Citrus Sinensis ID: 048038

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-
MDNNSNKLQLFLLSLFLLAISAVHPRSVPYSTPSDLISDGINSNNNHNQRGPQYLLLNPFIKAEEESSSSTCEQTYGFLPCTTTVLGNLFLIIVYGYLMYVAATYLSNGSELLLEILGPGVVGGLFLPILGALPDAMLILVSGLSGTKETAQSQVSVGMGLLAGSTVMLSTVIWGTCVVVGKCDLRESDSVAIDGQNTKGFRLTGTGVSTDVWTCYAARIMAISVIPFVVVQLPQMLNSTSGRHLAVLIALILSVSMLISYCLYQVFQPWIQKRRLAFAKHKHVISGILKHLRQRALGRLLTDSGEPNIDVIKKLFDAIDENKDERLSASELKALIIGIRFEEIDLDQDDAVSKVLSDFDTSNDSHIDIKEFINGIEKWLNEAMQARTGSADPGPHTMKFLDDFHLQTKREHALLGAEEESDEVAEGVENPKWVSFKAVLMLLIGTIIAAAFADPLVDAVDNFSAATSIPSFFISFIALPFATNSSEAVSAIIFASRKKIRTASLTFSELYGAVTMNNILCLSVFLALVYARGLTWDFSSEVLVILIVCLVMGAFASFRTNFPLWTCSIAYALYPFSLALVYVLDYFFGWS
cccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHcccccHHHHHHHHHHcccccHHHHHHHHHHcccEEEEEEEEccccccccccccccccccccccccccccccHHHHHHHHHHccHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHcccccccccHHHHHHHHHHccccccccccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHccccccccHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHcccccccHHHHEEccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccc
ccccccHHHHHHHHHHHHHHHHcccccccccccccEcccccccccccccccccEEEEcccccccccccHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHcccccHHHHHHHHHHHcHHHHEHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccccccccHHHHHHHHHccccccccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHcccccccccccccEEEccccccccHHHHHHHccccccccHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEHHHHHHcHHHHHHHHHHHHHccccEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcccc
MDNNSNKLQLFLLSLFLLAISavhprsvpystpsdlisdginsnnnhnqrgpqylllnpfikaeeesssstceqtygflpctttVLGNLFLIIVYGYLMYVAATYLSNGSELLLEIlgpgvvgglflpilgalpDAMLILVSglsgtketaQSQVSVGMGLLAGSTVMLSTVIWGTCVvvgkcdlresdsvaidgqntkgfrltgtgvstDVWTCYAARIMAISVIPFVVVQlpqmlnstSGRHLAVLIALILSVSMLISYCLYQVFQPWIQKRRLAFAKHKHVISGILKHLRQRALGRlltdsgepnIDVIKKLFDAIDENKDERLSASELKALIIGIRfeeidldqdDAVSKVlsdfdtsndshiDIKEFINGIEKWLNEAMQartgsadpgphtmkfLDDFHLQTKREHALlgaeeesdevaegvenpkwVSFKAVLMLLIGTIIAAAfadplvdavdnfsaatsipsFFISFialpfatnssEAVSAIIFASRKKIRTASLTFSELYGAVTMNNILCLSVFLALVYARGLTWDFSSEVLVILIVCLVMGAfasfrtnfplwtcSIAYALYPFSLALVYVLDYFFGWS
MDNNSNKLQLFLLSLFLLAISAVHPRSVPYSTPSDLISDGINSNNNHNQRGPQYLLLNPFIKAEEESSSSTCEQTYGFLPCTTTVLGNLFLIIVYGYLMYVAATYLSNGSELLLEILGPGVVGGLFLPILGALPDAMLILVSGLSGTKETAQSQVSVGMGLLAGSTVMLSTVIWGTCVVVGKCDLREsdsvaidgqntkgfrltgtgvSTDVWTCYAARIMAISVIPFVVVQLPQMLNSTSGRHLAVLIALILSVSMLISYCLYQVFQPWIQKRRLAFAKHKHVISGILKHLRQRALGrlltdsgepniDVIKKLFDAIDENKDERLSASELKALIIGIRFeeidldqdDAVSKVLSdfdtsndshidIKEFINGIEKWLNEAMQARTGSADPGPHTMKFLDDFHLQTKREHALLGAEEESDEVAEGVENPKWVSFKAVLMLLIGTIIAAAFADPLVDAVDNFSAATSIPSFFISFIALPFATNSSEAVSAIIFASRKKIRTASLTFSELYGAVTMNNILCLSVFLALVYARGLTWDFSSEVLVILIVCLVMGAFASFRTNFPLWTCSIAYALYPFSLALVYVLDYFFGWS
MDNNSNKlqlfllslfllAISAVHPRSVPYSTPSDLISDGINSNNNHNQRGPQYLLLNPFIKAeeessssTCEQTYGFLPCTTTVLGNLFLIIVYGYLMYVAATYLSNGSELLLEilgpgvvgglflpilgALPDAMLILVSGLSGTKETAQSQVSVGMGLLAGSTVMLSTVIWGTCVVVGKCDLRESDSVAIDGQNTKGFRLTGTGVSTDVWTCYAARIMAISVIPFVVVQLPQMLNSTSGRHLAVLIALILSVSMLISYCLYQVFQPWIQKRRLAFAKHKHVISGILKHLRQRALGRLLTDSGEPNIDVIKKLFDAIDENKDERLSASELKALIIGIRFEEIDLDQDDAVSKVLSDFDTSNDSHIDIKEFINGIEKWLNEAMQARTGSADPGPHTMKFLDDFHLQTKREHALLgaeeesdevaegveNPKWVSFKAVLMLLIGTIIAAAFADPLVDAVDNFSAATSIPSFFISFIALPFATNSSEAVSAIIFASRKKIRTASLTFSELYGAVTMNNILCLSVFLALVYARGLTWDFSSEVLVILIVCLVMGAFASFRTNFPLWTCSIAYALYPFSLALVYVLDYFFGWS
*******LQLFLLSLFLLAISAVHPRSV*************************YLLLN***************QTYGFLPCTTTVLGNLFLIIVYGYLMYVAATYLSNGSELLLEILGPGVVGGLFLPILGALPDAMLILVSGLSGTKETAQSQVSVGMGLLAGSTVMLSTVIWGTCVVVGKCDLRESDSVAIDGQNTKGFRLTGTGVSTDVWTCYAARIMAISVIPFVVVQLPQMLNSTSGRHLAVLIALILSVSMLISYCLYQVFQPWIQKRRLAFAKHKHVISGILKHLRQRALGRLLTDSGEPNIDVIKKLFDAIDENK**RLSASELKALIIGIRFEEIDLDQDDAVSKVLSDFDTSNDSHIDIKEFINGIEKWLNEA****************FLDDFHL*********************VENPKWVSFKAVLMLLIGTIIAAAFADPLVDAVDNFSAATSIPSFFISFIALPFATNSSEAVSAIIFASRKKIRTASLTFSELYGAVTMNNILCLSVFLALVYARGLTWDFSSEVLVILIVCLVMGAFASFRTNFPLWTCSIAYALYPFSLALVYVLDYFFGW*
******K**LFLLSLFLLAISAVHPRSVPYSTPSDLI****************YLLLNPF*********STCEQTYGFLPCTTTVLGNLFLIIVYGYLMYVAATYLSNGSELLLEILGPGVVGGLFLPILGALPDAMLILVSGLSGTKETA**QVSVGMGLLAGSTVMLSTVIWGTCVVVGKCD****************FRLTGTGVSTDVWTCYAARIMAISVIPFVVVQLPQMLNSTSGRHLAVLIALILSVSMLISYCLYQVFQPWIQKRRLAFAK**HV**************************VIKKLFDAIDENKDE*LSASELKALIIGIRFEEIDLDQDDAVSKVLSDFDTSNDSHIDIKEFINGIEK**********************************************AEGVENPKWVSFKAVLMLLIGTIIAAAFADPLVDAVDNFSAATSIPSFFISFIALPFATNSSEAVSAIIFASRKKIRTASLTFSELYGAVTMNNILCLSVFLALVYARGLTWDFSSEVLVILIVCLVMGAFASFRTNFPLWTCSIAYALYPFSLALVYVLDYFFGWS
MDNNSNKLQLFLLSLFLLAISAVHPRSVPYSTPSDLISDGINSNNNHNQRGPQYLLLNPFIKA***********TYGFLPCTTTVLGNLFLIIVYGYLMYVAATYLSNGSELLLEILGPGVVGGLFLPILGALPDAMLILVSGLSGTKETAQSQVSVGMGLLAGSTVMLSTVIWGTCVVVGKCDLRESDSVAIDGQNTKGFRLTGTGVSTDVWTCYAARIMAISVIPFVVVQLPQMLNSTSGRHLAVLIALILSVSMLISYCLYQVFQPWIQKRRLAFAKHKHVISGILKHLRQRALGRLLTDSGEPNIDVIKKLFDAIDENKDERLSASELKALIIGIRFEEIDLDQDDAVSKVLSDFDTSNDSHIDIKEFINGIEKWLNEAMQARTGSADPGPHTMKFLDDFHLQTKREHALLG***********VENPKWVSFKAVLMLLIGTIIAAAFADPLVDAVDNFSAATSIPSFFISFIALPFATNSSEAVSAIIFASRKKIRTASLTFSELYGAVTMNNILCLSVFLALVYARGLTWDFSSEVLVILIVCLVMGAFASFRTNFPLWTCSIAYALYPFSLALVYVLDYFFGWS
*DNNSNKLQLFLLSLFLLAISAVHPRSVPYSTPSDLISD*INSNNNHNQRGPQYLLLNPFIKAEEESSSSTCEQTYGFLPCTTTVLGNLFLIIVYGYLMYVAATYLSNGSELLLEILGPGVVGGLFLPILGALPDAMLILVSGLSGTKETAQSQVSVGMGLLAGSTVMLSTVIWGTCVVVGKCDLRE***************LTGTGVSTDVWTCYAARIMAISVIPFVVVQLPQMLNSTSGRHLAVLIALILSVSMLISYCLYQVFQPWIQKRRLAFAKHKHVISGILKHLRQRALGRLLTDSGEPNIDVIKKLFDAIDENKDERLSASELKALIIGIRFEEIDLDQDDAVSKVLSDFDTSNDSHIDIKEFINGIEKWLNEAMQ***********TMKFLDDFHLQTKREHALLGAEEESDEVAEGVENPKWVSFKAVLMLLIGTIIAAAFADPLVDAVDNFSAATSIPSFFISFIALPFATNSSEAVSAIIFASRKKIRTASLTFSELYGAVTMNNILCLSVFLALVYARGLTWDFSSEVLVILIVCLVMGAFASFRTNFPLWTCSIAYALYPFSLALVYVLDYFFGWS
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHooooooo
iiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiHHHHHHHHHHHHHHHHHHHHHHHooooo
SSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHHiiii
SSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHooo
SSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDNNSNKLQLFLLSLFLLAISAVHPRSVPYSTPSDLISDGINSNNNHNQRGPQYLLLNPFIKAEEESSSSTCEQTYGFLPCTTTVLGNLFLIIVYGYLMYVAATYLSNGSELLLEILGPGVVGGLFLPILGALPDAMLILVSGLSGTKETAQSQVSVGMGLLAGSTVMLSTVIWGTCVVVGKCDLRESDSVAIDGQNTKGFRLTGTGVSTDVWTCYAARIMAISVIPFVVVQLPQMLNSTSGRHLAVLIALILSVSMLISYCLYQVFQPWIQKRRLAFAKHKHVISGILKHLRQRALGRLLTDSGEPNIDVIKKLFDAIDENKDERLSASELKALIIGIRFEEIDLDQDDAVSKVLSDFDTSNDSHIDIKEFINGIEKWLNEAMQARTGSADPGPHTMKFLDDFHLQTKREHALLGAEEESDEVAEGVENPKWVSFKAVLMLLIGTIIAAAFADPLVDAVDNFSAATSIPSFFISFIALPFATNSSEAVSAIIFASRKKIRTASLTFSELYGAVTMNNILCLSVFLALVYARGLTWDFSSEVLVILIVCLVMGAFASFRTNFPLWTCSIAYALYPFSLALVYVLDYFFGWS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query591 2.2.26 [Sep-21-2011]
Q99385411 Vacuolar calcium ion tran yes no 0.167 0.240 0.349 8e-07
Q8L783441 Vacuolar cation/proton ex no no 0.137 0.183 0.333 0.0001
Q9LFZ8448 Putative vacuolar cation/ no no 0.137 0.180 0.333 0.0002
Q39254441 Vacuolar cation/proton ex no no 0.137 0.183 0.333 0.0004
Q39253463 Vacuolar cation/proton ex no no 0.160 0.205 0.333 0.0006
>sp|Q99385|VCX1_YEAST Vacuolar calcium ion transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VCX1 PE=1 SV=1 Back     alignment and function desciption
 Score = 56.2 bits (134), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 36/103 (34%), Positives = 58/103 (56%), Gaps = 4/103 (3%)

Query: 405 HLQTKREHALL-GAEEESDEVAEGV-ENPKW-VSFKAVLMLLIGTIIAAAF-ADPLVDAV 460
           + Q    HAL    EEE+DEV   +  NP   +S K+ L++L+GT +  +F AD LV  +
Sbjct: 216 YFQLGSHHALFEQQEEETDEVMSTISRNPHHSLSVKSSLVILLGTTVIISFCADFLVGTI 275

Query: 461 DNFSAATSIPSFFISFIALPFATNSSEAVSAIIFASRKKIRTA 503
           DN   +T +   FI  I +P   N++E V++++ A + K+  A
Sbjct: 276 DNVVESTGLSKTFIGLIVIPIVGNAAEHVTSVLVAMKDKMDLA 318
Has a role in promoting intracellular calcium ion sequestration via the exchange of calcium ions for hydrogen ions across the vacuolar membrane. Involved also in manganese ion homeostasis via its uptake into the vacuole.
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (taxid: 559292)
>sp|Q8L783|CAX5_ARATH Vacuolar cation/proton exchanger 5 OS=Arabidopsis thaliana GN=CAX5 PE=2 SV=1 Back     alignment and function description
>sp|Q9LFZ8|CAX6_ARATH Putative vacuolar cation/proton exchanger 6 OS=Arabidopsis thaliana GN=CAX6 PE=2 SV=3 Back     alignment and function description
>sp|Q39254|CAX2_ARATH Vacuolar cation/proton exchanger 2 OS=Arabidopsis thaliana GN=CAX2 PE=1 SV=2 Back     alignment and function description
>sp|Q39253|CAX1_ARATH Vacuolar cation/proton exchanger 1 OS=Arabidopsis thaliana GN=CAX1 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query591
224056545591 predicted protein [Populus trichocarpa] 0.950 0.950 0.732 0.0
449456591589 PREDICTED: uncharacterized protein LOC10 0.925 0.928 0.731 0.0
356549685579 PREDICTED: uncharacterized protein LOC10 0.962 0.982 0.701 0.0
30695448585 calcium-binding EF-hand domain-containin 0.940 0.950 0.727 0.0
449456593584 PREDICTED: uncharacterized protein LOC10 0.917 0.928 0.724 0.0
297847712588 sodium/calcium exchanger family protein 0.947 0.952 0.710 0.0
307135947585 sodium/calcium exchanger family protein 0.915 0.924 0.726 0.0
225461603579 PREDICTED: uncharacterized protein LOC10 0.925 0.944 0.716 0.0
255562295543 calcium ion binding protein, putative [R 0.884 0.963 0.715 0.0
7769854574 F12M16.12 [Arabidopsis thaliana] 0.922 0.949 0.711 0.0
>gi|224056545|ref|XP_002298903.1| predicted protein [Populus trichocarpa] gi|222846161|gb|EEE83708.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  838 bits (2166), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/569 (73%), Positives = 487/569 (85%), Gaps = 7/569 (1%)

Query: 24  HPRSVPYSTPSDLISDGINSNNNHNQRGPQYLLLNPFIKAEEESSSSTCEQTYGFLPCTT 83
           H R  P+  PSDLISDG+ +N + NQ        +PF  A + S+  TCEQTYGFLPCTT
Sbjct: 29  HSRYSPFD-PSDLISDGVLNNQSLNQTTS-----SPFHLALKSSAEETCEQTYGFLPCTT 82

Query: 84  TVLGNLFLIIVYGYLMYVAATYLSNGSELLLEILGPGVVGGLFLPILGALPDAMLILVSG 143
           TV+GNLFLI+VYGYLM+ AATYLS+GSELLL+ILGPG++GGLFLP+LGALPDA+LILVSG
Sbjct: 83  TVIGNLFLILVYGYLMFFAATYLSSGSELLLQILGPGIIGGLFLPVLGALPDALLILVSG 142

Query: 144 LSGTKETAQSQVSVGMGLLAGSTVMLSTVIWGTCVVVGKCDLRESDSVAIDGQNTKGFRL 203
           LSG+ ETAQSQVSVGMGLLAGSTVML TVIWG+CVVVGKCD+ E+++ AID ++TK F L
Sbjct: 143 LSGSTETAQSQVSVGMGLLAGSTVMLLTVIWGSCVVVGKCDMSETENSAIDRKDTKRFSL 202

Query: 204 TGTGVSTDVWTCYAARIMAISVIPFVVVQLPQMLNSTSGRHLAVLIALILSVSMLISYCL 263
           TG+GVSTD+WTCYAARIMAIS++PF+VVQL Q L+STSG+HLAVLI LILS+++LISYCL
Sbjct: 203 TGSGVSTDIWTCYAARIMAISILPFIVVQLLQTLHSTSGKHLAVLIGLILSLAILISYCL 262

Query: 264 YQVFQPWIQKRRLAFAKHKHVISGILKHLRQRALGRLLTDSGEPNIDVIKKLFDAIDENK 323
           YQVFQPWIQ+R+L + +HK V+SGILKHL+QRALGRLL D    +  V++KLF+ IDEN 
Sbjct: 263 YQVFQPWIQERKLKYTRHKLVMSGILKHLKQRALGRLLADDSSLDESVVQKLFNTIDENG 322

Query: 324 DERLSASELKALIIGIRFEEIDLDQDDAVSKVLSDFDTSNDSHIDIKEFINGIEKWLNEA 383
           D  LSASELKAL+IGIRFEEID D+DDAVSK++ DFD +ND+ I+ +EFINGI+KWL+EA
Sbjct: 323 DGCLSASELKALVIGIRFEEIDFDKDDAVSKLIKDFDKTNDNLINFREFINGIQKWLDEA 382

Query: 384 MQARTGSADPGPHTMKFLDDFHLQTKREHALLGAEE-ESDEVAEGVENPKWVSFKAVLML 442
           M+   GS DPGP T K+LD+FH +TK+ HALLG++E E  E   GV+NP+W SFKA LML
Sbjct: 383 MRVGGGSPDPGPRTHKYLDNFHDKTKKAHALLGSKEPEEGESDGGVKNPRWTSFKASLML 442

Query: 443 LIGTIIAAAFADPLVDAVDNFSAATSIPSFFISFIALPFATNSSEAVSAIIFASRKKIRT 502
           L G +IAAAFADPLVDAVDNFS ATSIP+FFISFIALP ATNSSEAVSAIIFASRKK+ T
Sbjct: 443 LAGAVIAAAFADPLVDAVDNFSDATSIPTFFISFIALPLATNSSEAVSAIIFASRKKVTT 502

Query: 503 ASLTFSELYGAVTMNNILCLSVFLALVYARGLTWDFSSEVLVILIVCLVMGAFASFRTNF 562
           ASLTFSELYGAVTMNN+LCLSVFLALVY R LTWDFS+EVLVI IVC+VMGAFASFRT F
Sbjct: 503 ASLTFSELYGAVTMNNVLCLSVFLALVYFRELTWDFSAEVLVICIVCIVMGAFASFRTTF 562

Query: 563 PLWTCSIAYALYPFSLALVYVLDYFFGWS 591
           PLWTC +AY LYPFSL LVYVLDY  GWS
Sbjct: 563 PLWTCFLAYFLYPFSLVLVYVLDYVLGWS 591

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449456591|ref|XP_004146032.1| PREDICTED: uncharacterized protein LOC101209298 isoform 1 [Cucumis sativus] gi|449507105|ref|XP_004162934.1| PREDICTED: uncharacterized protein LOC101229160 isoform 1 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356549685|ref|XP_003543222.1| PREDICTED: uncharacterized protein LOC100809896 [Glycine max] Back     alignment and taxonomy information
>gi|30695448|ref|NP_564623.2| calcium-binding EF-hand domain-containing protein [Arabidopsis thaliana] gi|20466169|gb|AAM20402.1| unknown protein [Arabidopsis thaliana] gi|332194787|gb|AEE32908.1| calcium-binding EF-hand domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449456593|ref|XP_004146033.1| PREDICTED: uncharacterized protein LOC101209298 isoform 2 [Cucumis sativus] gi|449507108|ref|XP_004162935.1| PREDICTED: uncharacterized protein LOC101229160 isoform 2 [Cucumis sativus] Back     alignment and taxonomy information
>gi|297847712|ref|XP_002891737.1| sodium/calcium exchanger family protein [Arabidopsis lyrata subsp. lyrata] gi|297337579|gb|EFH67996.1| sodium/calcium exchanger family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|307135947|gb|ADN33808.1| sodium/calcium exchanger family protein [Cucumis melo subsp. melo] Back     alignment and taxonomy information
>gi|225461603|ref|XP_002282948.1| PREDICTED: uncharacterized protein LOC100252144 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255562295|ref|XP_002522155.1| calcium ion binding protein, putative [Ricinus communis] gi|223538632|gb|EEF40234.1| calcium ion binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|7769854|gb|AAF69532.1|AC008007_7 F12M16.12 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query591
TAIR|locus:2009580585 AT1G53210 [Arabidopsis thalian 0.957 0.967 0.681 8.4e-200
DICTYBASE|DDB_G0278609574 DDB_G0278609 [Dictyostelium di 0.272 0.280 0.434 5.3e-65
TAIR|locus:2055471566 AT2G34030 [Arabidopsis thalian 0.832 0.869 0.323 5.5e-61
TAIR|locus:2055461610 AT2G34020 [Arabidopsis thalian 0.590 0.572 0.305 5.6e-60
DICTYBASE|DDB_G0286639368 DDB_G0286639 [Dictyostelium di 0.213 0.342 0.203 1.3e-06
TAIR|locus:2074348459 CAX3 "cation exchanger 3" [Ara 0.201 0.259 0.248 0.00011
TAIR|locus:2009580 AT1G53210 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1934 (685.9 bits), Expect = 8.4e-200, P = 8.4e-200
 Identities = 391/574 (68%), Positives = 445/574 (77%)

Query:    21 SAVHPRSVPYSTPS-DLISDGINSNNNHNQRGPQYLLLNPFIKAXXXXXXXTCEQTYGFL 79
             S+ + R V  +  S  LISDGI+  +N    G    ++   + A        CEQTYGF+
Sbjct:    17 SSAYARFVSLNPSSTSLISDGIDGGSNLAGSGS---VIKSVVSAPAEEKEEACEQTYGFM 73

Query:    80 PCTTTVLGNLFLIIVYGYLMYVAATYLSNGSELLLEXXXXXXXXXXXXXXXXALPDAMLI 139
             PCT T LGN+FLI+VYG+LM+ AATYLS GSELLLE                ALPDAMLI
Sbjct:    74 PCTKTALGNVFLILVYGFLMFTAATYLSAGSELLLEILGPGIVGGLFLPMLGALPDAMLI 133

Query:   140 LVSGLSGTKETAQSQVSVGMGLLAGSTVMLSTVIWGTCVVVGKCDLRESDSVAIDGQNTK 199
             +VSGLSG   TAQSQVSVGMGLLAGSTVML TVIWGTC VVGKCDLR  DS+A++ Q+TK
Sbjct:   134 MVSGLSGDAATAQSQVSVGMGLLAGSTVMLLTVIWGTCTVVGKCDLR--DSIAVNNQDTK 191

Query:   200 GFRLTGTGVSTDVWTCYAARIMAISVIPFVVVQLPQMLNSTSGRHLAVLIALILSVSMLI 259
             GF L  +GV+ D+WT YAARIMAISVIPFV+VQLPQML STSGR L+VLIALILSV MLI
Sbjct:   192 GFHLKDSGVTVDIWTSYAARIMAISVIPFVIVQLPQMLGSTSGRQLSVLIALILSVLMLI 251

Query:   260 SYCLYQVFQPWIQKRRLAFAKHKHVISGILKHLRQRALGRLLTDSGEPNIDVIKKLFDAI 319
             SYC+YQVFQPWIQ+RRLAFAKHKHVISGIL+HL+Q ALGRLL D G+P+  VI+KLF  I
Sbjct:   252 SYCVYQVFQPWIQRRRLAFAKHKHVISGILRHLKQHALGRLLDDEGQPDEHVIRKLFLTI 311

Query:   320 DENKDERLSASELKALIIGIRFEEIDLDQDDAVSKVLSDFDTSNDSHIDIKEFINGIEKW 379
             D N D  LSA+ELKALIIGI FE+ID D+DDAV KVL DFD + D  +D +EF+ GI++W
Sbjct:   312 DANNDGHLSAAELKALIIGISFEDIDFDKDDAVGKVLQDFDKTLDEQVDQEEFVRGIKQW 371

Query:   380 LNEAMQARTGSADPGPHTMKFLDDFHLQTKREHALLXXXXXXXXXXXXX--XNPKWVSFK 437
             L +AM       + GP TMKFLD+FH+QTKREHALL                +PKW++ K
Sbjct:   372 LIQAMGGAPSGPEAGPRTMKFLDNFHVQTKREHALLGDNENGENDEEGGEVADPKWITIK 431

Query:   438 AVLMLLIGTIIAAAFADPLVDAVDNFSAATSIPSFFISFIALPFATNSSEAVSAIIFASR 497
             A L+LL+G  IAAAFADPLVD V+NFSAAT IPSFFISFIALP ATNSSEAVSAIIFASR
Sbjct:   432 AALLLLLGAAIAAAFADPLVDTVNNFSAATGIPSFFISFIALPLATNSSEAVSAIIFASR 491

Query:   498 KKIRTASLTFSELYGAVTMNNILCLSVFLALVYARGLTWDFSSEVLVILIVCLVMGAFAS 557
             KKIRTASLTFSEL G VTMNNILCLSVFLA+VY RGLTW+FSSEVLVILIVCLVMG FAS
Sbjct:   492 KKIRTASLTFSELCGGVTMNNILCLSVFLAIVYVRGLTWNFSSEVLVILIVCLVMGGFAS 551

Query:   558 FRTNFPLWTCSIAYALYPFSLALVYVLDYFFGWS 591
             FRT +PLWTC IAY LYPFSL LVY+LDY+FGWS
Sbjct:   552 FRTTYPLWTCFIAYLLYPFSLGLVYILDYWFGWS 585
GO:0005509 "calcium ion binding" evidence=IEA;ISS
GO:0009507 "chloroplast" evidence=ISM
GO:0016021 "integral to membrane" evidence=IEA
GO:0055085 "transmembrane transport" evidence=IEA
GO:0016020 "membrane" evidence=ISS;IDA
GO:0005773 "vacuole" evidence=IDA
GO:0000325 "plant-type vacuole" evidence=IDA
GO:0005774 "vacuolar membrane" evidence=IDA
GO:0009506 "plasmodesma" evidence=IDA
GO:0007030 "Golgi organization" evidence=RCA
GO:0007033 "vacuole organization" evidence=RCA
GO:0042744 "hydrogen peroxide catabolic process" evidence=RCA
DICTYBASE|DDB_G0278609 DDB_G0278609 [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TAIR|locus:2055471 AT2G34030 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2055461 AT2G34020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0286639 DDB_G0286639 [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TAIR|locus:2074348 CAX3 "cation exchanger 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_Genewise1_v1.C_LG_I4955
SubName- Full=Putative uncharacterized protein; (592 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query591
pfam01699135 pfam01699, Na_Ca_ex, Sodium/calcium exchanger prot 1e-10
TIGR00846365 TIGR00846, caca2, calcium/proton exchanger 3e-09
COG0387368 COG0387, ChaA, Ca2+/H+ antiporter [Inorganic ion t 6e-09
COG0530320 COG0530, ECM27, Ca2+/Na+ antiporter [Inorganic ion 3e-08
pfam1349960 pfam13499, EF_hand_5, EF-hand domain pair 6e-07
cd0005163 cd00051, EFh, EF-hand, calcium binding motif; A di 2e-06
TIGR00378349 TIGR00378, cax, calcium/proton exchanger (cax) 8e-05
cd0502592 cd05025, S-100A1, S-100A1: S-100A1 domain found in 0.003
>gnl|CDD|216653 pfam01699, Na_Ca_ex, Sodium/calcium exchanger protein Back     alignment and domain information 
 Score = 59.1 bits (144), Expect = 1e-10
 Identities = 30/138 (21%), Positives = 53/138 (38%), Gaps = 6/138 (4%)

Query: 447 IIAAAFADPLVDAVDNFSAATSIPSFFISFIALPFATNSSEAVSAIIFASRKKIRTASLT 506
           ++    AD LVD+ ++ +    I    I    L   T+  E  S+II A +     A   
Sbjct: 1   LLIILLADLLVDSAESIAEVLGISPTVIGLTLLALGTSLPELFSSIIAALKGNADLA--- 57

Query: 507 FSELYGAVTMNN--ILCLSVFLALVYARGLTWDFSSEVLVILIVCLVMGAF-ASFRTNFP 563
              + G+   N   +L LS  ++ +  + L    S +   +L+V L++  F         
Sbjct: 58  LGNVIGSNLFNILLVLGLSALISPIGLKVLVSPLSLDFSFLLLVLLLLLLFLLLSDGRIS 117

Query: 564 LWTCSIAYALYPFSLALV 581
            +   +   LY   L L 
Sbjct: 118 RFEGLVLLLLYIVYLVLS 135

This is a family of sodium/calcium exchanger integral membrane proteins. This family covers the integral membrane regions of the proteins. Sodium/calcium exchangers regulate intracellular Ca2+ concentrations in many cells; cardiac myocytes, epithelial cells, neurons retinal rod photoreceptors and smooth muscle cells. Ca2+ is moved into or out of the cytosol depending on Na+ concentration. In humans and rats there are 3 isoforms; NCX1 NCX2 and NCX3. Length = 135
>gnl|CDD|129926 TIGR00846, caca2, calcium/proton exchanger Back     alignment and domain information
>gnl|CDD|223464 COG0387, ChaA, Ca2+/H+ antiporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|223604 COG0530, ECM27, Ca2+/Na+ antiporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|222177 pfam13499, EF_hand_5, EF-hand domain pair Back     alignment and domain information
>gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>gnl|CDD|129474 TIGR00378, cax, calcium/proton exchanger (cax) Back     alignment and domain information
>gnl|CDD|240152 cd05025, S-100A1, S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 591
KOG1397441 consensus Ca2+/H+ antiporter VCX1 and related prot 100.0
TIGR00378349 cax calcium/proton exchanger (cax). 100.0
TIGR00846365 caca2 calcium/proton exchanger. This model is gene 100.0
COG0387368 ChaA Ca2+/H+ antiporter [Inorganic ion transport a 100.0
PRK10734325 putative calcium/sodium:proton antiporter; Provisi 100.0
COG0530320 ECM27 Ca2+/Na+ antiporter [Inorganic ion transport 99.98
TIGR00367307 K+-dependent Na+/Ca+ exchanger related-protein. Th 99.97
KOG1307588 consensus K+-dependent Ca2+/Na+ exchanger NCKX1 an 99.96
PRK10599366 calcium/sodium:proton antiporter; Provisional 99.96
TIGR009271096 2A1904 K+-dependent Na+/Ca+ exchanger. 99.95
PLN03151650 cation/calcium exchanger; Provisional 99.76
PRK10734 325 putative calcium/sodium:proton antiporter; Provisi 99.44
PF01699140 Na_Ca_ex: Sodium/calcium exchanger protein; InterP 99.32
COG0530 320 ECM27 Ca2+/Na+ antiporter [Inorganic ion transport 99.31
TIGR00367 307 K+-dependent Na+/Ca+ exchanger related-protein. Th 99.26
TIGR00927 1096 2A1904 K+-dependent Na+/Ca+ exchanger. 99.22
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 99.12
PF01699140 Na_Ca_ex: Sodium/calcium exchanger protein; InterP 99.08
KOG2399605 consensus K+-dependent Na+:Ca2+ antiporter [Inorga 99.07
TIGR00845928 caca sodium/calcium exchanger 1. This model is spe 98.95
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 98.94
TIGR00846365 caca2 calcium/proton exchanger. This model is gene 98.94
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 98.92
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 98.84
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 98.81
cd0021388 S-100 S-100: S-100 domain, which represents the la 98.79
PLN03151 650 cation/calcium exchanger; Provisional 98.77
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 98.76
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 98.72
cd0005267 EH Eps15 homology domain; found in proteins implic 98.7
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 98.69
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 98.69
KOG0027151 consensus Calmodulin and related proteins (EF-Hand 98.65
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 98.64
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 98.55
TIGR00845928 caca sodium/calcium exchanger 1. This model is spe 98.53
KOG0027151 consensus Calmodulin and related proteins (EF-Hand 98.52
TIGR00378 349 cax calcium/proton exchanger (cax). 98.48
PTZ00184149 calmodulin; Provisional 98.47
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 98.44
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 98.38
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 98.33
PTZ00183158 centrin; Provisional 98.33
cd0503088 calgranulins Calgranulins: S-100 domain found in p 98.3
PTZ00183158 centrin; Provisional 98.26
KOG0377631 consensus Protein serine/threonine phosphatase RDG 98.23
KOG0034187 consensus Ca2+/calmodulin-dependent protein phosph 98.19
PTZ00184149 calmodulin; Provisional 98.18
KOG0028172 consensus Ca2+-binding protein (centrin/caltractin 98.03
KOG1307 588 consensus K+-dependent Ca2+/Na+ exchanger NCKX1 an 98.0
PF1465866 EF-hand_9: EF-hand domain 97.96
KOG0037221 consensus Ca2+-binding protein, EF-Hand protein su 97.95
KOG0028172 consensus Ca2+-binding protein (centrin/caltractin 97.93
cd0502491 S-100A10 S-100A10: A subgroup of the S-100A10 doma 97.9
KOG0044193 consensus Ca2+ sensor (EF-Hand superfamily) [Signa 97.78
KOG0036 463 consensus Predicted mitochondrial carrier protein 97.78
KOG0041244 consensus Predicted Ca2+-binding protein, EF-Hand 97.78
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 97.71
KOG0031171 consensus Myosin regulatory light chain, EF-Hand p 97.7
PLN02964 644 phosphatidylserine decarboxylase 97.66
KOG0046 627 consensus Ca2+-binding actin-bundling protein (fim 97.66
PF12763104 EF-hand_4: Cytoskeletal-regulatory complex EF hand 97.64
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 97.62
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 97.53
KOG0036 463 consensus Predicted mitochondrial carrier protein 97.49
KOG0031171 consensus Myosin regulatory light chain, EF-Hand p 97.45
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 97.4
KOG0030152 consensus Myosin essential light chain, EF-Hand pr 97.36
KOG00402399 consensus Ca2+-binding actin-bundling protein (spe 97.33
PRK12309391 transaldolase/EF-hand domain-containing protein; P 97.32
PLN02964 644 phosphatidylserine decarboxylase 97.32
PF10591113 SPARC_Ca_bdg: Secreted protein acidic and rich in 97.14
KOG0030152 consensus Myosin essential light chain, EF-Hand pr 97.13
KOG4065144 consensus Uncharacterized conserved protein [Funct 97.11
KOG4223325 consensus Reticulocalbin, calumenin, DNA supercoil 97.08
KOG0044193 consensus Ca2+ sensor (EF-Hand superfamily) [Signa 97.01
KOG4223325 consensus Reticulocalbin, calumenin, DNA supercoil 96.98
KOG4251362 consensus Calcium binding protein [General functio 96.96
KOG0037221 consensus Ca2+-binding protein, EF-Hand protein su 96.81
PRK10599366 calcium/sodium:proton antiporter; Provisional 96.7
KOG0034187 consensus Ca2+/calmodulin-dependent protein phosph 96.17
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 96.12
KOG1306596 consensus Ca2+/Na+ exchanger NCX1 and related prot 96.1
KOG0038189 consensus Ca2+-binding kinase interacting protein 95.96
PF1478851 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA 95.79
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 95.59
KOG2399 605 consensus K+-dependent Na+:Ca2+ antiporter [Inorga 95.22
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 95.07
KOG1306596 consensus Ca2+/Na+ exchanger NCX1 and related prot 94.61
COG0387368 ChaA Ca2+/H+ antiporter [Inorganic ion transport a 94.45
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 93.88
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 93.55
KOG3555434 consensus Ca2+-binding proteoglycan Testican [Gene 93.33
KOG3866442 consensus DNA-binding protein of the nucleobindin 92.87
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 91.88
KOG1397441 consensus Ca2+/H+ antiporter VCX1 and related prot 90.64
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 88.41
cd0502491 S-100A10 S-100A10: A subgroup of the S-100A10 doma 87.94
KOG1955 737 consensus Ral-GTPase effector RALBP1 [Intracellula 87.85
PF1478851 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA 87.61
KOG0377631 consensus Protein serine/threonine phosphatase RDG 87.48
KOG2643489 consensus Ca2+ binding protein, contains EF-hand m 86.67
PF0927983 EF-hand_like: Phosphoinositide-specific phospholip 86.44
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 86.14
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 86.03
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 85.41
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 85.14
KOG4251362 consensus Calcium binding protein [General functio 84.68
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 82.57
KOG2243 5019 consensus Ca2+ release channel (ryanodine receptor 81.42
cd0503088 calgranulins Calgranulins: S-100 domain found in p 81.08
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 80.46
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 80.42
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 80.1
>KOG1397 consensus Ca2+/H+ antiporter VCX1 and related proteins [Inorganic ion transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=7.4e-42  Score=349.63  Aligned_cols=321  Identities=23%  Similarity=0.359  Sum_probs=270.2

Q ss_pred             HHHHHHHHH-HHHHhHHHHHHHHHHHHhCCCccchhHHhhhcchhHHHHHHHhhcccchhhhhccceeehhhhhhHHHHH
Q 048038           91 LIIVYGYLM-YVAATYLSNGSELLLEILGPGVVGGLFLPILGALPDAMLILVSGLSGTKETAQSQVSVGMGLLAGSTVML  169 (591)
Q Consensus        91 li~v~g~ll-~~~a~~l~~g~e~L~~~lgp~iiG~~i~~~lgslPE~~i~l~s~l~~~~~~a~~~v~v~~G~l~GS~i~~  169 (591)
                      .+|..+++. +|.|.+++.++|+|+...||++ ||+++|++||+.|+++       ++.++.|+++++++|+++||++.|
T Consensus        97 ~vF~lsll~iiPLA~~l~~ateqls~~tg~tv-GgllNAtfGnaiElii-------~ilALk~g~~riVq~SlLGSILsn  168 (441)
T KOG1397|consen   97 WVFLLSLLGIIPLAERLGFATEQLSAYTGPTV-GGLLNATFGNAIELII-------YILALKNGKVRIVQGSLLGSILSN  168 (441)
T ss_pred             HHHHHHHhhhhhHHHHHHHHHHHHHhhcCCcH-HHHHhhhhccHHHHHH-------HHHHhhcCceEEEehhhHHHHHHH
Confidence            456667777 9999999999999999999875 9999999999999999       888999999999999999999999


Q ss_pred             HHHHHHHHhhhcccccccCccccccCCccccccccccceeecccchhhhHHHHHHHHHHHHHHhhhhhccccc-------
Q 048038          170 STVIWGTCVVVGKCDLRESDSVAIDGQNTKGFRLTGTGVSTDVWTCYAARIMAISVIPFVVVQLPQMLNSTSG-------  242 (591)
Q Consensus       170 ltli~G~~~l~g~~~~~~~~~~~~~~~~~~~f~~~~~gv~~~~~~~~~a~im~ls~~~~li~~lp~~~~~~~~-------  242 (591)
                      +++++|+|++.|++++++|           +||.+.+++        .+.++.++++..+   +|++++.+.+       
T Consensus       169 lLLvlG~s~~~Ggi~rk~Q-----------~Fn~~~A~v--------~s~lLl~a~l~~l---~P~~l~~~~~~~~~~~~  226 (441)
T KOG1397|consen  169 LLLVLGLSLFCGGIRRKDQ-----------RFNIKSAGV--------NSALLLLAVLGIL---LPTVLHYTYGGEVHDCS  226 (441)
T ss_pred             HHHHhhHHHhhccccccee-----------ecccchhhH--------HHHHHHHHHHHHH---HHHHHHHhcCccccccC
Confidence            9999999999999998887           999999998        8889999999988   9999986643       


Q ss_pred             -hhHHHHHHHHHHHHHHHHHHHHHhHhHHHHHHHhhhhccchhhhHHHHHHhhhhhhhhcccCCcccHHHHHHHhhhhcC
Q 048038          243 -RHLAVLIALILSVSMLISYCLYQVFQPWIQKRRLAFAKHKHVISGILKHLRQRALGRLLTDSGEPNIDVIKKLFDAIDE  321 (591)
Q Consensus       243 -~~~~~~is~ivsv~lli~Ysayq~lhpWiq~~~~~~~~~~~l~~~il~~lk~~~l~~l~~~~~~~~~~~Lr~lF~~iD~  321 (591)
                       ......+|+..+++++++|.+|..||.|-+       +|.+                   +...+              
T Consensus       227 ~~~~~l~lSr~~SivmliaYi~~L~FqL~t~-------~h~~-------------------~~~~~--------------  266 (441)
T KOG1397|consen  227 SGGAILPLSRGCSIVMLIAYIAYLWFQLKTA-------RHIW-------------------QFPTP--------------  266 (441)
T ss_pred             CccceeeehhccHHHHHHHHHHHHHHhhhcc-------cccC-------------------CCCCC--------------
Confidence             233567899999999999999987766531       1100                   00000              


Q ss_pred             CCCCCcCHHHHHHHHHccccccccccchHHHHHHHhhcCCCCCCCCChhHHHHHHHHHHHHHhhhcCCCCCCCCCCCCcc
Q 048038          322 NKDERLSASELKALIIGIRFEEIDLDQDDAVSKVLSDFDTSNDSHIDIKEFINGIEKWLNEAMQARTGSADPGPHTMKFL  401 (591)
Q Consensus       322 n~DG~Is~~ELk~~l~~~~~~~~~~~~~~ev~~lm~~~D~d~dG~Id~~EFl~a~~~~~~~~k~~~~~~~~~~~~~~~~~  401 (591)
                                                                                                      
T Consensus       267 --------------------------------------------------------------------------------  266 (441)
T KOG1397|consen  267 --------------------------------------------------------------------------------  266 (441)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             ccccchhhhhhhhcCCccccchhccccCCCcchHHHHHHHHHHHHHHHHhhHHHHHHhHHHHHHhcCCCchhhhhhhhhc
Q 048038          402 DDFHLQTKREHALLGAEEESDEVAEGVENPKWVSFKAVLMLLIGTIIAAAFADPLVDAVDNFSAATSIPSFFISFIALPF  481 (591)
Q Consensus       402 ~~~~~~~~~e~~~l~~e~~~~e~~~~~~~~~~~~~~~v~~Ll~g~~~~~~~A~~lV~si~~~a~~~gIs~~~Is~iilPl  481 (591)
                            + +|.     ++.+++...+++.|.|++|+++.+|+..|++++++||++|+.+++.++.+|+|+.|||+|++|+
T Consensus       267 ------~-ee~-----~~~d~~~s~~~e~p~is~~ss~~~L~~~T~~vsllaeyLV~~Id~~~ds~~ls~~Figlillpi  334 (441)
T KOG1397|consen  267 ------D-EEE-----TEQDDEVSNEDEAPNISRWSSIIWLLIMTLLVSLLAEYLVDTIDDVSDSWGLSVKFIGLILLPI  334 (441)
T ss_pred             ------C-hhc-----ccccccccccCCCCcchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCChhhheeeeecc
Confidence                  0 000     0111122224456899999999999999999999999999999999999999999999999999


Q ss_pred             cccchhHHHHHHHHHhccccccccccchhhhhhhHHHHHHHH-------HHHHHHHhcCcccccch-hHHHHHHHHHHHH
Q 048038          482 ATNSSEAVSAIIFASRKKIRTASLTFSELYGAVTMNNILCLS-------VFLALVYARGLTWDFSS-EVLVILIVCLVMG  553 (591)
Q Consensus       482 ats~~E~vsai~~A~k~k~~~as~t~s~i~g~v~m~n~l~l~-------vfl~lv~~r~l~w~fs~-evlvil~v~~~~~  553 (591)
                      ++|+.|++.||+||.|+|.+++        .+|+.|+.+|++       ++.+|....+++++|+. |+..+++.++++.
T Consensus       335 VgNaaEh~~AI~fA~k~kldLs--------lgVaigsalQI~Lf~vP~~v~v~W~~g~~M~LnF~~~et~~l~isVfl~~  406 (441)
T KOG1397|consen  335 VGNAAEHAGAISFAMKDKLDLS--------LGVAIGSALQIALFVVPFSVIVGWIMGISMDLNFPLLETACLFISVFLVA  406 (441)
T ss_pred             cCchHHhhcceeeeecCcccch--------hhhhhhhhHhHHHhhhhHHHHhhhhcCCceEEeccHHHHHHHHHHHHHHH
Confidence            9999999999999999999999        999999999977       55899999999999998 8888777777777


Q ss_pred             HHHhcCCccchHHHHHHHHHHHHHHHHHH
Q 048038          554 AFASFRTNFPLWTCSIAYALYPFSLALVY  582 (591)
Q Consensus       554 ~~~~~r~~~~~~~~~~~~~lY~~sl~lv~  582 (591)
                      ++. ..++-.+..|.+++++|.+..+-.|
T Consensus       407 y~l-qdG~Sny~kG~mLll~Y~Iia~~Ff  434 (441)
T KOG1397|consen  407 YLL-QDGKSNYFKGLMLLLCYLIIAAGFF  434 (441)
T ss_pred             HHH-hcCchhHHHHHHHHHHHHHHHHHhh
Confidence            665 4777788999999999965544443

>TIGR00378 cax calcium/proton exchanger (cax) Back     alignment and domain information
>TIGR00846 caca2 calcium/proton exchanger Back     alignment and domain information
>COG0387 ChaA Ca2+/H+ antiporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10734 putative calcium/sodium:proton antiporter; Provisional Back     alignment and domain information
>COG0530 ECM27 Ca2+/Na+ antiporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00367 K+-dependent Na+/Ca+ exchanger related-protein Back     alignment and domain information
>KOG1307 consensus K+-dependent Ca2+/Na+ exchanger NCKX1 and related proteins [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PRK10599 calcium/sodium:proton antiporter; Provisional Back     alignment and domain information
>TIGR00927 2A1904 K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>PLN03151 cation/calcium exchanger; Provisional Back     alignment and domain information
>PRK10734 putative calcium/sodium:proton antiporter; Provisional Back     alignment and domain information
>PF01699 Na_Ca_ex: Sodium/calcium exchanger protein; InterPro: IPR004837 The sodium/calcium exchangers are a family of integral membrane proteins Back     alignment and domain information
>COG0530 ECM27 Ca2+/Na+ antiporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00367 K+-dependent Na+/Ca+ exchanger related-protein Back     alignment and domain information
>TIGR00927 2A1904 K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>PF01699 Na_Ca_ex: Sodium/calcium exchanger protein; InterPro: IPR004837 The sodium/calcium exchangers are a family of integral membrane proteins Back     alignment and domain information
>KOG2399 consensus K+-dependent Na+:Ca2+ antiporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00845 caca sodium/calcium exchanger 1 Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>TIGR00846 caca2 calcium/proton exchanger Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>PLN03151 cation/calcium exchanger; Provisional Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>TIGR00845 caca sodium/calcium exchanger 1 Back     alignment and domain information
>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00378 cax calcium/proton exchanger (cax) Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1307 consensus K+-dependent Ca2+/Na+ exchanger NCKX1 and related proteins [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF14658 EF-hand_9: EF-hand domain Back     alignment and domain information
>KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG0041 consensus Predicted Ca2+-binding protein, EF-Hand protein superfamily [General function prediction only] Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>KOG0046 consensus Ca2+-binding actin-bundling protein (fimbrin/plastin), EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>KOG0030 consensus Myosin essential light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>KOG0040 consensus Ca2+-binding actin-bundling protein (spectrin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton] Back     alignment and domain information
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins Back     alignment and domain information
>KOG0030 consensus Myosin essential light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>KOG4065 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4251 consensus Calcium binding protein [General function prediction only] Back     alignment and domain information
>KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>PRK10599 calcium/sodium:proton antiporter; Provisional Back     alignment and domain information
>KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms] Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>KOG1306 consensus Ca2+/Na+ exchanger NCX1 and related proteins [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0038 consensus Ca2+-binding kinase interacting protein (KIP) (EF-Hand protein superfamily) [General function prediction only] Back     alignment and domain information
>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>KOG2399 consensus K+-dependent Na+:Ca2+ antiporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>KOG1306 consensus Ca2+/Na+ exchanger NCX1 and related proteins [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>COG0387 ChaA Ca2+/H+ antiporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>KOG3555 consensus Ca2+-binding proteoglycan Testican [General function prediction only] Back     alignment and domain information
>KOG3866 consensus DNA-binding protein of the nucleobindin family [General function prediction only] Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>KOG1397 consensus Ca2+/H+ antiporter VCX1 and related proteins [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>KOG1955 consensus Ral-GTPase effector RALBP1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A Back     alignment and domain information
>KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG2643 consensus Ca2+ binding protein, contains EF-hand motifs [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>KOG4251 consensus Calcium binding protein [General function prediction only] Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>KOG2243 consensus Ca2+ release channel (ryanodine receptor) [Signal transduction mechanisms] Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query591
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 5e-09
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 1e-07
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 3e-07
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 4e-07
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 5e-04
3lij_A494 Calcium/calmodulin dependent protein kinase with A 4e-07
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 9e-07
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 5e-04
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 7e-04
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 1e-06
3li6_A66 Calcium-binding protein; calcium signaling protein 1e-06
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 2e-06
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 2e-06
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 3e-06
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 3e-06
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 1e-04
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 4e-06
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 4e-06
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 5e-06
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 6e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-05
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 1e-05
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 1e-05
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 1e-05
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 2e-05
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 2e-05
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 2e-05
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 2e-05
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 2e-04
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 3e-05
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 3e-05
3a4u_B143 Multiple coagulation factor deficiency protein 2; 3e-05
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 3e-05
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 6e-05
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 4e-05
1y1x_A191 Leishmania major homolog of programmed cell death 4e-05
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 4e-05
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 5e-05
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 6e-04
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 5e-05
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 6e-05
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 6e-05
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 7e-05
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 9e-05
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 1e-04
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 1e-04
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 1e-04
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 1e-04
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 1e-04
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 1e-04
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 1e-04
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 2e-04
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 2e-04
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 2e-04
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 2e-04
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 8e-04
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 2e-04
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 2e-04
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 2e-04
3akb_A166 Putative calcium binding protein; EF-hand, metal b 2e-04
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 2e-04
3fwb_A161 Cell division control protein 31; gene gating, com 2e-04
2hps_A186 Coelenterazine-binding protein with bound coelent; 3e-04
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 3e-04
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 3e-04
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 3e-04
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 4e-04
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 8e-04
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 4e-04
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 4e-04
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 4e-04
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 4e-04
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 5e-04
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 5e-04
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 6e-04
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 6e-04
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 6e-04
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 6e-04
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 8e-04
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Length = 91 Back     alignment and structure
 Score = 52.7 bits (127), Expect = 5e-09
 Identities = 21/89 (23%), Positives = 31/89 (34%), Gaps = 6/89 (6%)

Query: 292 LRQRALGRLLTDSGEPNIDVIKKLFDAIDENKDERLSASELKALIIGIRFEEIDLDQDDA 351
             +  L     D     +  ++ +F A D N+  RL   E +AL   +R    D +    
Sbjct: 9   SGRENLYFQGADGDGEELARLRSVFAACDANRSGRLEREEFRALCTELRVRPADAEA--- 65

Query: 352 VSKVLSDFDTSNDSHIDIKEFINGIEKWL 380
              V    D   D  I  +EF  G    L
Sbjct: 66  ---VFQRLDADRDGAITFQEFARGFLGSL 91
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Length = 220 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Length = 204 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Length = 204 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Length = 180 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Length = 105 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172 Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Length = 103 Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Length = 67 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Length = 198 Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Length = 83 Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Length = 256 Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211 Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Length = 108 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Length = 191 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Length = 191 Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Length = 183 Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191 Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Length = 143 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Length = 193 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 87 Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166 Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Length = 226 Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Length = 190 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Length = 190 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Length = 224 Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Length = 190 Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Length = 207 Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Length = 207 Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Length = 109 Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Length = 78 Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Length = 208 Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Length = 208 Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Length = 183 Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Length = 143 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} PDB: 2kqy_A Length = 109 Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} PDB: 2gv5_A 2doq_A 3fwc_A Length = 161 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Length = 108 Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Length = 109 Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Length = 108 Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Length = 219 Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Length = 219 Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Length = 147 Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Length = 162 Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Length = 153 Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 142 Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Length = 229 Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Length = 195 Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Length = 86 Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Length = 169 Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Length = 135 Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Length = 155 Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Length = 110 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query591
3v5u_A320 Uncharacterized membrane protein MJ0091; lipid cub 100.0
3v5u_A 320 Uncharacterized membrane protein MJ0091; lipid cub 99.45
2lv7_A100 Calcium-binding protein 7; metal binding protein; 99.27
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 99.14
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 99.13
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 99.12
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 99.11
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 99.11
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 99.11
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 99.11
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 99.11
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 99.1
1c07_A95 Protein (epidermal growth factor receptor pathway 99.08
1avs_A90 Troponin C; muscle contraction, calcium-activated, 99.08
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 99.07
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 99.07
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 99.07
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 99.05
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 99.04
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 99.04
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 99.03
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 99.03
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 99.03
1qjt_A99 EH1, epidermal growth factor receptor substrate su 99.02
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 99.0
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 99.0
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 99.0
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 98.99
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 98.99
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 98.98
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 98.97
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 98.97
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 98.97
3li6_A66 Calcium-binding protein; calcium signaling protein 98.96
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 98.96
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 98.96
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 98.96
3lij_A494 Calcium/calmodulin dependent protein kinase with A 98.96
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 98.95
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 98.93
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 98.92
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 98.91
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 98.91
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 98.9
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 98.9
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 98.9
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 98.9
2jq6_A139 EH domain-containing protein 1; metal binding prot 98.9
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 98.88
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 98.88
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 98.88
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 98.87
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 98.86
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 98.85
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 98.85
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 98.84
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 98.84
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 98.84
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 98.84
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 98.84
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 98.84
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 98.83
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 98.83
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 98.83
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 98.82
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 98.82
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 98.82
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 98.81
1exr_A148 Calmodulin; high resolution, disorder, metal trans 98.81
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 98.8
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 98.79
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 98.79
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 98.79
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 98.78
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 98.78
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 98.78
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 98.78
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 98.77
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 98.77
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 98.77
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 98.77
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 98.77
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 98.76
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 98.76
1exr_A148 Calmodulin; high resolution, disorder, metal trans 98.75
3fwb_A161 Cell division control protein 31; gene gating, com 98.75
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 98.75
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 98.74
2jnf_A158 Troponin C; stretch activated muscle contraction, 98.74
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 98.73
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 98.72
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 98.71
3fwb_A161 Cell division control protein 31; gene gating, com 98.7
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 98.69
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 98.69
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 98.68
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 98.68
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 98.68
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 98.67
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 98.67
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 98.67
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 98.67
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 98.66
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 98.65
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 98.64
3akb_A166 Putative calcium binding protein; EF-hand, metal b 98.64
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 98.64
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 98.63
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 98.63
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 98.63
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 98.63
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 98.62
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 98.62
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 98.61
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 98.6
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 98.6
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 98.6
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 98.6
2jnf_A158 Troponin C; stretch activated muscle contraction, 98.59
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 98.59
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 98.59
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 98.58
1y1x_A191 Leishmania major homolog of programmed cell death 98.58
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 98.57
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 98.57
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 98.56
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 98.56
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 98.55
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 98.55
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 98.55
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 98.55
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 98.54
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 98.54
1y1x_A191 Leishmania major homolog of programmed cell death 98.54
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 98.54
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 98.54
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 98.53
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 98.53
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 98.53
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 98.53
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 98.53
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 98.52
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 98.52
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 98.52
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 98.52
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 98.51
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 98.5
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 98.5
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 98.49
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 98.49
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 98.48
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 98.48
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 98.47
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 98.45
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 98.44
3akb_A166 Putative calcium binding protein; EF-hand, metal b 98.44
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 98.44
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 98.42
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 98.42
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 98.41
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 98.41
3a4u_B143 Multiple coagulation factor deficiency protein 2; 98.41
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 98.4
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 98.4
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 98.39
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 98.39
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 98.38
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 98.38
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 98.37
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 98.37
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 98.36
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 98.36
2hps_A186 Coelenterazine-binding protein with bound coelent; 98.36
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 98.35
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 98.35
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 98.35
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 98.34
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 98.34
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 98.34
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 98.33
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 98.33
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 98.33
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 98.33
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 98.32
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 98.32
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 98.31
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 98.31
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 98.3
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 98.3
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 98.29
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 98.29
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 98.29
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 98.28
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 98.28
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 98.28
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 98.27
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 98.27
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 98.27
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 98.26
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 98.26
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 98.26
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 98.26
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 98.25
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 98.25
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 98.25
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 98.24
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 98.24
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 98.23
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 98.22
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 98.21
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 98.21
3lij_A494 Calcium/calmodulin dependent protein kinase with A 98.2
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 98.18
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 98.18
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 98.17
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 98.15
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 98.14
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 98.13
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 98.12
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 98.12
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 98.08
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 98.06
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 98.06
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 98.05
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 98.04
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 98.03
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 97.99
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 97.99
2hps_A186 Coelenterazine-binding protein with bound coelent; 97.95
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 97.94
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 97.93
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 97.92
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 97.91
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 97.89
1sra_A151 Sparc; extracellular matrix protein, calcium-bindi 97.86
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 97.81
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 97.79
3a4u_B143 Multiple coagulation factor deficiency protein 2; 97.78
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 97.61
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 97.6
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 97.59
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 97.58
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 97.56
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 97.54
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 97.54
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 97.51
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 97.5
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 97.4
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 97.4
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 97.4
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 97.37
1nub_A229 Basement membrane protein BM-40; extracellular mod 97.27
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 96.99
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 96.9
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 96.78
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 96.78
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 96.39
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 96.16
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 95.69
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 95.53
1tuz_A118 Diacylglycerol kinase alpha; transferase, HR532, n 95.34
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 95.08
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 94.69
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 94.46
3qr0_A 816 Phospholipase C-beta (PLC-beta); PH domain, EF han 94.38
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 94.07
3li6_A66 Calcium-binding protein; calcium signaling protein 93.95
3qr0_A 816 Phospholipase C-beta (PLC-beta); PH domain, EF han 93.67
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 92.28
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 91.54
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 90.81
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 90.44
2lv7_A100 Calcium-binding protein 7; metal binding protein; 90.36
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 90.0
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 89.82
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 89.78
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 89.64
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 89.33
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 89.32
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 89.11
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 88.77
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 88.1
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 88.02
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 87.41
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 87.18
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 86.81
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 86.69
1avs_A90 Troponin C; muscle contraction, calcium-activated, 86.67
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 86.59
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 86.54
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 86.25
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 86.21
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 85.98
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 85.71
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 85.31
1qjt_A99 EH1, epidermal growth factor receptor substrate su 85.09
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 85.08
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 85.06
1c07_A95 Protein (epidermal growth factor receptor pathway 84.93
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 84.91
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 84.53
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 84.52
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 84.12
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 83.99
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 83.78
2l5y_A150 Stromal interaction molecule 2; EF-hand, SAM domai 83.29
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 83.28
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 83.06
1sra_A151 Sparc; extracellular matrix protein, calcium-bindi 83.03
1pul_A125 Hypothetical protein C32E8.3 in chromosome I; alph 82.65
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 82.34
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 81.88
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 80.46
>3v5u_A Uncharacterized membrane protein MJ0091; lipid cubic phase, cation protein complex, sodium,calcium EX membrane protein; HET: OLC MYS 1PE; 1.90A {Methanocaldococcus jannaschii} PDB: 3v5s_A* Back     alignment and structure
Probab=100.00  E-value=7.1e-33  Score=288.27  Aligned_cols=290  Identities=19%  Similarity=0.241  Sum_probs=221.0

Q ss_pred             HHHHHHHHH-HHHHhHHHHHHHHHHHHhC--CCccchhHHhhhcchhHHHHHHHhhcccchhhhhccceeehhhhhhHHH
Q 048038           91 LIIVYGYLM-YVAATYLSNGSELLLEILG--PGVVGGLFLPILGALPDAMLILVSGLSGTKETAQSQVSVGMGLLAGSTV  167 (591)
Q Consensus        91 li~v~g~ll-~~~a~~l~~g~e~L~~~lg--p~iiG~~i~~~lgslPE~~i~l~s~l~~~~~~a~~~v~v~~G~l~GS~i  167 (591)
                      +.++.|+++ +++++++++++|.+++++|  |.++|.+++|++||+||+++.+++...|       +.++++|+++|||+
T Consensus         7 ~~l~~g~~~l~~~a~~lv~~~~~la~~lgis~~viGltiva~GTSlPEl~vsi~A~~~g-------~~diaiGnivGSni   79 (320)
T 3v5u_A            7 GYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMH-------APGISIGNAIGSCI   79 (320)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHTBCHHHHHHTHHHHHHHHHHHHHHHHHHHTT-------CHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHhCcCHHHHHHHHHHHHcccHHHHHHHHHHhCC-------CCceeeeeecchHH
Confidence            445667777 9999999999999999999  5799999999999999999977766544       55699999999999


Q ss_pred             HHHHHHHHHHhhhcccccccCccccccCCccccccccccceeecccchhhhHHHHHHHHHHHHHHhhhhhccccchhHHH
Q 048038          168 MLSTVIWGTCVVVGKCDLRESDSVAIDGQNTKGFRLTGTGVSTDVWTCYAARIMAISVIPFVVVQLPQMLNSTSGRHLAV  247 (591)
Q Consensus       168 ~~ltli~G~~~l~g~~~~~~~~~~~~~~~~~~~f~~~~~gv~~~~~~~~~a~im~ls~~~~li~~lp~~~~~~~~~~~~~  247 (591)
                      +|+++++|+|.++++.+. ++                        ..+++..+|+++.+.++.+    .++   +     
T Consensus        80 ~nillvlG~~~li~p~~v-~~------------------------~~~~d~~~~l~~~~~l~~~----~~~---g-----  122 (320)
T 3v5u_A           80 CNIGLVLGLSAIISPIIV-DK------------------------NLQKNILVYLLFVIFAAVI----GID---G-----  122 (320)
T ss_dssp             HHHHTHHHHHHHHSCBCC-CH------------------------HHHHHHHHHHHHHHHHHHH----TTT---C-----
T ss_pred             HHHHHHHHHHHHHccccc-cH------------------------HHHHHHHHHHHHHHHHHHH----HHc---c-----
Confidence            999999999999988765 21                        1233566666665544321    111   1     


Q ss_pred             HHHHHHHHHHHHHHHHHHhHhHHHHHHHhhhhccchhhhHHHHHHhhhhhhhhcccCCcccHHHHHHHhhhhcCCCCCCc
Q 048038          248 LIALILSVSMLISYCLYQVFQPWIQKRRLAFAKHKHVISGILKHLRQRALGRLLTDSGEPNIDVIKKLFDAIDENKDERL  327 (591)
Q Consensus       248 ~is~ivsv~lli~Ysayq~lhpWiq~~~~~~~~~~~l~~~il~~lk~~~l~~l~~~~~~~~~~~Lr~lF~~iD~n~DG~I  327 (591)
                       ++++.+++++..|.+|..+.-+  +.     ++                                              
T Consensus       123 -is~~~g~~Ll~~Y~~yl~~~~~--~~-----~~----------------------------------------------  148 (320)
T 3v5u_A          123 -FSWIDGVVLLILFIIYLRWTVK--NG-----SA----------------------------------------------  148 (320)
T ss_dssp             -BCHHHHHHHHHHHHHHHHHHHH--HT-----BC----------------------------------------------
T ss_pred             -cHHHHHHHHHHHHHHHHHHHHH--hc-----cc----------------------------------------------
Confidence             6788999999999999765321  00     00                                              


Q ss_pred             CHHHHHHHHHccccccccccchHHHHHHHhhcCCCCCCCCChhHHHHHHHHHHHHHhhhcCCCCCCCCCCCCccccccch
Q 048038          328 SASELKALIIGIRFEEIDLDQDDAVSKVLSDFDTSNDSHIDIKEFINGIEKWLNEAMQARTGSADPGPHTMKFLDDFHLQ  407 (591)
Q Consensus       328 s~~ELk~~l~~~~~~~~~~~~~~ev~~lm~~~D~d~dG~Id~~EFl~a~~~~~~~~k~~~~~~~~~~~~~~~~~~~~~~~  407 (591)
                                                                                                      
T Consensus       149 --------------------------------------------------------------------------------  148 (320)
T 3v5u_A          149 --------------------------------------------------------------------------------  148 (320)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             hhhhhhhcCCccccchhccccCCCcchHHHHHHHHHHHHHHHHhhHHHHHHhHHHHHHhcCCCchhhhhhhhhccccchh
Q 048038          408 TKREHALLGAEEESDEVAEGVENPKWVSFKAVLMLLIGTIIAAAFADPLVDAVDNFSAATSIPSFFISFIALPFATNSSE  487 (591)
Q Consensus       408 ~~~e~~~l~~e~~~~e~~~~~~~~~~~~~~~v~~Ll~g~~~~~~~A~~lV~si~~~a~~~gIs~~~Is~iilPlats~~E  487 (591)
                        ++       |+ +|+     .++++.++.+..+++|.+++.+.|+++|++++.+++.+|+|+.++|++++|+|||+||
T Consensus       149 --~~-------~~-~~~-----~~~~~~~~~~~~l~~~l~~l~~~a~~lv~~~~~ia~~~gis~~~iGltlva~gtslPE  213 (320)
T 3v5u_A          149 --EI-------EE-NND-----KNNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPE  213 (320)
T ss_dssp             ----------------------CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCCCHHHHHHTHHHHHTHHH
T ss_pred             --cc-------cc-ccc-----cccccHHHHHHHHHHHHHHHHHHHHhccccHHHHHHHhCCchHHHHHHHHHHHhccHH
Confidence              00       00 000     1234556889999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHhccccccccccchhhhhhhHHHHHHHHHHHHH-HHhcCcccccchhHHHHHHHHHHHHHHHhcCCccchHH
Q 048038          488 AVSAIIFASRKKIRTASLTFSELYGAVTMNNILCLSVFLAL-VYARGLTWDFSSEVLVILIVCLVMGAFASFRTNFPLWT  566 (591)
Q Consensus       488 ~vsai~~A~k~k~~~as~t~s~i~g~v~m~n~l~l~vfl~l-v~~r~l~w~fs~evlvil~v~~~~~~~~~~r~~~~~~~  566 (591)
                      .++++.+|+|+|.+++       +|++..+|+.++.+.++. ...+|++.+ ..|..+++++++++.. ...+++.++|+
T Consensus       214 ~~~sv~aa~~g~~~la-------ig~iiGS~ifn~~~v~g~~~li~p~~~~-~~d~~~~l~~~~ll~~-~~~~~~i~~~e  284 (320)
T 3v5u_A          214 LMVSLAAAKRNLGGMV-------LGNVIGSNIADIGGALAVGSLFMHLPAE-NVQMAVLVIMSLLLYL-FAKYSKIGRWQ  284 (320)
T ss_dssp             HHHHHHHHHTTCHHHH-------HHHHHHHHHHHHHTHHHHHHHHSCBCCC-HHHHHHHHHHHHHHHH-HHHHSCBSHHH
T ss_pred             HHHHHHHHHcCCCcHH-------HHHHHhHHHHHHHHHHHHHHhhccccch-HHHHHHHHHHHHHHHH-HHhCCcCcHHH
Confidence            9999999999999999       333333355555555555 245777765 5588888777776655 34577899999


Q ss_pred             HHHHHHHHHH-HHHHHH
Q 048038          567 CSIAYALYPF-SLALVY  582 (591)
Q Consensus       567 ~~~~~~lY~~-sl~lv~  582 (591)
                      |.+++.+|.. |+..++
T Consensus       285 G~~ll~~Y~~~y~~~~~  301 (320)
T 3v5u_A          285 GILFLALYIIAIASLRM  301 (320)
T ss_dssp             HHHHHHHHHHHHHHSCS
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            9999999988 776543
>3v5u_A Uncharacterized membrane protein MJ0091; lipid cubic phase, cation protein complex, sodium,calcium EX membrane protein; HET: OLC MYS 1PE; 1.90A {Methanocaldococcus jannaschii} PDB: 3v5s_A* Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>2l5y_A Stromal interaction molecule 2; EF-hand, SAM domain, store OPE calcium entry, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 Back     alignment and structure
>1pul_A Hypothetical protein C32E8.3 in chromosome I; alpha helical, northeast structural genomics consortium, PSI, protein structure initiative; NMR {Caenorhabditis elegans} SCOP: a.39.1.11 Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 591
d1snla_99 a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo 3e-08
d1tiza_67 a.39.1.5 (A:) Calmodulin-related protein T21P5.17 8e-08
d1c7va_68 a.39.1.5 (A:) Calcium vector protein {Amphioxus (B 9e-08
d1rwya_109 a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta 8e-07
d1rroa_108 a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) 1e-06
d1pvaa_109 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 1e-06
d1cb1a_78 a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [Tax 2e-06
d5pala_109 a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis 4e-06
d1oqpa_77 a.39.1.5 (A:) Caltractin (centrin 2) {Green algae 4e-06
d1jc2a_75 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 4e-06
d1a4pa_92 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 6e-06
d2pvba_107 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 8e-06
d2opoa181 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che 8e-06
d1fi5a_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), 1e-05
d1s6ja_87 a.39.1.5 (A:) Calcium-dependent protein kinase sk5 1e-05
d1ij5a_321 a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind 2e-05
d1ij5a_321 a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind 8e-04
d3c1va193 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sa 3e-05
d1fpwa_190 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 3e-05
d1topa_162 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 5e-05
d1e8aa_87 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 6e-05
d1uhka1187 a.39.1.5 (A:3-189) Calcium-regulated photoprotein 1e-04
d1bjfa_181 a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId 1e-04
d1avsa_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 1e-04
d2obha1141 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien 2e-04
d1fw4a_65 a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 2e-04
d1ksoa_93 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 2e-04
d1k8ua_89 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 3e-04
d1f54a_77 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 3e-04
d2scpa_174 a.39.1.5 (A:) Sarcoplasmic calcium-binding protein 3e-04
d1yuta198 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sa 4e-04
d1k94a_165 a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [Ta 4e-04
d1j55a_94 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 4e-04
d1dtla_156 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 6e-04
d1qlsa_95 a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), 0.001
d1xk4a187 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sa 0.001
d2pq3a173 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [T 0.001
d1zfsa193 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus no 0.001
d1xo5a_180 a.39.1.5 (A:) Calcium- and integrin-binding protei 0.001
d3cr5x190 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos tauru 0.002
d2fcea161 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [ 0.002
d1g8ia_187 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 0.002
d2sasa_185 a.39.1.5 (A:) Sarcoplasmic calcium-binding protein 0.002
d2zfda1183 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 { 0.003
d1qjta_99 a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 0.003
d1nyaa_176 a.39.1.5 (A:) Calerythrin {Saccharopolyspora eryth 0.004
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure

class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: EF-hand modules in multidomain proteins
domain: Nucleobindin 1 (CALNUC)
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 49.7 bits (118), Expect = 3e-08
 Identities = 17/79 (21%), Positives = 31/79 (39%), Gaps = 12/79 (15%)

Query: 312 IKKLFDAIDENKDERLSASELKALI------------IGIRFEEIDLDQDDAVSKVLSDF 359
            K  F   D N D  L   EL+AL                   E++ ++      V+ + 
Sbjct: 18  PKTFFILHDINSDGVLDEQELEALFTKELEKVYDPKNEEDDMREMEEERLRMREHVMKNV 77

Query: 360 DTSNDSHIDIKEFINGIEK 378
           DT+ D  + ++EF+   ++
Sbjct: 78  DTNQDRLVTLEEFLASTQR 96
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109 Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 108 Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109 Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Length = 78 Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Length = 109 Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 107 Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81 Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 87 Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 190 Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Length = 187 Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Length = 181 Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 65 Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 77 Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Length = 174 Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Length = 165 Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 156 Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Length = 95 Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Length = 73 Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Length = 180 Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Length = 90 Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 61 Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 187 Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 185 Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 183 Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Length = 176 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query591
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 99.28
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.26
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 99.24
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.24
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 99.24
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 99.24
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.22
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 99.21
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 99.19
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.18
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 99.17
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.15
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 99.11
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 99.06
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 99.05
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 99.04
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.03
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 98.97
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 98.95
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 98.94
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 98.92
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 98.92
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 98.91
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 98.9
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 98.89
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 98.89
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 98.84
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 98.84
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.82
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 98.81
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 98.81
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 98.8
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 98.78
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 98.77
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 98.76
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 98.74
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 98.74
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 98.73
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 98.72
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 98.71
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 98.7
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.7
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 98.69
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 98.66
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 98.63
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 98.63
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.63
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.62
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 98.59
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 98.59
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 98.59
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 98.58
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 98.58
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.58
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 98.58
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 98.56
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 98.55
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 98.54
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 98.53
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 98.5
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 98.49
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 98.48
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 98.47
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 98.46
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 98.46
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 98.45
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.44
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 98.43
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 98.4
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 98.37
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 98.37
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 98.37
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 98.35
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 98.32
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 98.32
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 98.31
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 98.31
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.28
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 98.28
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 98.28
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 98.24
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 98.23
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 98.23
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 98.19
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 98.17
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 98.17
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 98.17
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 98.16
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 98.13
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 98.12
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 98.08
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 98.06
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 98.04
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 98.03
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 98.01
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 97.99
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 97.97
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 97.94
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 97.93
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 97.92
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 97.9
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 97.89
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 97.89
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 97.8
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 97.8
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 97.75
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 97.73
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 97.58
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 97.56
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 97.53
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 97.38
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 97.37
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 97.28
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 97.15
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 96.99
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 96.62
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 96.39
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 96.37
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 96.28
d1sraa_151 C-terminal (EC) domain of BM-40/SPARC/osteonectin 96.2
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 95.92
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 95.73
d1j7qa_86 Calcium vector protein {Amphioxus (Branchiostoma l 95.14
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 95.03
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 94.99
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 94.0
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 93.99
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 93.54
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 93.23
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 93.17
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 92.89
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 92.28
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 92.08
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 91.95
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 91.91
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 91.86
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 91.75
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 91.73
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 91.43
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 90.83
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 90.65
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 90.4
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 89.72
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 89.26
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 88.89
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 87.86
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 87.86
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 87.4
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 87.07
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 86.96
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 86.82
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 86.78
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 86.51
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 85.92
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 85.63
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 84.82
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 84.39
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 83.41
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 81.69
d1qasa194 Phosphoinositide-specific phospholipase C, isozyme 81.57
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: Polcalcin
domain: Polcalcin Che a 3
species: Pigweed (Chenopodium album) [TaxId: 3559]

Probab=99.28  E-value=1.8e-12  Score=105.83  Aligned_cols=67  Identities=25%  Similarity=0.425  Sum_probs=61.5

Q ss_pred             cccHHHHHHHhhhhcCCCCCCcCHHHHHHHHHccccccccccchHHHHHHHhhcCCCCCCCCChhHHHHHHH
Q 048038          306 EPNIDVIKKLFDAIDENKDERLSASELKALIIGIRFEEIDLDQDDAVSKVLSDFDTSNDSHIDIKEFINGIE  377 (591)
Q Consensus       306 ~~~~~~Lr~lF~~iD~n~DG~Is~~ELk~~l~~~~~~~~~~~~~~ev~~lm~~~D~d~dG~Id~~EFl~a~~  377 (591)
                      ++++..++++|+.+|+|+||.|+.+|++.+++.+| +    +++++++++++.+|.|+||.|+|+||+..+.
T Consensus         2 ~ee~~e~~~~F~~~D~d~~G~I~~~El~~~l~~lg-~----~~~~ei~~~~~~~D~d~~G~I~~~EF~~~~~   68 (81)
T d2opoa1           2 PQDIADRERIFKRFDTNGDGKISSSELGDALKTLG-S----VTPDEVRRMMAEIDTDGDGFISFDEFTDFAR   68 (81)
T ss_dssp             HHHHHHHHHHHHHHCTTCSSEEEHHHHHHHHHTTT-T----CCHHHHHHHHHHHCTTCSSEECHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHCCCCCCCCcHHHHHHHHHHhh-c----CCHHHHHHHHHHhCCCCCCeEeHHHHHHHHH
Confidence            56788999999999999999999999999999987 2    6788999999999999999999999998653
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1j7qa_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure