Citrus Sinensis ID: 048131


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120----
MAQARGSAIIAVVTVLLLLMHCNIGSATTFKVGDDGGWVFGVQNWPEGKTFKCGDILEFNYDPQRHNVIIVDQEGHDSCKPASDAKKFQTGKDQIVLNHGKNFFICGVPTHCSDHGMKLEINVE
cccccHHHHHHHHHHHHHHHHHHccccCEEECcccccccccccccccccCEECccEEEEECcccccCEEEEccccccccccccccccccccccEEEccccccEEECcccccccccccEEEEEEc
*******AIIAVVTVLLLLMHCNIGSATTFKVGDDGGWVFGVQNWPEGKTFKCGDILEFNYDPQRHNVIIVDQEGHDSCKPASDAKKFQTGKDQIVLNHGKNFFICGVPTHCSDHGMKLEINVE
xxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAQARGSAIIAVVTVLLLLMHCNIGSATTFKVGDDGGWVFGVQNWPEGKTFKCGDILEFNYDPQRHNVIIVDQEGHDSCKPASDAKKFQTGKDQIVLNHGKNFFICGVPTHCSDHGMKLEINVE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Basic blue protein Forms a concentration gradient along the pollen tube growth path, with a lower level in the stigma papilla cell wall and a higher level in the transmitting tract extracellular matix of the style.probableQ8LG89

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2CBP, chain A
Confidence level:very confident
Coverage over the Query: 28-123
View the alignment between query and template
View the model in PyMOL