKSSVSDPPLGLIGSLNLSGCGITEFPDILRTQRQMRTLDISNNK 439

Query:   428 INGKVPKWLLDPSMQNFGHLNLSHNFLTGFDQH----------PNTVNYLVSNNSLTGEI 477
             I G+VP WLL   +Q   ++++S+N   GF++           P+  ++  SNN+ +G+I
Sbjct:   440 IKGQVPSWLL---LQ-LEYMHISNNNFIGFERSTKLEKTVVPKPSMKHFFGSNNNFSGKI 495

Query:   478 PSWICNLSNRLESLDLSYNNLSGLLPQCLGNFSDWLSILDLQHNKFSGTIPDNLLKGNIL 537
             PS+IC+L + L  LDLS NN SG +P C+G F   LS L+L+ N+ SG++P  ++K   L
Sbjct:   496 PSFICSLRS-LIILDLSNNNFSGAIPPCVGKFKSTLSDLNLRRNRLSGSLPKTIIKS--L 552

Query:   538 KVIDLSDNLLQGRIPRSLANCSNLEFLDLGDNQIRDIFPSWLGTLPDLNVLILKSNKFHG 597
             + +D+S N L+G++PRSL + S LE L++  N+I D FP WL +L  L VL+L+SN FHG
Sbjct:   553 RSLDVSHNELEGKLPRSLIHFSTLEVLNVESNRINDTFPFWLSSLKKLQVLVLRSNAFHG 612

Query:   598 LIREPKTDCGFPKLRIIDLSKNRFTGKLPSMAFQCWNAMKVVNASELRYMQEVIPFNEGN 657
              I + +    FPKLRIID+S+N F G LPS  F  W  M  +  +E R+ ++ +    G+
Sbjct:   613 RIHKTR----FPKLRIIDISRNHFNGTLPSDCFVEWTGMHSLEKNEDRFNEKYM----GS 664

Query:   658 GIYDYSLTMSNKGQMMSYKKIPDILTAVILSSNRFDGEIPTSISNLKGLQILSLADNSLH 717
             G Y  S+ + NKG  M   +I  I TA+  S N+F+GEIP SI  LK L IL+L+ N   
Sbjct:   665 GYYHDSMVLMNKGLEMELVRILKIYTALDFSGNKFEGEIPRSIGLLKELHILNLSSNGFT 724

Query:   718 GHIPSCLGNLTDLESLDLSNNRFSGQIPQQLVELTFLEFFNVSDNHFTGPIPQGKQFATF 777
             GHIPS +GNL +LESLD+S N+ SG+IPQ+L  L++L + N S N   G +P G QF T 
Sbjct:   725 GHIPSSMGNLRELESLDVSRNKLSGEIPQELGNLSYLAYMNFSHNQLVGQVPGGTQFRTQ 784

Query:   778 DKTSFDGNSGLCGRPLSSECEISEAPTNEDQIEDSE-ESLLSGVSDWKIILIGYAGGLIV 836
               +SF+ N GLCGRPL  EC +   PT   + E  E E +LS    W    IG+  G+++
Sbjct:   785 SASSFEENLGLCGRPLE-ECRVVHEPTPSGESETLESEQVLS----WIAAAIGFTPGIVL 839

Query:   837 GVEAMGGSLFTISMQFVFSLIFFN 860
             G+  +G  + +   ++ F +++ N
Sbjct:   840 GL-TIGHIVLSSKPRWFFKVLYIN 862


GO:0005886 "plasma membrane" evidence=ISM
GO:0006952 "defense response" evidence=ISS
GO:0016301 "kinase activity" evidence=ISS
GO:0007165 "signal transduction" evidence=IC
GO:0009507 "chloroplast" evidence=IDA
GO:0000165 "MAPK cascade" evidence=RCA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=RCA
GO:0006457 "protein folding" evidence=RCA
GO:0006612 "protein targeting to membrane" evidence=RCA
GO:0009408 "response to heat" evidence=RCA
GO:0009617 "response to bacterium" evidence=RCA
GO:0009644 "response to high light intensity" evidence=RCA
GO:0009862 "systemic acquired resistance, salicylic acid mediated signaling pathway" evidence=RCA
GO:0009867 "jasmonic acid mediated signaling pathway" evidence=RCA
GO:0010310 "regulation of hydrogen peroxide metabolic process" evidence=RCA
GO:0010363 "regulation of plant-type hypersensitive response" evidence=RCA
GO:0031348 "negative regulation of defense response" evidence=RCA
GO:0034976 "response to endoplasmic reticulum stress" evidence=RCA
GO:0035304 "regulation of protein dephosphorylation" evidence=RCA
GO:0042542 "response to hydrogen peroxide" evidence=RCA
TAIR|locus:2144392 RLP53 "receptor like protein 53" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2074633 RLP35 "AT3G11080" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085537 RLP34 "AT3G11010" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2055772 RLP19 "receptor like protein 19" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090754 RLP43 "receptor like protein 43" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129246 RLP50 "receptor like protein 50" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078112 RLP32 "receptor like protein 32" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119430 RLP47 "receptor like protein 47" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046357 RLP23 "receptor like protein 23" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query930
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-82
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-19
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-15
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-12
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 8e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-07
PLN032101153 PLN03210, PLN03210, Resistant to P 5e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-07
PLN032101153 PLN03210, PLN03210, Resistant to P 9e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 5e-06
PLN032101153 PLN03210, PLN03210, Resistant to P 7e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-05
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 2e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-05
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 3e-05
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 4e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.003
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.003
PRK15370754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 0.003
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  287 bits (735), Expect = 1e-82
 Identities = 244/790 (30%), Positives = 346/790 (43%), Gaps = 203/790 (25%)

Query: 7   HGDERSALLQFKESLIISESKEIDTLYGPIFCHPKAASWKPEEGNNIDCCSWDGVQCNEN 66
           H +E   LL FK S I    K +             ++W      + D C W G+ CN N
Sbjct: 27  HAEELELLLSFKSS-INDPLKYL-------------SNWNS----SADVCLWQGITCN-N 67

Query: 67  TGHVIKLDLSSSCLQGSINSSSSLFKLVHLEWLDLAFNDFDGSEIPPEIINLS-SLSYLN 125
           +  V+ +DLS   + G I  SS++F+L +++ ++L+ N   G  IP +I   S SL YLN
Sbjct: 68  SSRVVSIDLSGKNISGKI--SSAIFRLPYIQTINLSNNQLSG-PIPDDIFTTSSSLRYLN 124

Query: 126 LSSAAFSGQIPSEILELSKLAYLDLSHNSYYDPVELRKPSLGNLADKLTNLKELVLGDVT 185
           LS+  F+G IP     +  L  LDLS+N                                
Sbjct: 125 LSNNNFTGSIPRG--SIPNLETLDLSNN-------------------------------M 151

Query: 186 ISSPIPHNLTYLSSLTTLSLSGCDLRGRIPSSLGNITRLIHLDLSFNKLSDELPTFIGTL 245
           +S  IP+++   SSL  L L G  L G+IP+SL N+T L  L L+ N+L  ++P  +G +
Sbjct: 152 LSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQM 211

Query: 246 GSLKELDLLQNNLSGELPNSIGNLASLEQVDLSLNRFLGKVPSSLGNLTQLHWLSLASND 305
            SLK + L  NNLSGE+P  IG L SL  +DL  N   G +PSSLGNL  L +L L  N 
Sbjct: 212 KSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNK 271

Query: 306 FSGELPASFGNLRSLRTLDVYECKFSGQIPSSLSNLTHLSFLDFSLNNFSGKMDLDIFLV 365
            SG +P S  +L+ L +LD+ +   SG+IP  +  L +L  L    NNF+GK        
Sbjct: 272 LSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGK-------- 323

Query: 366 NHKLLYHLFLSTNRLSLLTKATSNTTSHRFRAVSLCSCDLTEIPKFLKNQHHLELLDLAS 425
                                                     IP  L +   L++L L S
Sbjct: 324 ------------------------------------------IPVALTSLPRLQVLQLWS 341

Query: 426 NKINGKVPKWLLDPSMQNFGHLNLSHNFLTGFDQHPNTVNYLVSNNSLTGEIPSWICNLS 485
           NK +G++PK        N G     HN LT  D         +S N+LTGEIP  +C+ S
Sbjct: 342 NKFSGEIPK--------NLG----KHNNLTVLD---------LSTNNLTGEIPEGLCS-S 379

Query: 486 NRLESLDLSYNNLSGLLPQCLGNFSDWLSILDLQHNKFSGTIPDNLLKGNILKVIDLSDN 545
             L  L L  N+L G +P+ LG     L  + LQ N FSG +P    K  ++  +D+S+N
Sbjct: 380 GNLFKLILFSNSLEGEIPKSLGACRS-LRRVRLQDNSFSGELPSEFTKLPLVYFLDISNN 438

Query: 546 LLQGRIPRSLANCSNLEFLDLGDNQIRDIFPSWLGTLPDLNVLILKSNKFHGLIREPKTD 605
            LQGRI     +  +L+ L L  N        + G LPD                     
Sbjct: 439 NLQGRINSRKWDMPSLQMLSLARN-------KFFGGLPDSF------------------- 472

Query: 606 CGFPKLRIIDLSKNRFTGKLPSMAFQCWNAMKVVNASELRYMQEVIPFNEGNGIYDYSLT 665
            G  +L  +DLS+N+F+G +P          K+ + SEL  ++                 
Sbjct: 473 -GSKRLENLDLSRNQFSGAVPR---------KLGSLSELMQLK----------------- 505

Query: 666 MSNKGQMMSYKKIPDILTAVILSSNRFDGEIPTSISNLKGLQILSLADNSLHGHIPSCLG 725
                                LS N+  GEIP  +S+ K L  L L+ N L G IP+   
Sbjct: 506 ---------------------LSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFS 544

Query: 726 NLTDLESLDLSNNRFSGQIPQQLVELTFLEFFNVSDNHFTGPIPQGKQFATFDKTSFDGN 785
            +  L  LDLS N+ SG+IP+ L  +  L   N+S NH  G +P    F   + ++  GN
Sbjct: 545 EMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGN 604

Query: 786 SGLCGRPLSS 795
             LCG   +S
Sbjct: 605 IDLCGGDTTS 614


Length = 968

>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 930
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG4194873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG4237498 consensus Extracellular matrix protein slit, conta 99.89
PLN032101153 Resistant to P. syringae 6; Provisional 99.89
PLN032101153 Resistant to P. syringae 6; Provisional 99.88
KOG4237498 consensus Extracellular matrix protein slit, conta 99.87
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.87
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.85
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.79
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.77
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.74
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.71
PLN03150623 hypothetical protein; Provisional 99.59
KOG0617264 consensus Ras suppressor protein (contains leucine 99.59
KOG0617264 consensus Ras suppressor protein (contains leucine 99.55
PLN03150623 hypothetical protein; Provisional 99.51
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.15
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.14
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.11
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.04
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.03
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.02
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.99
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.96
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.8
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.79
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.79
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.78
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.76
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.74
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.72
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.64
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.59
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.58
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.58
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.44
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.3
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.21
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.2
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.18
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.18
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.17
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.17
KOG4341483 consensus F-box protein containing LRR [General fu 97.93
PRK15386426 type III secretion protein GogB; Provisional 97.91
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.84
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.7
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.63
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.6
PRK15386426 type III secretion protein GogB; Provisional 97.57
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.48
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.39
KOG4341483 consensus F-box protein containing LRR [General fu 97.32
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.25
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.2
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.71
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.7
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.46
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.32
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.82
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.72
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.59
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.32
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.31
KOG2123388 consensus Uncharacterized conserved protein [Funct 94.75
KOG4308478 consensus LRR-containing protein [Function unknown 93.51
KOG4308478 consensus LRR-containing protein [Function unknown 92.85
KOG0473326 consensus Leucine-rich repeat protein [Function un 91.44
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 87.71
KOG0473326 consensus Leucine-rich repeat protein [Function un 87.22
smart0037026 LRR Leucine-rich repeats, outliers. 82.92
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 82.92
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 82.47
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.5e-73  Score=721.20  Aligned_cols=584  Identities=38%  Similarity=0.620  Sum_probs=438.0

Q ss_pred             cHHHHHHHHHHHhhcCCCCCccccccCCCccCCCCCCCCCCCCCCCCCCCcccceEecCCCCcEEEEEcCCCCCcccccC
Q 047985            7 HGDERSALLQFKESLIISESKEIDTLYGPIFCHPKAASWKPEEGNNIDCCSWDGVQCNENTGHVIKLDLSSSCLQGSINS   86 (930)
Q Consensus         7 ~~~~~~aLl~~k~~~~~~~~~~~~~~~~~~~~~~~l~~W~~~~~~~~~~C~w~gv~C~~~~~~v~~L~L~~~~l~g~~~~   86 (930)
                      +++|++||++||+++.++..              .+.+|..    ..+||.|.||+|+. .++|+.|||+++.+.|.+++
T Consensus        27 ~~~~~~~l~~~~~~~~~~~~--------------~~~~w~~----~~~~c~w~gv~c~~-~~~v~~L~L~~~~i~~~~~~   87 (968)
T PLN00113         27 HAEELELLLSFKSSINDPLK--------------YLSNWNS----SADVCLWQGITCNN-SSRVVSIDLSGKNISGKISS   87 (968)
T ss_pred             CHHHHHHHHHHHHhCCCCcc--------------cCCCCCC----CCCCCcCcceecCC-CCcEEEEEecCCCccccCCh
Confidence            57899999999999975533              5789976    57999999999986 47999999999999998866


Q ss_pred             cccccCCCCCCEEECCCCCCCCCCCchhcc-CCCCCCEEEccCCCCCccCCccccCCCCCcEEEccCCCCCCCccccCCc
Q 047985           87 SSSLFKLVHLEWLDLAFNDFDGSEIPPEII-NLSSLSYLNLSSAAFSGQIPSEILELSKLAYLDLSHNSYYDPVELRKPS  165 (930)
Q Consensus        87 ~~~l~~l~~L~~L~Ls~n~~~~~~ip~~l~-~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~Ls~n~~~~~~~~~~~~  165 (930)
                        .+..+++|++|+|++|.+.+. +|..+. .+++|++|+|++|.++|.+|.  +.+++|++|+|++|.           
T Consensus        88 --~~~~l~~L~~L~Ls~n~~~~~-ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~-----------  151 (968)
T PLN00113         88 --AIFRLPYIQTINLSNNQLSGP-IPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNM-----------  151 (968)
T ss_pred             --HHhCCCCCCEEECCCCccCCc-CChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEECcCCc-----------
Confidence              888999999999999999875 777655 899999999999999888775  456777777777763           


Q ss_pred             hhhhhhCCCCCCEEEcCCccCCCCCchhccCCCCCCEEEccCCCCCCCCcccccCCCCCcEEEccCCCCCCchhhhhcCC
Q 047985          166 LGNLADKLTNLKELVLGDVTISSPIPHNLTYLSSLTTLSLSGCDLRGRIPSSLGNITRLIHLDLSFNKLSDELPTFIGTL  245 (930)
Q Consensus       166 l~~~l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l  245 (930)
                                          +++.+|..++++++|++|++++|.+.+.+|..++++++|++|++++|.+.+.+|..++++
T Consensus       152 --------------------~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l  211 (968)
T PLN00113        152 --------------------LSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQM  211 (968)
T ss_pred             --------------------ccccCChHHhcCCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCc
Confidence                                344445555555555555555555555555556666666666666666665566666666


Q ss_pred             CCCCEEEccCCCCCCCcchhhcCCCCCCEEEccCCCCCCCCCCCCCCCcCCcEEEccCCCCCCccCcccccccccceeec
Q 047985          246 GSLKELDLLQNNLSGELPNSIGNLASLEQVDLSLNRFLGKVPSSLGNLTQLHWLSLASNDFSGELPASFGNLRSLRTLDV  325 (930)
Q Consensus       246 ~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L  325 (930)
                      ++|++|++++|.+++.+|..++++++|++|++++|.+++.+|..++++++|++|++++|.+.+.+|..+.++++|++|++
T Consensus       212 ~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L  291 (968)
T PLN00113        212 KSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDL  291 (968)
T ss_pred             CCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChhHhCCCCCCEEECcCCeeeccCchhHhhccCcCEEEC
Confidence            66666666666666666666666666666666666666666666666666666666666666666666666666666666


Q ss_pred             ccccccCCCcccccCCCCCCEEEccCCCCCCCCchhHHhhccccccEEEccCCcccccccccCCCCccccceeeeccCCC
Q 047985          326 YECKFSGQIPSSLSNLTHLSFLDFSLNNFSGKMDLDIFLVNHKLLYHLFLSTNRLSLLTKATSNTTSHRFRAVSLCSCDL  405 (930)
Q Consensus       326 ~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~~~L~~L~Ls~n~l~~~~~~~~~~~~~~L~~L~l~~~~l  405 (930)
                      ++|.+.+.+|..+.++++|+.|++++|.+.+.+|                                              
T Consensus       292 s~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~----------------------------------------------  325 (968)
T PLN00113        292 SDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIP----------------------------------------------  325 (968)
T ss_pred             cCCeeccCCChhHcCCCCCcEEECCCCccCCcCC----------------------------------------------
Confidence            6666666666666666667777666666654433                                              


Q ss_pred             CCcchhhhcCCCcCEEeCCCCCCcCCCCccccCCCCCCceEEeccCccCcCCCCCCCcceEEeccCcCCCCCchHHhhcc
Q 047985          406 TEIPKFLKNQHHLELLDLASNKINGKVPKWLLDPSMQNFGHLNLSHNFLTGFDQHPNTVNYLVSNNSLTGEIPSWICNLS  485 (930)
Q Consensus       406 ~~ip~~l~~~~~L~~L~Ls~N~l~~~~p~~~~~~~l~~L~~L~Ls~N~l~~~~~~~~l~~l~ls~n~l~g~ip~~~~~~~  485 (930)
                          ..+..+++|+.|++++|.+.+.+|..                                             +..+ 
T Consensus       326 ----~~~~~l~~L~~L~L~~n~l~~~~p~~---------------------------------------------l~~~-  355 (968)
T PLN00113        326 ----VALTSLPRLQVLQLWSNKFSGEIPKN---------------------------------------------LGKH-  355 (968)
T ss_pred             ----hhHhcCCCCCEEECcCCCCcCcCChH---------------------------------------------HhCC-
Confidence                22334455555555555554444333                                             2233 


Q ss_pred             cccceeecccccccCcCcccccccccCCceeecCCCccccccCcccCCCCCccEEEccCccccccCCccccCCCCCcEec
Q 047985          486 NRLESLDLSYNNLSGLLPQCLGNFSDWLSILDLQHNKFSGTIPDNLLKGNILKVIDLSDNLLQGRIPRSLANCSNLEFLD  565 (930)
Q Consensus       486 ~~L~~L~Ls~N~l~~~~p~~l~~~~~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~  565 (930)
                      ++|+.|++++|++++.+|..+..+.. |+.|++++|++.+.+|..+..+++|+.|++++|++++.+|..|.+++.|+.|+
T Consensus       356 ~~L~~L~Ls~n~l~~~~p~~~~~~~~-L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~  434 (968)
T PLN00113        356 NNLTVLDLSTNNLTGEIPEGLCSSGN-LFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLD  434 (968)
T ss_pred             CCCcEEECCCCeeEeeCChhHhCcCC-CCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChhHhcCCCCCEEE
Confidence            45566666666666666665555553 66666666666666666666677777777777777777777777777788888


Q ss_pred             ccCccccccCcccccCCCCCcEEEccCCcccccCCCCCccCCCCCceEEECCCCcCcccCChHHHhhcccceeccccccc
Q 047985          566 LGDNQIRDIFPSWLGTLPDLNVLILKSNKFHGLIREPKTDCGFPKLRIIDLSKNRFTGKLPSMAFQCWNAMKVVNASELR  645 (930)
Q Consensus       566 Ls~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~~~~~~~~~l~~L~~LdLs~N~l~g~ip~~~~~~l~~l~~l~~~~~~  645 (930)
                      +++|++++.+|..+..+++|+.|+|++|++.+.+|...   ..++|+.||+++|++++.+|.. +..             
T Consensus       435 Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~---~~~~L~~L~ls~n~l~~~~~~~-~~~-------------  497 (968)
T PLN00113        435 ISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSF---GSKRLENLDLSRNQFSGAVPRK-LGS-------------  497 (968)
T ss_pred             CcCCcccCccChhhccCCCCcEEECcCceeeeecCccc---ccccceEEECcCCccCCccChh-hhh-------------
Confidence            88888887777777778888888888888887776644   3578999999999999888753 221             


Q ss_pred             cccccccCCCCCccceeeeEeeecccccccccccccccEEEcccccccccCchhcccccccceeeccCccccccCccccc
Q 047985          646 YMQEVIPFNEGNGIYDYSLTMSNKGQMMSYKKIPDILTAVILSSNRFDGEIPTSISNLKGLQILSLADNSLHGHIPSCLG  725 (930)
Q Consensus       646 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~L~Ls~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~  725 (930)
                                                       ++.|+.|+|++|+++|.+|..++++++|+.|+|++|.++|.+|..++
T Consensus       498 ---------------------------------l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~  544 (968)
T PLN00113        498 ---------------------------------LSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFS  544 (968)
T ss_pred             ---------------------------------hhccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHh
Confidence                                             23478999999999999999999999999999999999999999999


Q ss_pred             ccCCCCeeeCCCCcCcccCCccccCCCCCCeeecCCCcccccCCCCCCcCccCCcccCCCCCCCCCC
Q 047985          726 NLTDLESLDLSNNRFSGQIPQQLVELTFLEFFNVSDNHFTGPIPQGKQFATFDKTSFDGNSGLCGRP  792 (930)
Q Consensus       726 ~L~~L~~LdLs~N~lsg~ip~~l~~L~~L~~L~ls~N~L~g~iP~~~~~~~~~~~s~~gn~~Lcg~~  792 (930)
                      ++++|+.|||++|+++|.+|..+..+++|++|++++|+++|.||..++|.+|...+|.||+++||.+
T Consensus       545 ~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~~~~~~~~~~~n~~lc~~~  611 (968)
T PLN00113        545 EMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNIDLCGGD  611 (968)
T ss_pred             CcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCCcchhcccChhhhcCCccccCCc
Confidence            9999999999999999999999999999999999999999999999999999999999999999864



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query930
3rgx_A768 Structural Insight Into Brassinosteroid Perception 6e-58
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 1e-16
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 6e-58
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 9e-17
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 6e-17
3fxi_A605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 4e-06
2z66_A306 Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 A 5e-06
3rg1_A612 Crystal Structure Of The Rp105MD-1 Complex Length = 1e-05
4g8a_A635 Crystal Structure Of Human Tlr4 Polymorphic Variant 1e-05
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 2e-05
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 3e-04
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 2e-05
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 4e-05
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 1e-04
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 1e-04
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 1e-04
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 1e-04
2z63_A570 Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 A 1e-04
3v47_A455 Crystal Structure Of The N-Tetminal Fragment Of Zeb 4e-04
2wfh_A193 The Human Slit 2 Dimerization Domain D4 Length = 19 4e-04
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure

Iteration: 1

Score = 223 bits (567), Expect = 6e-58, Method: Compositional matrix adjust. Identities = 234/786 (29%), Positives = 345/786 (43%), Gaps = 164/786 (20%) Query: 57 SWDGVQCNENTGHVIKLDLSSSCLQGSINSSSSLFKLVHLEWLDLAFNDFDGSEIPPEII 116 S G +C + + LDLS + L G + + +SL L++L+++ N D Sbjct: 92 SVSGFKC---SASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLD--------- 139 Query: 117 XXXXXXXXXXXXAAFSGQIPSEILELSKLAYLDLSHNSYYDPVELRKPSLGNLADKLTNL 176 F G++ S L+L+ L LDLS NS + L+D L Sbjct: 140 --------------FPGKV-SGGLKLNSLEVLDLSANSISGANVVGWV----LSDGCGEL 180 Query: 177 KELVLGDVTISSPIPHNXXXXXXXXXXXXXGCDLRGRIPSSLGNITRLIHL---DLSFNK 233 K L + IS + +++R ++L D+S N Sbjct: 181 KHLAISGNKISGDV-----------------------------DVSRCVNLEFLDVSSNN 211 Query: 234 LSDELPTFIGTLGSLKELDLLQNNLSGELPNSIGNLASLEQVDLSLNRFLGKVPSSLGNL 293 S +P F+G +L+ LD+ N LSG+ +I L+ +++S N+F+G +P L Sbjct: 212 FSTGIP-FLGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPL--PL 268 Query: 294 TQLHWLSLASNDFSGELPASF-GNLRSLRTLDVYECKFSGQIPSSLSNLTHLSFLDFSLN 352 L +LSLA N F+GE+P G +L LD+ F G +P + + L L S N Sbjct: 269 KSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSN 328 Query: 353 NFSGKMDLDIFLVNHKLLYHLFLSTNRLSLLTKATSNTTSHRFRAVSLCSCDLTEIPKFL 412 NFSG++ +D L+ + L L LS N S E+P+ L Sbjct: 329 NFSGELPMDT-LLKMRGLKVLDLSFNEFS------------------------GELPESL 363 Query: 413 KN-QHHLELLDLASNKINGKVPKWLLDPSMQNFGHLNLSHNFLTGFDQHP-NTVNYL-VS 469 N L LDL+SN +G + L Q+P NT+ L + Sbjct: 364 TNLSASLLTLDLSSNNFSGPI---------------------LPNLCQNPKNTLQELYLQ 402 Query: 470 NNSLTGEIPSWICNLSNRLESLDLSYNNLSGLLPQCLGNFSDWLSILDLQHNKFSGTIPD 529 NN TG+IP + N S L SL LS+N LSG +P LG+ S L L L N G IP Sbjct: 403 NNGFTGKIPPTLSNCS-ELVSLHLSFNYLSGTIPSSLGSLSK-LRDLKLWLNMLEGEIPQ 460 Query: 530 NLLKGNILKVIDLSDNLLQGRIPRSLANCSNLEFLDLGDNQIRDIFPSWLGTLPDLNVLI 589 L+ L+ + L N L G IP L+NC+NL ++ L +N++ P W+G L +L +L Sbjct: 461 ELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILK 520 Query: 590 LKSNKFHGLIREPKTDCGFPKLRIIDLSKNRFTGKLPSMAF------------------- 630 L +N F G I DC L +DL+ N F G +P+ F Sbjct: 521 LSNNSFSGNIPAELGDC--RSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYI 578 Query: 631 -------QCWNA-----MKVVNASELRYMQEVIPFNEGNGIYD--YSLTMSNKGQMMSYK 676 +C A + + + +L + P N + +Y S T N G MM Sbjct: 579 KNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMM--- 635 Query: 677 KIPDILTAVILSSNRFDGEIPTSISNLKGLQILSLADNSLHGHIPSCLGNLTDLESLDLS 736 + +S N G IP I ++ L IL+L N + G IP +G+L L LDLS Sbjct: 636 -------FLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLS 688 Query: 737 NNRFSGQIPQQLVELTFLEFFNVSDNHFTGPIPQGKQFATFDKTSFDGNSGLCGRPLSSE 796 +N+ G+IPQ + LT L ++S+N+ +GPIP+ QF TF F N GLCG PL Sbjct: 689 SNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPL-PR 747 Query: 797 CEISEA 802 C+ S A Sbjct: 748 CDPSNA 753
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure
>pdb|2Z66|A Chain A, Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 306 Back     alignment and structure
>pdb|3RG1|A Chain A, Crystal Structure Of The Rp105MD-1 Complex Length = 612 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2Z63|A Chain A, Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 570 Back     alignment and structure
>pdb|3V47|A Chain A, Crystal Structure Of The N-Tetminal Fragment Of Zebrafish Tlr5 In Complex With Salmonella Flagellin Length = 455 Back     alignment and structure
>pdb|2WFH|A Chain A, The Human Slit 2 Dimerization Domain D4 Length = 193 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query930
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 0.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-102
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-74
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-57
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-31
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-83
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-83
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-67
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-56
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-39
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-09
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-80
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-79
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-75
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-49
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-40
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-36
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-33
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-74
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-69
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-53
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-34
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-27
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-72
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-65
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-65
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-63
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-40
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-39
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-39
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-33
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-25
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-20
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-71
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-68
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-61
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-54
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-27
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-64
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-64
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-62
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-59
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-22
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-55
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-49
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-46
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-08
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-51
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-50
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-42
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-29
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-29
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-21
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-48
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-43
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-43
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-35
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-31
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-25
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-17
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-16
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-46
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-42
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-41
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-40
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-36
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-45
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-35
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-24
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-22
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-15
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-43
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-42
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-38
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-38
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-37
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-27
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-24
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-23
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-09
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-38
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-36
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-35
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-29
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-27
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-26
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-17
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-37
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-36
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-34
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-27
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-19
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-17
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-36
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-32
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-32
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-29
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-24
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-10
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-34
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-31
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-28
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-24
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-19
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-33
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-31
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-31
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-23
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-15
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-33
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-32
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-30
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-30
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-29
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-27
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-31
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-31
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-29
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-29
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-27
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-24
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-24
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-23
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-22
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-18
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-07
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 6e-31
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-30
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 7e-29
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-27
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-13
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-07
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-30
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-30
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-29
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-29
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-28
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-26
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-24
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-23
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-20
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-30
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-22
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 8e-22
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-19
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 8e-18
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 9e-08
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-28
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-26
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-18
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-17
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-12
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 6e-26
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-22
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 9e-19
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 7e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-26
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-20
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-15
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-14
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-12
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-12
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-25
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-23
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-23
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-21
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-19
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-25
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-22
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-18
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-18
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-16
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-11
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-25
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-22
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-22
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-21
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-21
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-19
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-25
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-21
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-20
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-18
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-21
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-21
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 9e-21
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 9e-20
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-10
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-21
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-20
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-20
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 8e-20
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-16
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 8e-16
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-20
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-19
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-20
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-18
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-19
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-05
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 5e-19
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-15
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 7e-15
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-14
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-13
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 9e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-18
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-18
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-18
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-15
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-15
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-18
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-17
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-12
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-10
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 9e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-17
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-13
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-15
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-15
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-15
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-14
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-14
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 9e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-14
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-13
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-13
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-13
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-13
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-12
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 6e-13
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 9e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 7e-12
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-11
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-10
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-11
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-09
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-11
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 8e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 7e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-09
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-05
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-08
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-08
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 7e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 6e-08
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-07
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-07
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 7e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 8e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 5e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 8e-07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 8e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  626 bits (1616), Expect = 0.0
 Identities = 238/836 (28%), Positives = 355/836 (42%), Gaps = 113/836 (13%)

Query: 4   PLCHGDERSALLQFKESLIISESKEIDTLYGPIFCHPKAASWKPEEGNNIDCCSWDGVQC 63
                 E   L+ FK+ L                       W     +N + C++DGV C
Sbjct: 7   SQSLYREIHQLISFKDVLPDK---------------NLLPDWS----SNKNPCTFDGVTC 47

Query: 64  NENTGHVIKLDLSSSCLQGSINS-SSSLFKLVHLEWLDLAFNDFDGSEIPPEIINLSSLS 122
                 V  +DLSS  L    ++ SSSL  L  LE L L+ +  +GS         +SL+
Sbjct: 48  R--DDKVTSIDLSSKPLNVGFSAVSSSLLSLTGLESLFLSNSHINGS--VSGFKCSASLT 103

Query: 123 YLNLSSAAFSGQIPS--EILELSKLAYLDLSHNSYYDPVELRKPSLGNLADKLTNLKELV 180
            L+LS  + SG + +   +   S L +L++S N+   P ++       L     +L+ L 
Sbjct: 104 SLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKV--SGGLKL----NSLEVLD 157

Query: 181 LGDVTISSPIPHNLTY---LSSLTTLSLSGCDLRGRIPSSLGNITRLIHLDLSFNKLSDE 237
           L   +IS               L  L++SG  + G +   +     L  LD+S N  S  
Sbjct: 158 LSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVD--VSRCVNLEFLDVSSNNFSTG 215

Query: 238 LPTFIGTLGSLKELDLLQNNLSGELPNSIGNLASLEQVDLSLNRFLGKVPSSLGNLTQLH 297
           +P F+G   +L+ LD+  N LSG+   +I     L+ +++S N+F+G +P     L  L 
Sbjct: 216 IP-FLGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPL--PLKSLQ 272

Query: 298 WLSLASNDFSGELPAS-FGNLRSLRTLDVYECKFSGQIPSSLSNLTHLSFLDFSLNNFSG 356
           +LSLA N F+GE+P    G   +L  LD+    F G +P    + + L  L  S NNFSG
Sbjct: 273 YLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSG 332

Query: 357 KMDLDIFLVNHKLLYHLFLSTNRLSLLTKATSNTTSHRFRAVSLCSCDLTEIPKFLKN-Q 415
           ++ +D  L+  + L  L LS N  S                         E+P+ L N  
Sbjct: 333 ELPMD-TLLKMRGLKVLDLSFNEFS------------------------GELPESLTNLS 367

Query: 416 HHLELLDLASNKINGKVPKWLLDPSMQNFGHLNLSHNFLTGFDQHPNTVNYLVSNNSLTG 475
             L  LDL+SN  +G +   L          L L                    NN  TG
Sbjct: 368 ASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQ-------------------NNGFTG 408

Query: 476 EIPSWICNLSNRLESLDLSYNNLSGLLPQCLGNFSDWLSILDLQHNKFSGTIPDNLLKGN 535
           +IP  + N S  L SL LS+N LSG +P  LG+ S  L  L L  N   G IP  L+   
Sbjct: 409 KIPPTLSNCSE-LVSLHLSFNYLSGTIPSSLGSLS-KLRDLKLWLNMLEGEIPQELMYVK 466

Query: 536 ILKVIDLSDNLLQGRIPRSLANCSNLEFLDLGDNQIRDIFPSWLGTLPDLNVLILKSNKF 595
            L+ + L  N L G IP  L+NC+NL ++ L +N++    P W+G L +L +L L +N F
Sbjct: 467 TLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSF 526

Query: 596 HGLIREPKTDCGFPKLRIIDLSKNRFTGKLPSMAFQCWNAMKVVNASELRYMQE------ 649
            G I  P        L  +DL+ N F G +P+  F+    +     +  RY+        
Sbjct: 527 SGNI--PAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMK 584

Query: 650 --------------VIPFNEGNGIYDYSLTMSN---KGQMMSYKKIPDILTAVILSSNRF 692
                         +               +++    G           +  + +S N  
Sbjct: 585 KECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNML 644

Query: 693 DGEIPTSISNLKGLQILSLADNSLHGHIPSCLGNLTDLESLDLSNNRFSGQIPQQLVELT 752
            G IP  I ++  L IL+L  N + G IP  +G+L  L  LDLS+N+  G+IPQ +  LT
Sbjct: 645 SGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALT 704

Query: 753 FLEFFNVSDNHFTGPIPQGKQFATFDKTSFDGNSGLCGRPLSSECEISEAPTNEDQ 808
            L   ++S+N+ +GPIP+  QF TF    F  N GLCG PL      +       Q
Sbjct: 705 MLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPRCDPSNADGYAHHQ 760


>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query930
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.98
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.98
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.94
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.94
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.94
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.93
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.93
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.93
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.93
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.92
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.92
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.91
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.91
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.91
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.91
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.91
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.9
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.9
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.88
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.88
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.88
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.87
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.87
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.87
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.86
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.86
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.86
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.85
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.85
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.85
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.85
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.84
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.83
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.83
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.82
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.82
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.81
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.8
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.8
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.79
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.79
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.77
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.75
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.73
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.72
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.72
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.72
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.72
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.72
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.71
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.71
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.71
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.7
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.69
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.69
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.68
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.68
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.67
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.66
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.66
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.66
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.65
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.63
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.62
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.55
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.53
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.53
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.53
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.52
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.51
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.5
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.49
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.49
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.46
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.42
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.39
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.36
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.35
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.35
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.34
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.34
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.33
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.29
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.29
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.27
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.21
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.16
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.12
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.09
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.07
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.9
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.87
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.75
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.74
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.51
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.44
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.3
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.28
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.26
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.25
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.65
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.62
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.84
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.64
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.57
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.52
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=1.4e-91  Score=862.40  Aligned_cols=711  Identities=33%  Similarity=0.493  Sum_probs=598.2

Q ss_pred             CCCcHHHHHHHHHHHhhcCCCCCccccccCCCccCCCCCCCCCCCCCCCCCCCcccceEecCCCCcEEEEEcCCCCCccc
Q 047985            4 PLCHGDERSALLQFKESLIISESKEIDTLYGPIFCHPKAASWKPEEGNNIDCCSWDGVQCNENTGHVIKLDLSSSCLQGS   83 (930)
Q Consensus         4 ~~c~~~~~~aLl~~k~~~~~~~~~~~~~~~~~~~~~~~l~~W~~~~~~~~~~C~w~gv~C~~~~~~v~~L~L~~~~l~g~   83 (930)
                      ..+.++||+|||+||+++.++.               ++++|+.    ++|||+|+||+|+  +|+|++|||+++.+.|.
T Consensus         7 ~~~~~~~~~all~~k~~~~~~~---------------~l~~W~~----~~~~C~w~gv~C~--~~~v~~L~L~~~~l~g~   65 (768)
T 3rgz_A            7 SQSLYREIHQLISFKDVLPDKN---------------LLPDWSS----NKNPCTFDGVTCR--DDKVTSIDLSSKPLNVG   65 (768)
T ss_dssp             -CCHHHHHHHHHHHHTTCSCTT---------------SSTTCCT----TSCGGGSTTEEEE--TTEEEEEECTTSCCCEE
T ss_pred             ccCCHHHHHHHHHHHhhCCCcc---------------cccCCCC----CCCCcCCcceEEC--CCcEEEEECCCCCcCCc
Confidence            3457889999999999998542               5899986    6799999999998  58999999999999998


Q ss_pred             ---ccCcccccCCCCCCEEECCCCCCCCCCCchhccCCCCCCEEEccCCCCCccCCc--cccCCCCCcEEEccCCCCCCC
Q 047985           84 ---INSSSSLFKLVHLEWLDLAFNDFDGSEIPPEIINLSSLSYLNLSSAAFSGQIPS--EILELSKLAYLDLSHNSYYDP  158 (930)
Q Consensus        84 ---~~~~~~l~~l~~L~~L~Ls~n~~~~~~ip~~l~~l~~L~~L~Ls~n~l~~~~p~--~l~~l~~L~~L~Ls~n~~~~~  158 (930)
                         +++  ++..+++|+.++++.+.+..  +|+.++.+++|++|||++|.++|.+|.  .++++++|++|++++|.+.  
T Consensus        66 ~~~l~~--~l~~L~~L~~l~~~~~~~~~--l~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~--  139 (768)
T 3rgz_A           66 FSAVSS--SLLSLTGLESLFLSNSHING--SVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLD--  139 (768)
T ss_dssp             HHHHHH--HTTTCTTCCEEECTTSCEEE--CCCCCCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCCEEECCSSEEE--
T ss_pred             cCccCh--hHhccCcccccCCcCCCcCC--CchhhccCCCCCEEECCCCcCCCcCCChHHHhCCCCCCEEECcCCccC--
Confidence               776  89999999999999998742  567899999999999999999999998  9999999999999999542  


Q ss_pred             ccccCCchhhh-hhCCCCCCEEEcCCccCCCCCchh---ccCCCCCCEEEccCCCCCCCCcccccCCCCCcEEEccCCCC
Q 047985          159 VELRKPSLGNL-ADKLTNLKELVLGDVTISSPIPHN---LTYLSSLTTLSLSGCDLRGRIPSSLGNITRLIHLDLSFNKL  234 (930)
Q Consensus       159 ~~~~~~~l~~~-l~~l~~L~~L~L~~n~l~~~~~~~---l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l  234 (930)
                           +.++.. +.++++|++|++++|.+++..|..   +.++++|++|++++|.+++..|.  ..+++|++|++++|.+
T Consensus       140 -----~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~--~~l~~L~~L~Ls~n~l  212 (768)
T 3rgz_A          140 -----FPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVDV--SRCVNLEFLDVSSNNF  212 (768)
T ss_dssp             -----CCSSCCSCCCCTTCSEEECCSSCCEEETHHHHHHTTCCTTCCEEECCSSEEESCCBC--TTCTTCCEEECCSSCC
T ss_pred             -----CcCCHHHhccCCCCCEEECCCCccCCcCChhhhhhccCCCCCEEECCCCcccccCCc--ccCCcCCEEECcCCcC
Confidence                 233333 378999999999999999998887   88999999999999999987664  8899999999999999


Q ss_pred             CCchhhhhcCCCCCCEEEccCCCCCCCcchhhcCCCCCCEEEccCCCCCCCCCCCCCCCcCCcEEEccCCCCCCccCccc
Q 047985          235 SDELPTFIGTLGSLKELDLLQNNLSGELPNSIGNLASLEQVDLSLNRFLGKVPSSLGNLTQLHWLSLASNDFSGELPASF  314 (930)
Q Consensus       235 ~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l  314 (930)
                      ++.+|. ++++++|++|++++|.+++.+|..++.+++|++|++++|++++.+|..  .+++|++|++++|.+++.+|..+
T Consensus       213 ~~~~~~-l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~--~l~~L~~L~L~~n~l~~~ip~~~  289 (768)
T 3rgz_A          213 STGIPF-LGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPL--PLKSLQYLSLAENKFTGEIPDFL  289 (768)
T ss_dssp             CSCCCB-CTTCCSCCEEECCSSCCCSCHHHHTTTCSSCCEEECCSSCCEESCCCC--CCTTCCEEECCSSEEEESCCCCS
T ss_pred             CCCCcc-cccCCCCCEEECcCCcCCCcccHHHhcCCCCCEEECCCCcccCccCcc--ccCCCCEEECcCCccCCccCHHH
Confidence            998887 999999999999999999999999999999999999999999888875  89999999999999999999988


Q ss_pred             ccc-cccceeecccccccCCCcccccCCCCCCEEEccCCCCCCCCchhHHhhccccccEEEccCCcccccccccCCCCcc
Q 047985          315 GNL-RSLRTLDVYECKFSGQIPSSLSNLTHLSFLDFSLNNFSGKMDLDIFLVNHKLLYHLFLSTNRLSLLTKATSNTTSH  393 (930)
Q Consensus       315 ~~l-~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~~~L~~L~Ls~n~l~~~~~~~~~~~~~  393 (930)
                      ... ++|++|++++|++++.+|..++.+++|++|++++|.++|.+|...+ ..+++|++|++++|++..           
T Consensus       290 ~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~ip~~~l-~~l~~L~~L~Ls~n~l~~-----------  357 (768)
T 3rgz_A          290 SGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTL-LKMRGLKVLDLSFNEFSG-----------  357 (768)
T ss_dssp             CTTCTTCSEEECCSSEEEECCCGGGGGCTTCCEEECCSSEEEEECCHHHH-TTCTTCCEEECCSSEEEE-----------
T ss_pred             HhhcCcCCEEECcCCcCCCccchHHhcCCCccEEECCCCcccCcCCHHHH-hcCCCCCEEeCcCCccCc-----------
Confidence            775 9999999999999999999999999999999999999988887655 677778777777774321           


Q ss_pred             ccceeeeccCCCCCcchhhhcCC-CcCEEeCCCCCCcCCCCccccCCCCCCceEEeccCccCcCCCCCCCcceEEeccCc
Q 047985          394 RFRAVSLCSCDLTEIPKFLKNQH-HLELLDLASNKINGKVPKWLLDPSMQNFGHLNLSHNFLTGFDQHPNTVNYLVSNNS  472 (930)
Q Consensus       394 ~L~~L~l~~~~l~~ip~~l~~~~-~L~~L~Ls~N~l~~~~p~~~~~~~l~~L~~L~Ls~N~l~~~~~~~~l~~l~ls~n~  472 (930)
                                   .+|..+..++ +|++|++++|.+.+.+|..+....+++|++|++++                   |.
T Consensus       358 -------------~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~-------------------n~  405 (768)
T 3rgz_A          358 -------------ELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQN-------------------NG  405 (768)
T ss_dssp             -------------CCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCS-------------------SE
T ss_pred             -------------cccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCC-------------------Cc
Confidence                         4556666666 89999999999888888776632355565555555                   55


Q ss_pred             CCCCCchHHhhcccccceeecccccccCcCcccccccccCCceeecCCCccccccCcccCCCCCccEEEccCccccccCC
Q 047985          473 LTGEIPSWICNLSNRLESLDLSYNNLSGLLPQCLGNFSDWLSILDLQHNKFSGTIPDNLLKGNILKVIDLSDNLLQGRIP  552 (930)
Q Consensus       473 l~g~ip~~~~~~~~~L~~L~Ls~N~l~~~~p~~l~~~~~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p  552 (930)
                      +++.+|..+..+ ++|++|++++|++++.+|..++.+++ |++|++++|.+++.+|..+..+++|++|++++|++++.+|
T Consensus       406 l~~~~p~~l~~l-~~L~~L~Ls~N~l~~~~p~~l~~l~~-L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p  483 (768)
T 3rgz_A          406 FTGKIPPTLSNC-SELVSLHLSFNYLSGTIPSSLGSLSK-LRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIP  483 (768)
T ss_dssp             EEEECCGGGGGC-TTCCEEECCSSEEESCCCGGGGGCTT-CCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCC
T ss_pred             cccccCHHHhcC-CCCCEEECcCCcccCcccHHHhcCCC-CCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCC
Confidence            566788888888 88999999999999999999999886 9999999999999999999999999999999999999999


Q ss_pred             ccccCCCCCcEecccCccccccCcccccCCCCCcEEEccCCcccccCCCCCccCCCCCceEEECCCCcCcccCChHHHhh
Q 047985          553 RSLANCSNLEFLDLGDNQIRDIFPSWLGTLPDLNVLILKSNKFHGLIREPKTDCGFPKLRIIDLSKNRFTGKLPSMAFQC  632 (930)
Q Consensus       553 ~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~~~~~~~~~l~~L~~LdLs~N~l~g~ip~~~~~~  632 (930)
                      ..+.++++|++|++++|++++.+|.+++.+++|++|+|++|++++.+|..+  ..+++|++||+++|+++|.+|...+..
T Consensus       484 ~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l--~~l~~L~~L~Ls~N~l~g~ip~~~~~~  561 (768)
T 3rgz_A          484 SGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAEL--GDCRSLIWLDLNTNLFNGTIPAAMFKQ  561 (768)
T ss_dssp             GGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGG--GGCTTCCEEECCSSEEESBCCGGGGTT
T ss_pred             HHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHH--cCCCCCCEEECCCCccCCcCChHHhcc
Confidence            999999999999999999999999999999999999999999999888766  678999999999999999999775543


Q ss_pred             cccceeccccc-c--cccccccc------------CCCCC--cc--c--eeeeE---eeecccccccccccccccEEEcc
Q 047985          633 WNAMKVVNASE-L--RYMQEVIP------------FNEGN--GI--Y--DYSLT---MSNKGQMMSYKKIPDILTAVILS  688 (930)
Q Consensus       633 l~~l~~l~~~~-~--~~~~~~~~------------~~~~~--~~--~--~~~~~---~~~~~~~~~~~~~~~~L~~L~Ls  688 (930)
                      .. +..+.... .  .+......            +....  ..  .  .....   ...+|...........|+.|||+
T Consensus       562 ~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs  640 (768)
T 3rgz_A          562 SG-KIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMS  640 (768)
T ss_dssp             TT-CBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECC
T ss_pred             cc-hhhhhccccccccccccccccccccccccccccccccchhhhccccccccccccceecccCchhhhccccccEEECc
Confidence            22 22111110 0  00000000            00000  00  0  00000   00111111122335679999999


Q ss_pred             cccccccCchhcccccccceeeccCccccccCcccccccCCCCeeeCCCCcCcccCCccccCCCCCCeeecCCCcccccC
Q 047985          689 SNRFDGEIPTSISNLKGLQILSLADNSLHGHIPSCLGNLTDLESLDLSNNRFSGQIPQQLVELTFLEFFNVSDNHFTGPI  768 (930)
Q Consensus       689 ~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~lsg~ip~~l~~L~~L~~L~ls~N~L~g~i  768 (930)
                      +|+++|.||.+|++++.|+.|||++|+++|.||..|+++++|++||||+|+++|.||..++++++|++||+|+|+|+|+|
T Consensus       641 ~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~i  720 (768)
T 3rgz_A          641 YNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPI  720 (768)
T ss_dssp             SSCCBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEEC
T ss_pred             CCcccccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCcCccCCcccCCCCCCCCCCCCCCCCCCC
Q 047985          769 PQGKQFATFDKTSFDGNSGLCGRPLSSECEISE  801 (930)
Q Consensus       769 P~~~~~~~~~~~s~~gn~~Lcg~~l~~~c~~~~  801 (930)
                      |.++||++|...+|.|||+|||.|+. .|....
T Consensus       721 P~~~~~~~~~~~~~~gN~~Lcg~~l~-~C~~~~  752 (768)
T 3rgz_A          721 PEMGQFETFPPAKFLNNPGLCGYPLP-RCDPSN  752 (768)
T ss_dssp             CSSSSGGGSCGGGGCSCTEEESTTSC-CCCSCC
T ss_pred             CCchhhccCCHHHhcCCchhcCCCCc-CCCCCc
Confidence            99999999999999999999999987 897543



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 930
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-21
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-21
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-15
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 8e-15
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-11
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-11
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-18
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-18
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-17
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-12
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-12
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-06
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-17
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-14
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-14
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 9e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 9e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-05
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-13
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 6e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 5e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 6e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.002
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-09
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 9e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-09
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-09
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 6e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.001
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-08
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 1e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.003
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 7e-08
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 8e-07
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 1e-06
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 9e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.003
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-06
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-04
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 5e-05
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 0.002
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 4e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 5e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.003
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 7e-04
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
 Score = 94.4 bits (233), Expect = 1e-21
 Identities = 78/355 (21%), Positives = 124/355 (34%), Gaps = 58/355 (16%)

Query: 5   LCHGDERSALLQFKESLIISESKEIDTLYGPIFCHPKAASWKPEEGNNIDCC--SWDGVQ 62
           LC+  ++ ALLQ K+ L                     +SW P      DCC  +W GV 
Sbjct: 2   LCNPQDKQALLQIKKDLGNP---------------TTLSSWLP----TTDCCNRTWLGVL 42

Query: 63  CNENTG--HVIKLDLSSSCLQGSINSSSSLFKLVHLEWLDLAFNDFDGSEIPPEIINLSS 120
           C+ +T    V  LDLS   L       SSL  L +L +L +   +     IPP I  L+ 
Sbjct: 43  CDTDTQTYRVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQ 102

Query: 121 LSYLNLSSAAFSGQIPSEILELSKLAYLDLSHNSYYDPVELRKPSLGNLADKLTNLKELV 180
           L YL ++    SG IP  + ++  L  LD S+N+                          
Sbjct: 103 LHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSG----------------------- 139

Query: 181 LGDVTISSPIPHNLTYLSSLTTLSLSGCDLRGRIPSSLGNITRLIHLDLSF-NKLSDELP 239
                    +P +++ L +L  ++  G  + G IP S G+ ++L        N+L+ ++P
Sbjct: 140 --------TLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIP 191

Query: 240 TFIGTLGSLKELDLLQNNLSGELPNSIGNLASLEQVDLSLNRFLGKVPSSLGNLTQLHWL 299
                L                      +  + +      +         L        L
Sbjct: 192 PTFANLNLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLGKVGLSKNLNGLDL 251

Query: 300 SLASNDFSGELPASFGNLRSLRTLDVYECKFSGQIPSSLSNLTHLSFLDFSLNNF 354
              +N   G LP     L+ L +L+V      G+IP    NL       ++ N  
Sbjct: 252 R--NNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIP-QGGNLQRFDVSAYANNKC 303


>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query930
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.98
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.94
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.9
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.9
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.88
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.88
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.85
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.83
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.76
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.76
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.73
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.71
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.7
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.68
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.67
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.67
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.64
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.63
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.6
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.59
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.58
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.52
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.49
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.44
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.43
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.32
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.31
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.3
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.29
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.09
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.06
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.05
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.02
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.03
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.86
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.52
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.5
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.68
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.61
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=100.00  E-value=1.7e-40  Score=361.40  Aligned_cols=295  Identities=33%  Similarity=0.530  Sum_probs=205.8

Q ss_pred             CCcHHHHHHHHHHHhhcCCCCCccccccCCCccCCCCCCCCCCCCCCCCCCCc--ccceEecCCC--CcEEEEEcCCCCC
Q 047985            5 LCHGDERSALLQFKESLIISESKEIDTLYGPIFCHPKAASWKPEEGNNIDCCS--WDGVQCNENT--GHVIKLDLSSSCL   80 (930)
Q Consensus         5 ~c~~~~~~aLl~~k~~~~~~~~~~~~~~~~~~~~~~~l~~W~~~~~~~~~~C~--w~gv~C~~~~--~~v~~L~L~~~~l   80 (930)
                      -|+++||+|||+||+++.++.               .+++|..    ++|||.  |+||+|+..+  +||++|||+++.+
T Consensus         2 ~c~~~e~~aLl~~k~~~~~~~---------------~l~sW~~----~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~~l   62 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLGNPT---------------TLSSWLP----TTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNL   62 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCG---------------GGTTCCT----TSCTTTTCSTTEEECCSSSCCCEEEEEEECCCC
T ss_pred             CCCHHHHHHHHHHHHHCCCCC---------------cCCCCCC----CCCCCCCcCCCeEEeCCCCcEEEEEEECCCCCC
Confidence            599999999999999998763               5899987    679994  9999998754  4899999999999


Q ss_pred             cccccCcccccCCCCCCEEECCC-CCCCCCCCchhccCCCCCCEEEccCCCCCccCCccccCCCCCcEEEccCCCCCCCc
Q 047985           81 QGSINSSSSLFKLVHLEWLDLAF-NDFDGSEIPPEIINLSSLSYLNLSSAAFSGQIPSEILELSKLAYLDLSHNSYYDPV  159 (930)
Q Consensus        81 ~g~~~~~~~l~~l~~L~~L~Ls~-n~~~~~~ip~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~Ls~n~~~~~~  159 (930)
                      .|...-...+++|++|++|+|++ |.++|. +|+.|+++++|++|+|++|++.+..|..+..+.+|+++++++|.+    
T Consensus        63 ~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~-iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~----  137 (313)
T d1ogqa_          63 PKPYPIPSSLANLPYLNFLYIGGINNLVGP-IPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNAL----  137 (313)
T ss_dssp             SSCEECCGGGGGCTTCSEEEEEEETTEESC-CCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEE----
T ss_pred             CCCCCCChHHhcCccccccccccccccccc-cccccccccccchhhhccccccccccccccchhhhcccccccccc----
Confidence            88532223788888888888876 677775 788888888888888888888887777778888888888887732    


Q ss_pred             cccCCchhhhhhCCCCCCEEEcCCccCCCCCchhccCCCCC-CEEEccCCCCCCCCcccccCCCCCcEEEccCCCCCCch
Q 047985          160 ELRKPSLGNLADKLTNLKELVLGDVTISSPIPHNLTYLSSL-TTLSLSGCDLRGRIPSSLGNITRLIHLDLSFNKLSDEL  238 (930)
Q Consensus       160 ~~~~~~l~~~l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L-~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~  238 (930)
                      .   ..+|..+.++++|+++++++|.+.+.+|..+..+..+ +.+++++|++++..|..+.++..+ .++++.+...+.+
T Consensus       138 ~---~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~-~l~l~~~~~~~~~  213 (313)
T d1ogqa_         138 S---GTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLA-FVDLSRNMLEGDA  213 (313)
T ss_dssp             E---SCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCS-EEECCSSEEEECC
T ss_pred             c---ccCchhhccCcccceeeccccccccccccccccccccccccccccccccccccccccccccc-ccccccccccccc
Confidence            2   3445556666666666666666666666666665554 566666666666666655555433 4666666666666


Q ss_pred             hhhhcCCCCCCEEEccCCCCCCCcchhhcCCCCCCEEEccCCCCCCCCCCCCCCCcCCcEEEccCCCCCCccCccccccc
Q 047985          239 PTFIGTLGSLKELDLLQNNLSGELPNSIGNLASLEQVDLSLNRFLGKVPSSLGNLTQLHWLSLASNDFSGELPASFGNLR  318 (930)
Q Consensus       239 p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~  318 (930)
                      |..+..+++++.+++++|.+++.+| .++.+++|+.|+|++|+++|.+|..|+++++|++|+|++|+++|.+|. +++++
T Consensus       214 ~~~~~~~~~l~~l~~~~~~l~~~~~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~-~~~L~  291 (313)
T d1ogqa_         214 SVLFGSDKNTQKIHLAKNSLAFDLG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQ-GGNLQ  291 (313)
T ss_dssp             GGGCCTTSCCSEEECCSSEECCBGG-GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCC-STTGG
T ss_pred             ccccccccccccccccccccccccc-ccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCC-cccCC
Confidence            6666666666666666666655443 355566666666666666666666666666666666666666655553 45556


Q ss_pred             ccceeeccccc
Q 047985          319 SLRTLDVYECK  329 (930)
Q Consensus       319 ~L~~L~L~~n~  329 (930)
                      +|+.+++++|+
T Consensus       292 ~L~~l~l~~N~  302 (313)
T d1ogqa_         292 RFDVSAYANNK  302 (313)
T ss_dssp             GSCGGGTCSSS
T ss_pred             CCCHHHhCCCc
Confidence            66666666664



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure