Citrus Sinensis ID: 048056


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140---
RPVTTEAWNTTGLHVHRKRIAHMTFFWGHNTQVLFSGWPGSSTGMYVLALVFVFSLAVIVEWLSHYNIVKPGASRVAAGLFKTGLHGVRVGLAYMVVLAVMSFNGGIFIAAVVGHAVGYLLFGSRVRMLVTKLGMREEEKRKR
ccccccccccccccccccccEEEEEEcccCEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHccccccHHHccc
********NTTGLHVHRKRIAHMTFFWGHNTQVLFSGWPGSSTGMYVLALVFVFSLAVIVEWLSHYNIVKPGASRVAAGLFKTGLHGVRVGLAYMVVLAVMSFNGGIFIAAVVGHAVGYLLFGSRVR****************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
RPVTTEAWNTTGLHVHRKRIAHMTFFWGHNTQVLFSGWPGSSTGMYVLALVFVFSLAVIVEWLSHYNIVKPGASRVAAGLFKTGLHGVRVGLAYMVVLAVMSFNGGIFIAAVVGHAVGYLLFGSRVRMLVTKLGMREEEKRKR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Copper transporter 6 Involved in the transport of copper.probableQ8GWP3

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2LS3, chain A
Confidence level:probable
Coverage over the Query: 78-105
View the alignment between query and template
View the model in PyMOL
Template: 2LS2, chain A
Confidence level:probable
Coverage over the Query: 41-64
View the alignment between query and template
View the model in PyMOL
Template: 2LS4, chain A
Confidence level:probable
Coverage over the Query: 103-126
View the alignment between query and template
View the model in PyMOL