Citrus Sinensis ID: 048149

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150----
ALKKAHDELDIHVGANRQVNESDIKNLVYLRAILKETMRLYPSMEDCTGSGYHVRAGTQHFVNALKVHHDPKDIDLRGQNFELMPFGSGRRICPGISFAFQVMPLTLASLLRGFDFATPLDELVDMEEAKSLIITRATPFKALLTPHLSASLYD
cHHHHHHHHHHccccccccccccccccHHHHHHHHHHHccccccccEEEccEEcccccEEEEEEEEcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEcccccEEEEEEccccccccc
cHHHHHHHHHHHHccccEEEHccccccHHHHHHHHHHHHccccccccEEccEEcccccEEEEEEEEEcccccccccccccEEEEEcccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEcccccEEEEEcccccHHHcc
ALKKAHDELDIHVGANRQVNESDIKNLVYLRAILKETMRlypsmedctgsgyhvragTQHFVNALkvhhdpkdidlrgqnfelmpfgsgrricpgisfAFQVMPLTLASLLrgfdfatpldelVDMEEAKSLIItratpfkalltphlsaslyd
alkkahdeldihvganrqvnesdikNLVYLRAILKETMRLYPSMEDCTGSGYHVRAGTQHFVNALKVHHDPKDIDLRGQNFELMPFGSGRRICPGISFAFQVMPLTLASLLRGFDFATPLDELVDMEEAKSLIItratpfkalltphlsaslyd
ALKKAHDELDIHVGANRQVNESDIKNLVYLRAILKETMRLYPSMEDCTGSGYHVRAGTQHFVNALKVHHDPKDIDLRGQNFELMPFGSGRRICPGISFAFQVMPLTLASLLRGFDFATPLDELVDMEEAKSLIITRATPFKALLTPHLSASLYD
***********HVGANRQVNESDIKNLVYLRAILKETMRLYPSMEDCTGSGYHVRAGTQHFVNALKVHHDPKDIDLRGQNFELMPFGSGRRICPGISFAFQVMPLTLASLLRGFDFATPLDELVDMEEAKSLIITRATPFKALLTP********
ALKKAHDELDIHVGANRQVNESDIKNLVYLRAILKETMRLYPSMEDCTGSGYHVRAGTQHFVNALKVHHDPKDIDLRGQNFELMPFGSGRRICPGISFAFQVMPLTLASLLRGFDFATPLDELVDMEEAKSLIITRATPFKALLTPHLSASL**
ALKKAHDELDIHVGANRQVNESDIKNLVYLRAILKETMRLYPSMEDCTGSGYHVRAGTQHFVNALKVHHDPKDIDLRGQNFELMPFGSGRRICPGISFAFQVMPLTLASLLRGFDFATPLDELVDMEEAKSLIITRATPFKALLTPHLSASLYD
ALKKAHDELDIHVGANRQVNESDIKNLVYLRAILKETMRLYPSMEDCTGSGYHVRAGTQHFVNALKVHHDPKDIDLRGQNFELMPFGSGRRICPGISFAFQVMPLTLASLLRGFDFATPLDELVDMEEAKSLIITRATPFKALLTPHLSASLYD
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ALKKAHDELDIHVGANRQVNESDIKNLVYLRAILKETMRLYPSMEDCTGSGYHVRAGTQHFVNALKVHHDPKDIDLRGQNFELMPFGSGRRICPGISFAFQVMPLTLASLLRGFDFATPLDELVDMEEAKSLIITRATPFKALLTPHLSASLYD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query154 2.2.26 [Sep-21-2011]
O49394523 Cytochrome P450 82C2 OS=A yes no 0.987 0.290 0.5 5e-44
O49396512 Cytochrome P450 82C3 OS=A no no 0.987 0.296 0.505 9e-44
Q9SZ46524 Cytochrome P450 82C4 OS=A no no 0.987 0.290 0.494 8e-43
O49859525 Cytochrome P450 82A4 OS=G no no 0.948 0.278 0.468 6e-38
Q43068544 Cytochrome P450 82A1 (Fra N/A no 1.0 0.283 0.419 2e-36
O49858527 Cytochrome P450 82A3 OS=G no no 1.0 0.292 0.425 8e-36
O81972522 Cytochrome P450 82A2 OS=G no no 1.0 0.295 0.430 4e-35
Q9LSF8515 Cytochrome P450 82G1 OS=A no no 0.993 0.297 0.398 3e-30
P48418506 Flavonoid 3',5'-hydroxyla N/A no 0.987 0.300 0.375 1e-26
P48419508 Flavonoid 3',5'-hydroxyla N/A no 0.987 0.299 0.375 1e-26
>sp|O49394|C82C2_ARATH Cytochrome P450 82C2 OS=Arabidopsis thaliana GN=CYP82C2 PE=2 SV=2 Back     alignment and function desciption
 Score =  176 bits (446), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 90/180 (50%), Positives = 114/180 (63%), Gaps = 28/180 (15%)

Query: 2   LKKAHDELDIHVGANRQVNESDIKNLVYLRAILKETMRLYPS---------MEDCTGSGY 52
           LKKA DE+DIHVG +R V +SDI+NLVY++AI+KET+RLYP+         +EDCT +GY
Sbjct: 343 LKKAQDEIDIHVGRDRNVEDSDIENLVYIQAIIKETLRLYPAGPLLGHREAIEDCTVAGY 402

Query: 53  HVRAGTQHFVNALKVHHDP-------------------KDIDLRGQNFELMPFGSGRRIC 93
           +VR GT+  VN  K+  DP                   K+ D+RGQNFELMPFGSGRR C
Sbjct: 403 NVRRGTRMLVNVWKIQRDPRVYMEPNEFRPERFITGEAKEFDVRGQNFELMPFGSGRRSC 462

Query: 94  PGISFAFQVMPLTLASLLRGFDFATPLDELVDMEEAKSLIITRATPFKALLTPHLSASLY 153
           PG S A QV+ L LA  L+ FD  T +D  VDM E+  L I +ATP + L++P L   LY
Sbjct: 463 PGSSLAMQVLHLGLARFLQSFDVKTVMDMPVDMTESPGLTIPKATPLEILISPRLKEGLY 522
Can hydroxylates 8-methoxypsoralen to form 5-hydroxy-8-methoxypsoralen in vivo and in vitro.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: 4EC: .EC: -EC: .EC: -
>sp|O49396|C82C3_ARATH Cytochrome P450 82C3 OS=Arabidopsis thaliana GN=CYP82C3 PE=2 SV=3 Back     alignment and function description
>sp|Q9SZ46|C82C4_ARATH Cytochrome P450 82C4 OS=Arabidopsis thaliana GN=CYP82C4 PE=2 SV=1 Back     alignment and function description
>sp|O49859|C82A4_SOYBN Cytochrome P450 82A4 OS=Glycine max GN=CYP82A4 PE=2 SV=1 Back     alignment and function description
>sp|Q43068|C82A1_PEA Cytochrome P450 82A1 (Fragment) OS=Pisum sativum GN=CYP82A1 PE=2 SV=2 Back     alignment and function description
>sp|O49858|C82A3_SOYBN Cytochrome P450 82A3 OS=Glycine max GN=CYP82A3 PE=2 SV=1 Back     alignment and function description
>sp|O81972|C82A2_SOYBN Cytochrome P450 82A2 OS=Glycine max GN=CYP82A2 PE=2 SV=1 Back     alignment and function description
>sp|Q9LSF8|C82G1_ARATH Cytochrome P450 82G1 OS=Arabidopsis thaliana GN=CYP82G1 PE=1 SV=1 Back     alignment and function description
>sp|P48418|C75A1_PETHY Flavonoid 3',5'-hydroxylase 1 OS=Petunia hybrida GN=CYP75A1 PE=2 SV=1 Back     alignment and function description
>sp|P48419|C75A3_PETHY Flavonoid 3',5'-hydroxylase 2 OS=Petunia hybrida GN=CYP75A3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query154
356510322 526 PREDICTED: cytochrome P450 82C4-like [Gl 0.993 0.290 0.541 7e-47
224137298 342 cytochrome P450 [Populus trichocarpa] gi 0.993 0.447 0.55 9e-47
224148856 271 cytochrome P450 [Populus trichocarpa] gi 0.993 0.564 0.55 1e-46
224112939 528 cytochrome P450 [Populus trichocarpa] gi 0.993 0.289 0.55 1e-46
224137318 392 cytochrome P450 [Populus trichocarpa] gi 0.987 0.387 0.519 2e-46
225458465 527 PREDICTED: cytochrome P450 82C4 [Vitis v 0.993 0.290 0.522 1e-45
224137290 538 cytochrome P450 [Populus trichocarpa] gi 0.987 0.282 0.530 1e-44
224109946250 cytochrome P450 [Populus trichocarpa] gi 0.987 0.608 0.530 2e-44
224123398 525 cytochrome P450 [Populus trichocarpa] gi 1.0 0.293 0.508 3e-44
441418866 453 CYP82D61 [Sinopodophyllum hexandrum] 0.993 0.337 0.5 4e-44
>gi|356510322|ref|XP_003523888.1| PREDICTED: cytochrome P450 82C4-like [Glycine max] Back     alignment and taxonomy information
 Score =  191 bits (486), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 97/179 (54%), Positives = 120/179 (67%), Gaps = 26/179 (14%)

Query: 1   ALKKAHDELDIHVGANRQVNESDIKNLVYLRAILKETMRLYPS---------MEDCTGSG 51
           ALKKA +ELD++VG  RQV ESDI+NL Y++AI+KET+RLYP+          EDC  +G
Sbjct: 346 ALKKAQEELDLNVGMERQVEESDIRNLAYVQAIIKETLRLYPAGPLLGPREAQEDCNVAG 405

Query: 52  YHVRAGTQHFVNALKVHHDPK-----------------DIDLRGQNFELMPFGSGRRICP 94
           YHV AGT+  VN  K+H DP+                  +D+RGQNFEL+PFGSGRR CP
Sbjct: 406 YHVPAGTRLVVNLWKIHRDPRVWQEPSAFRPERFLTSDAVDVRGQNFELIPFGSGRRSCP 465

Query: 95  GISFAFQVMPLTLASLLRGFDFATPLDELVDMEEAKSLIITRATPFKALLTPHLSASLY 153
           G+SFA QV+ LTLA LL  F+FATP D+ VDM E+  L I +ATP + LLTP L A LY
Sbjct: 466 GMSFALQVLHLTLARLLHAFEFATPSDQPVDMTESPGLTIPKATPLEVLLTPRLPAKLY 524

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224137298|ref|XP_002327091.1| cytochrome P450 [Populus trichocarpa] gi|222835406|gb|EEE73841.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224148856|ref|XP_002336723.1| cytochrome P450 [Populus trichocarpa] gi|222836601|gb|EEE74994.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224112939|ref|XP_002332682.1| cytochrome P450 [Populus trichocarpa] gi|222838808|gb|EEE77159.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224137318|ref|XP_002327096.1| cytochrome P450 [Populus trichocarpa] gi|222835411|gb|EEE73846.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225458465|ref|XP_002284031.1| PREDICTED: cytochrome P450 82C4 [Vitis vinifera] gi|302142392|emb|CBI19595.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224137290|ref|XP_002327089.1| cytochrome P450 [Populus trichocarpa] gi|222835404|gb|EEE73839.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224109946|ref|XP_002333178.1| cytochrome P450 [Populus trichocarpa] gi|222835027|gb|EEE73476.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224123398|ref|XP_002330305.1| cytochrome P450 [Populus trichocarpa] gi|222871340|gb|EEF08471.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|441418866|gb|AGC29951.1| CYP82D61 [Sinopodophyllum hexandrum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query154
TAIR|locus:2116622512 CYP82C3 ""cytochrome P450, fam 0.545 0.164 0.547 4e-40
TAIR|locus:2116652523 CYP82C2 ""cytochrome P450, fam 0.545 0.160 0.547 1.2e-39
TAIR|locus:2116607524 CYP82C4 ""cytochrome P450, fam 0.461 0.135 0.575 4.5e-39
TAIR|locus:2142878513 TT7 "TRANSPARENT TESTA 7" [Ara 0.506 0.152 0.388 1.6e-23
TAIR|locus:2139099520 CYP706A5 ""cytochrome P450, fa 0.532 0.157 0.426 1.3e-22
TAIR|locus:2139114518 CYP706A6 ""cytochrome P450, fa 0.545 0.162 0.411 7.2e-22
TAIR|locus:504955640490 CYP71A22 ""cytochrome P450, fa 0.5 0.157 0.4 7.5e-22
TAIR|locus:2043699512 CYP76C1 ""cytochrome P450, fam 0.467 0.140 0.466 2.8e-21
TAIR|locus:2139084516 CYP706A4 ""cytochrome P450, fa 0.545 0.162 0.388 5.4e-21
TAIR|locus:2019240497 CYP98A8 "cytochrome P450, fami 0.512 0.158 0.362 1.9e-20
TAIR|locus:2116622 CYP82C3 ""cytochrome P450, family 82, subfamily C, polypeptide 3"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 234 (87.4 bits), Expect = 4.0e-40, Sum P(2) = 4.0e-40
 Identities = 46/84 (54%), Positives = 56/84 (66%)

Query:    70 DPKDIDLRGQNFELMPFGSGRRICPGISFAFQVMPLTLASLLRGFDFATPLDELVDMEEA 129
             + KD D+RGQNFELMPFGSGRR CPG S A Q++ L LA  L  F+  T LD  VDM E+
Sbjct:   428 EAKDFDVRGQNFELMPFGSGRRSCPGPSLAMQMLHLGLARFLHSFEVKTVLDRPVDMSES 487

Query:   130 KSLIITRATPFKALLTPHLSASLY 153
               L IT+ATP + L+ P L   L+
Sbjct:   488 PGLTITKATPLEVLINPRLKRELF 511
GO:0005506 "iron ion binding" evidence=IEA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0019825 "oxygen binding" evidence=ISS
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
TAIR|locus:2116652 CYP82C2 ""cytochrome P450, family 82, subfamily C, polypeptide 2"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2116607 CYP82C4 ""cytochrome P450, family 82, subfamily C, polypeptide 4"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2142878 TT7 "TRANSPARENT TESTA 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2139099 CYP706A5 ""cytochrome P450, family 706, subfamily A, polypeptide 5"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2139114 CYP706A6 ""cytochrome P450, family 706, subfamily A, polypeptide 6"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504955640 CYP71A22 ""cytochrome P450, family 71, subfamily A, polypeptide 22"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043699 CYP76C1 ""cytochrome P450, family 76, subfamily C, polypeptide 1"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2139084 CYP706A4 ""cytochrome P450, family 706, subfamily A, polypeptide 4"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019240 CYP98A8 "cytochrome P450, family 98, subfamily A, polypeptide 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
CYP82C9v1
cytochrome P450 (486 aa)
(Populus trichocarpa)
Predicted Functional Partners:
CYP715A2-2
cytochrome P450 (359 aa)
  •     0.456

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query154
PLN02687517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 8e-38
PLN00110504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 6e-35
PLN03112514 PLN03112, PLN03112, cytochrome P450 family protein 3e-30
pfam00067461 pfam00067, p450, Cytochrome P450 2e-27
PLN02183516 PLN02183, PLN02183, ferulate 5-hydroxylase 5e-26
PLN03234499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 4e-22
PLN02394503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 6e-21
PLN02966502 PLN02966, PLN02966, cytochrome P450 83A1 1e-19
PLN02655466 PLN02655, PLN02655, ent-kaurene oxidase 6e-18
PLN03018534 PLN03018, PLN03018, homomethionine N-hydroxylase 2e-15
PLN02971543 PLN02971, PLN02971, tryptophan N-hydroxylase 5e-15
PLN02936489 PLN02936, PLN02936, epsilon-ring hydroxylase 2e-13
PTZ00404482 PTZ00404, PTZ00404, cytochrome P450; Provisional 4e-12
COG2124411 COG2124, CypX, Cytochrome P450 [Secondary metaboli 9e-12
PLN02738633 PLN02738, PLN02738, carotene beta-ring hydroxylase 1e-11
PLN00168519 PLN00168, PLN00168, Cytochrome P450; Provisional 9e-11
PLN02290516 PLN02290, PLN02290, cytokinin trans-hydroxylase 4e-07
PLN02987472 PLN02987, PLN02987, Cytochrome P450, family 90, su 2e-06
PLN02169500 PLN02169, PLN02169, fatty acid (omega-1)-hydroxyla 3e-05
PLN03195516 PLN03195, PLN03195, fatty acid omega-hydroxylase; 5e-04
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information 
 Score =  134 bits (339), Expect = 8e-38
 Identities = 67/184 (36%), Positives = 98/184 (53%), Gaps = 32/184 (17%)

Query: 2   LKKAHDELDIHVGANRQVNESDIKNLVYLRAILKETMRLYPSM---------EDCTGSGY 52
           LKKA +ELD  VG +R V+ESD+  L YL+A++KET RL+PS          E+C  +GY
Sbjct: 331 LKKAQEELDAVVGRDRLVSESDLPQLTYLQAVIKETFRLHPSTPLSLPRMAAEECEINGY 390

Query: 53  HVRAGTQHFVNALKVHHDPK--------------------DIDLRGQNFELMPFGSGRRI 92
           H+  G    VN   +  DP+                     +D++G +FEL+PFG+GRRI
Sbjct: 391 HIPKGATLLVNVWAIARDPEQWPDPLEFRPDRFLPGGEHAGVDVKGSDFELIPFGAGRRI 450

Query: 93  CPGISFAFQVMPLTLASLLRGFDFATPLD---ELVDMEEAKSLIITRATPFKALLTPHLS 149
           C G+S+  +++ L  A+L+  FD+        + ++MEEA  L + RA P      P L 
Sbjct: 451 CAGLSWGLRMVTLLTATLVHAFDWELADGQTPDKLNMEEAYGLTLQRAVPLMVHPRPRLL 510

Query: 150 ASLY 153
            S Y
Sbjct: 511 PSAY 514

Length = 517
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|178592 PLN03018, PLN03018, homomethionine N-hydroxylase Back     alignment and domain information
>gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase Back     alignment and domain information
>gnl|CDD|178524 PLN02936, PLN02936, epsilon-ring hydroxylase Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase Back     alignment and domain information
>gnl|CDD|166628 PLN02987, PLN02987, Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>gnl|CDD|177826 PLN02169, PLN02169, fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>gnl|CDD|215627 PLN03195, PLN03195, fatty acid omega-hydroxylase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 154
KOG0158499 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf 100.0
PLN02971543 tryptophan N-hydroxylase 100.0
PTZ00404482 cytochrome P450; Provisional 100.0
KOG0156489 consensus Cytochrome P450 CYP2 subfamily [Secondar 100.0
PLN02394503 trans-cinnamate 4-monooxygenase 100.0
PLN00168519 Cytochrome P450; Provisional 100.0
PLN02738633 carotene beta-ring hydroxylase 100.0
KOG0157497 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami 100.0
PLN02290516 cytokinin trans-hydroxylase 100.0
PLN00110504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 100.0
PLN02183516 ferulate 5-hydroxylase 100.0
KOG0159519 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 100.0
PLN02426502 cytochrome P450, family 94, subfamily C protein 100.0
PLN03112514 cytochrome P450 family protein; Provisional 100.0
PLN03234499 cytochrome P450 83B1; Provisional 100.0
PLN02169500 fatty acid (omega-1)-hydroxylase/midchain alkane h 100.0
PF00067463 p450: Cytochrome P450 p450 superfamily signature b 100.0
PLN03018534 homomethionine N-hydroxylase 100.0
PLN02500490 cytochrome P450 90B1 100.0
PLN03195516 fatty acid omega-hydroxylase; Provisional 100.0
PLN02655466 ent-kaurene oxidase 100.0
PLN02687517 flavonoid 3'-monooxygenase 100.0
PLN02774463 brassinosteroid-6-oxidase 100.0
PLN03141452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 100.0
PLN02936489 epsilon-ring hydroxylase 99.98
PLN02966502 cytochrome P450 83A1 99.98
PLN02196463 abscisic acid 8'-hydroxylase 99.98
PLN02302490 ent-kaurenoic acid oxidase 99.98
PLN02987472 Cytochrome P450, family 90, subfamily A 99.97
KOG0684486 consensus Cytochrome P450 [Secondary metabolites b 99.96
PLN02648480 allene oxide synthase 99.93
COG2124411 CypX Cytochrome P450 [Secondary metabolites biosyn 99.9
>KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information 
Probab=100.00  E-value=3.9e-38  Score=246.88  Aligned_cols=146  Identities=27%  Similarity=0.486  Sum_probs=128.0

Q ss_pred             CHHHHHHHHhHhhCCCCCCCccccCCChhHHHHHHhhhcCCC--------CCCCCccc-CeeeCCCCEEEeeccccccCC
Q 048149            1 ALKKAHDELDIHVGANRQVNESDIKNLVYLRAILKETMRLYP--------SMEDCTGS-GYHVRAGTQHFVNALKVHHDP   71 (154)
Q Consensus         1 vq~kl~~Ei~~~~~~~~~~~~~~~~~l~~~~a~~~E~lRl~~--------~~~~~~~~-g~~ip~g~~v~~~~~~~~~~~   71 (154)
                      ||+|||+||+++..+...++++.+.+|+||++||+||||+||        +.+|+++. ++.||+|+.|.++.+++|+||
T Consensus       327 vQ~kLreEI~~~~~~~~~ltyd~l~~L~YLd~Vi~ETLR~yP~~~~~~R~C~k~~~i~~~~~i~kG~~V~Ip~~alH~Dp  406 (499)
T KOG0158|consen  327 VQDKLREEIDEVLEEKEGLTYDSLSKLKYLDMVIKETLRLYPPAPFLNRECTKDYEIPGGFVIPKGTPVMIPTYALHHDP  406 (499)
T ss_pred             HHHHHHHHHHHHhcccCCCCHHHHhCCcHHHHHHHHHHhhCCCcccccceecCceecCCCeEeCCCCEEEeecccccCCc
Confidence            699999999999665444999999999999999999999999        78999999 999999999999999999999


Q ss_pred             -----------CCcCcCC----CCCccccccCCCCCCcchHHHHHHHHHHHHHHHHcCeeeCCCCCccChhhcc---cee
Q 048149           72 -----------KDIDLRG----QNFELMPFGSGRRICPGISFAFQVMPLTLASLLRGFDFATPLDELVDMEEAK---SLI  133 (154)
Q Consensus        72 -----------~~~~~~~----~~~~~~pFg~G~r~C~G~~~A~~~~~~~~~~ll~~f~~~~~~~~~~~~~~~~---~~~  133 (154)
                                 |||++..    .+..|+|||.|||+|+|++||.+|+|+.+++||++|+++.++.+.+.  ...   +.+
T Consensus       407 ~~~p~Pe~F~PERF~~~~~~~~~~~~ylPFG~GPR~CIGmRfa~mq~K~~L~~lL~~f~~~~~~~t~~~--~~~~~~~~~  484 (499)
T KOG0158|consen  407 EYWPEPEKFKPERFEEENNKSRHPGAYLPFGVGPRNCIGMRFALMEAKLALAHLLRNFSFEVCPTTIIP--LEGDPKGFT  484 (499)
T ss_pred             ccCCCcccCCCccCCCCcccccCCccccCCCCCccccHHHHHHHHHHHHHHHHHHhhCEEecCCcccCc--ccCCcccee
Confidence                       4444322    56789999999999999999999999999999999999999843323  333   666


Q ss_pred             eecCCCeEEEEeecC
Q 048149          134 ITRATPFKALLTPHL  148 (154)
Q Consensus       134 ~~~~~~~~v~~~~R~  148 (154)
                      +.|..++++++++|+
T Consensus       485 l~pk~gi~Lkl~~r~  499 (499)
T KOG0158|consen  485 LSPKGGIWLKLEPRD  499 (499)
T ss_pred             eecCCceEEEEEeCC
Confidence            788999999999985

>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query154
3ruk_A494 Human Cytochrome P450 Cyp17a1 In Complex With Abira 2e-09
2hi4_A495 Crystal Structure Of Human Microsomal P450 1a2 In C 8e-09
4i8v_A491 Human Cytochrome P450 1a1 In Complex With Alpha-nap 1e-08
3hf2_A482 Crystal Structure Of The I401p Mutant Of Cytochrome 2e-08
3kx4_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 2e-07
1zoa_A473 Crystal Structure Of A328v Mutant Of The Heme Domai 3e-07
3qi8_B472 Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) 3e-07
1yqo_A455 T268a Mutant Heme Domain Of Flavocytochrome P450 Bm 4e-07
2x7y_A455 P450 Bm3 F87a In Complex With Dmso Length = 455 4e-07
3kx5_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 4e-07
3dgi_A461 Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Le 4e-07
1bvy_A458 Complex Of The Heme And Fmn-Binding Domains Of The 4e-07
2bmh_A455 Modeling Protein-Substrate Interactions In The Heme 4e-07
1yqp_A455 T268n Mutant Cytochrome Domain Of Flavocytochrome P 4e-07
2nnb_A471 The Q403k Mutnat Heme Domain Of Flavocytochrome P45 4e-07
3cbd_A455 Directed Evolution Of Cytochrome P450 Bm3, To Octan 4e-07
2hpd_A471 Crystal Structure Of Hemoprotein Domain Of P450bm-3 4e-07
1fah_A471 Structure Of Cytochrome P450 Length = 471 4e-07
1smi_A471 A Single Mutation Of P450 Bm3 Induces The Conformat 4e-07
2ij2_A470 Atomic Structure Of The Heme Domain Of Flavocytochr 4e-07
1zo4_A473 Crystal Structure Of A328s Mutant Of The Heme Domai 4e-07
3ekd_A470 Crystal Structure Of The A264m Heme Domain Of Cytoc 4e-07
3ben_A470 Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine 4e-07
2uwh_A458 Cytochrome P450 Bm3 Mutant In Complex With Palmitic 4e-07
3kx3_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 4e-07
4dud_A471 Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Le 4e-07
4dtw_B469 Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Seroto 4e-07
2ij3_A470 Structure Of The A264h Mutant Of Cytochrome P450 Bm 4e-07
1jpz_A473 Crystal Structure Of A Complex Of The Heme Domain O 4e-07
4du2_B470 Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamin 4e-07
3m4v_A482 Crystal Structure Of The A330p Mutant Of Cytochrome 4e-07
2ij4_A470 Structure Of The A264k Mutant Of Cytochrome P450 Bm 4e-07
3ekf_A470 Crystal Structure Of The A264q Heme Domain Of Cytoc 4e-07
3npl_A470 Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme D 4e-07
3psx_A487 Crystal Structure Of The Kt2 Mutant Of Cytochrome P 5e-07
3ekb_A470 Crystal Structure Of The A264c Mutant Heme Domain O 5e-07
4duf_A471 Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Seroto 8e-07
4duc_A472 Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Leng 8e-07
4dua_A471 Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Leng 8e-07
4dub_A472 Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopami 8e-07
1p0x_A455 F393y Mutant Heme Domain Of Flavocytochrome P450 Bm 8e-07
1p0w_A455 F393w Mutant Heme Domain Of Flavocytochrome P450 Bm 1e-06
3eqm_A503 Crystal Structure Of Human Placental Aromatase Cyto 3e-06
1jme_A455 Crystal Structure Of Phe393his Cytochrome P450 Bm3 3e-06
1p0v_A455 F393a Mutant Heme Domain Of Flavocytochrome P450 Bm 4e-06
3k9v_A482 Crystal Structure Of Rat Mitochondrial P450 24a1 S5 8e-06
3ua1_A487 Crystal Structure Of The Cytochrome P4503a4-Bromoer 2e-05
1tqn_A486 Crystal Structure Of Human Microsomal P450 3a4 Leng 2e-05
1w0e_A485 Crystal Structure Of Human Cytochrome P450 3a4 Leng 2e-05
1og2_A475 Structure Of Human Cytochrome P450 Cyp2c9 Length = 2e-05
1r9o_A477 Crystal Structure Of P4502c9 With Flurbiprofen Boun 2e-05
3dbg_A467 Crystal Structure Of Cytochrome P450 170a1 (Cyp170a 2e-05
3c6g_A479 Crystal Structure Of Cyp2r1 In Complex With Vitamin 3e-05
3czh_A481 Crystal Structure Of Cyp2r1 In Complex With Vitamin 3e-05
3pm0_A507 Structural Characterization Of The Complex Between 3e-05
1x8v_A455 Estriol-Bound And Ligand-Free Structures Of Sterol 4e-05
2w0a_A455 Cyp51 Of M. Tuberculosis Bound To An Inhibitor N-[( 4e-05
1u13_A455 Crystal Structure Analysis Of The C37lC151TC442A-Tr 4e-05
2q9f_A456 Crystal Structure Of Human Cytochrome P450 46a1 In 4e-05
1ea1_A455 Cytochrome P450 14 Alpha-Sterol Demethylase (Cyp51) 5e-05
4dvq_A483 Structure Of Human Aldosterone Synthase, Cyp11b2, I 5e-05
4gqs_A477 Structure Of Human Microsomal Cytochrome P450 (cyp) 1e-04
2ve3_A444 Retinoic Acid Bound Cyanobacterial Cyp120a1 Length 1e-04
3ld6_A461 Crystal Structure Of Human Lanosterol 14alpha-Demet 2e-04
2p85_A476 Structure Of Human Lung Cytochrome P450 2a13 With I 2e-04
3tk3_A476 Cytochrome P450 2b4 Mutant L437a In Complex With 4- 3e-04
4h1n_A479 Crystal Structure Of P450 2b4 F297a Mutant In Compl 4e-04
2q6n_A478 Structure Of Cytochrome P450 2b4 With Bound 1-(4- C 5e-04
1suo_A476 Structure Of Mammalian Cytochrome P450 2b4 With Bou 5e-04
1po5_A476 Structure Of Mammalian Cytochrome P450 2b4 Length = 5e-04
>pdb|3RUK|A Chain A, Human Cytochrome P450 Cyp17a1 In Complex With Abiraterone Length = 494 Back     alignment and structure 
Iteration: 1

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 64/145 (44%), Gaps = 26/145 (17%)
Query: 3   KKAHDELDIHVGANRQVNESDIKNLVYLRAILKETMRLYP---------SMEDCTGSGYH 53
           KK ++E+D +VG +R    SD   L+ L A ++E +RL P         +  D +   + 
Sbjct: 308 KKLYEEIDQNVGFSRTPTISDRNRLLLLEATIREVLRLRPVAPMLIPHKANVDSSIGEFA 367
Query: 54  VRAGTQHFVNALKVHHD-----------------PKDIDLRGQNFELMPFGSGRRICPGI 96
           V  GT+  +N   +HH+                 P    L   +   +PFG+G R C G 
Sbjct: 368 VDKGTEVIINLWALHHNEKEWHQPDQFMPERFLNPAGTQLISPSVSYLPFGAGPRSCIGE 427
Query: 97  SFAFQVMPLTLASLLRGFDFATPLD 121
             A Q + L +A LL+ FD   P D
Sbjct: 428 ILARQELFLIMAWLLQRFDLEVPDD 452
>pdb|2HI4|A Chain A, Crystal Structure Of Human Microsomal P450 1a2 In Complex With Alpha-Naphthoflavone Length = 495 Back     alignment and structure
>pdb|4I8V|A Chain A, Human Cytochrome P450 1a1 In Complex With Alpha-naphthoflavone Length = 491 Back     alignment and structure
>pdb|3HF2|A Chain A, Crystal Structure Of The I401p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|3KX4|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|1ZOA|A Chain A, Crystal Structure Of A328v Mutant Of The Heme Domain Of P450bm-3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|3QI8|B Chain B, Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) Length = 472 Back     alignment and structure
>pdb|1YQO|A Chain A, T268a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|2X7Y|A Chain A, P450 Bm3 F87a In Complex With Dmso Length = 455 Back     alignment and structure
>pdb|3KX5|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|3DGI|A Chain A, Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Length = 461 Back     alignment and structure
>pdb|1BVY|A Chain A, Complex Of The Heme And Fmn-Binding Domains Of The Cytochrome P450(Bm-3) Length = 458 Back     alignment and structure
>pdb|2BMH|A Chain A, Modeling Protein-Substrate Interactions In The Heme Domain Of Cytochrome P450bm-3 Length = 455 Back     alignment and structure
>pdb|1YQP|A Chain A, T268n Mutant Cytochrome Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|2NNB|A Chain A, The Q403k Mutnat Heme Domain Of Flavocytochrome P450 Bm3 Length = 471 Back     alignment and structure
>pdb|3CBD|A Chain A, Directed Evolution Of Cytochrome P450 Bm3, To Octane Monoxygenase 139-3 Length = 455 Back     alignment and structure
>pdb|2HPD|A Chain A, Crystal Structure Of Hemoprotein Domain Of P450bm-3, A Prototype For Microsomal P450's Length = 471 Back     alignment and structure
>pdb|1FAH|A Chain A, Structure Of Cytochrome P450 Length = 471 Back     alignment and structure
>pdb|1SMI|A Chain A, A Single Mutation Of P450 Bm3 Induces The Conformational Rearrangement Seen Upon Substrate-Binding In Wild-Type Enzyme Length = 471 Back     alignment and structure
>pdb|2IJ2|A Chain A, Atomic Structure Of The Heme Domain Of Flavocytochrome P450- Bm3 Length = 470 Back     alignment and structure
>pdb|1ZO4|A Chain A, Crystal Structure Of A328s Mutant Of The Heme Domain Of P450bm-3 Length = 473 Back     alignment and structure
>pdb|3EKD|A Chain A, Crystal Structure Of The A264m Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3BEN|A Chain A, Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine Inhibitor Bound To The Heme Domain Of Cytochrome P450-Bm3 Length = 470 Back     alignment and structure
>pdb|2UWH|A Chain A, Cytochrome P450 Bm3 Mutant In Complex With Palmitic Acid Length = 458 Back     alignment and structure
>pdb|3KX3|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|4DUD|A Chain A, Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|4DTW|B Chain B, Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Serotonin Length = 469 Back     alignment and structure
>pdb|2IJ3|A Chain A, Structure Of The A264h Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1JPZ|A Chain A, Crystal Structure Of A Complex Of The Heme Domain Of P450bm- 3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|4DU2|B Chain B, Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamine Length = 470 Back     alignment and structure
>pdb|3M4V|A Chain A, Crystal Structure Of The A330p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|2IJ4|A Chain A, Structure Of The A264k Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3EKF|A Chain A, Crystal Structure Of The A264q Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3NPL|A Chain A, Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme Domain, A Ruthenium Modified P450 Bm3 Mutant Length = 470 Back     alignment and structure
>pdb|3PSX|A Chain A, Crystal Structure Of The Kt2 Mutant Of Cytochrome P450 Bm3 Length = 487 Back     alignment and structure
>pdb|3EKB|A Chain A, Crystal Structure Of The A264c Mutant Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|4DUF|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Serotonin Length = 471 Back     alignment and structure
>pdb|4DUC|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Length = 472 Back     alignment and structure
>pdb|4DUA|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|4DUB|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopamine Length = 472 Back     alignment and structure
>pdb|1P0X|A Chain A, F393y Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1P0W|A Chain A, F393w Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3EQM|A Chain A, Crystal Structure Of Human Placental Aromatase Cytochrome P450 In Complex With Androstenedione Length = 503 Back     alignment and structure
>pdb|1JME|A Chain A, Crystal Structure Of Phe393his Cytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1P0V|A Chain A, F393a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3K9V|A Chain A, Crystal Structure Of Rat Mitochondrial P450 24a1 S57d In Complex With Chaps Length = 482 Back     alignment and structure
>pdb|3UA1|A Chain A, Crystal Structure Of The Cytochrome P4503a4-Bromoergocryptine Complex Length = 487 Back     alignment and structure
>pdb|1TQN|A Chain A, Crystal Structure Of Human Microsomal P450 3a4 Length = 486 Back     alignment and structure
>pdb|1W0E|A Chain A, Crystal Structure Of Human Cytochrome P450 3a4 Length = 485 Back     alignment and structure
>pdb|1OG2|A Chain A, Structure Of Human Cytochrome P450 Cyp2c9 Length = 475 Back     alignment and structure
>pdb|1R9O|A Chain A, Crystal Structure Of P4502c9 With Flurbiprofen Bound Length = 477 Back     alignment and structure
>pdb|3DBG|A Chain A, Crystal Structure Of Cytochrome P450 170a1 (Cyp170a1) From Streptomyces Coelicolor Length = 467 Back     alignment and structure
>pdb|3C6G|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D3 Length = 479 Back     alignment and structure
>pdb|3CZH|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D2 Length = 481 Back     alignment and structure
>pdb|3PM0|A Chain A, Structural Characterization Of The Complex Between Alpha- Naphthoflavone And Human Cytochrome P450 1b1 (Cyp1b1) Length = 507 Back     alignment and structure
>pdb|1X8V|A Chain A, Estriol-Bound And Ligand-Free Structures Of Sterol 14alpha- Demethylase (Cyp51) Length = 455 Back     alignment and structure
>pdb|2W0A|A Chain A, Cyp51 Of M. Tuberculosis Bound To An Inhibitor N-[(1s)-2-Methyl-1-(Pyridin-4-Ylcarbamoyl)propyl] Cyclohexanecarboxamide Length = 455 Back     alignment and structure
>pdb|1U13|A Chain A, Crystal Structure Analysis Of The C37lC151TC442A-Triple Mutant Of Cyp51 From Mycobacterium Tuberculosis Length = 455 Back     alignment and structure
>pdb|2Q9F|A Chain A, Crystal Structure Of Human Cytochrome P450 46a1 In Complex With Cholesterol-3-Sulphate Length = 456 Back     alignment and structure
>pdb|1EA1|A Chain A, Cytochrome P450 14 Alpha-Sterol Demethylase (Cyp51) From Mycobacterium Tuberculosis In Complex With Fluconazole Length = 455 Back     alignment and structure
>pdb|4DVQ|A Chain A, Structure Of Human Aldosterone Synthase, Cyp11b2, In Complex With Deoxycorticosterone Length = 483 Back     alignment and structure
>pdb|4GQS|A Chain A, Structure Of Human Microsomal Cytochrome P450 (cyp) 2c19 Length = 477 Back     alignment and structure
>pdb|2VE3|A Chain A, Retinoic Acid Bound Cyanobacterial Cyp120a1 Length = 444 Back     alignment and structure
>pdb|3LD6|A Chain A, Crystal Structure Of Human Lanosterol 14alpha-Demethylase (C Complex With Ketoconazole Length = 461 Back     alignment and structure
>pdb|2P85|A Chain A, Structure Of Human Lung Cytochrome P450 2a13 With Indole Bound In Two Alternate Conformations Length = 476 Back     alignment and structure
>pdb|3TK3|A Chain A, Cytochrome P450 2b4 Mutant L437a In Complex With 4-(4-Chlorophenyl) Imidazole Length = 476 Back     alignment and structure
>pdb|4H1N|A Chain A, Crystal Structure Of P450 2b4 F297a Mutant In Complex With Anti- Platelet Drug Clopidogrel Length = 479 Back     alignment and structure
>pdb|2Q6N|A Chain A, Structure Of Cytochrome P450 2b4 With Bound 1-(4- Cholorophenyl)imidazole Length = 478 Back     alignment and structure
>pdb|1SUO|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 With Bound 4-(4- Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|1PO5|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 Length = 476 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query154
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 3e-47
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 4e-44
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 4e-40
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 9e-39
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 2e-28
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 6e-28
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 4e-27
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 1e-24
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 6e-24
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 7e-24
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 5e-23
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 3e-22
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 6e-22
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 6e-21
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 2e-20
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 2e-19
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 6e-19
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 7e-19
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 9e-19
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 2e-18
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 7e-18
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 1e-17
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 2e-17
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 2e-17
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 4e-17
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 1e-16
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 1e-16
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 2e-16
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 4e-14
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
 Score =  158 bits (401), Expect = 3e-47
 Identities = 36/192 (18%), Positives = 59/192 (30%), Gaps = 44/192 (22%)

Query: 1   ALKKAHDELDIHVGANRQVNESDIKNLVYLRAILKETMRLYP-------SMEDCT----- 48
           AL+   +E+    G      E   KN     ++L ET+RL           +D       
Sbjct: 286 ALRAVREEIQ---GGKHLRLEERQKNTPVFDSVLWETLRLTAAALITRDVTQDKKICLSN 342

Query: 49  GSGYHVRAGTQHFVNA-LKVHHDPK------------------------DIDLRGQNFEL 83
           G  YH+R G +  V   +    DP+                          +     +  
Sbjct: 343 GQEYHLRRGDRLCVFPFISPQMDPQIHQQPEMFQFDRFLNADRTEKKDFFKNGARVKYPS 402

Query: 84  MPFGSGRRICPGISFAFQVMPLTLASLLRGFDFATPLDE----LVDMEEAKSLIITRATP 139
           +P+G+   +CPG  FA   +   + ++L  FD           LVD       I+  A  
Sbjct: 403 VPWGTEDNLCPGRHFAVHAIKELVFTILTRFDVELCDKNATVPLVDPSRYGFGILQPAGD 462

Query: 140 FKALLTPHLSAS 151
            +          
Sbjct: 463 LEIRYRIRFHHH 474
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query154
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 100.0
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 100.0
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 100.0
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 100.0
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 100.0
3ld6_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 100.0
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 100.0
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 100.0
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 100.0
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 100.0
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 100.0
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 100.0
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 100.0
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 100.0
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 100.0
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 100.0
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 100.0
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 100.0
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 100.0
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 99.98
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 99.98
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 99.97
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 99.97
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.97
3v8d_A491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 99.96
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 99.95
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 99.95
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 99.95
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 99.95
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 99.95
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 99.95
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 99.95
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 99.95
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 99.95
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 99.95
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 99.95
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 99.95
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 99.94
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 99.94
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 99.94
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 99.94
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 99.94
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 99.94
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 99.94
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 99.94
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 99.94
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 99.94
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 99.94
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 99.94
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 99.94
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 99.94
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 99.94
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 99.94
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 99.94
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 99.94
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 99.94
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 99.94
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 99.94
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 99.94
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 99.94
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 99.93
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 99.93
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 99.93
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 99.93
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 99.93
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 99.93
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 99.93
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 99.93
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 99.93
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 99.93
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 99.93
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 99.92
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 99.92
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 99.92
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 99.9
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 99.86
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
Probab=100.00  E-value=5.4e-38  Score=245.30  Aligned_cols=148  Identities=22%  Similarity=0.369  Sum_probs=126.3

Q ss_pred             CHHHHHHHHhHhhCCCCCCCccccCCChhHHHHHHhhhcCCC---------CCCCCcccCeeeCCCCEEEeeccccccCC
Q 048149            1 ALKKAHDELDIHVGANRQVNESDIKNLVYLRAILKETMRLYP---------SMEDCTGSGYHVRAGTQHFVNALKVHHDP   71 (154)
Q Consensus         1 vq~kl~~Ei~~~~~~~~~~~~~~~~~l~~~~a~~~E~lRl~~---------~~~~~~~~g~~ip~g~~v~~~~~~~~~~~   71 (154)
                      +|+||++||+.+++.+..++++++.+|||++|||+|+||++|         +.+|+.++|+.||+||.|.++.+++|+||
T Consensus       305 ~q~kl~~Ei~~~~~~~~~~~~~~l~~lpyl~avi~EtlRl~p~~~~~~~~~~~~d~~~~g~~IP~Gt~V~~~~~~~h~d~  384 (479)
T 3tbg_A          305 VQRRVQQEIDDVIGQVRRPEMGDQAHMPYTTAVIHEVQRFGDIVPLGVTHMTSRDIEVQGFRIPKGTTLITNLSSVLKDE  384 (479)
T ss_dssp             HHHHHHHHHHHHTCSSSCCCHHHHTTCHHHHHHHHHHHHHHCSSTTCCCEECSSCEEETTEEECTTCEEEEEHHHHHTCT
T ss_pred             HHHHHHHHHHHHHhhccccchhhhccccccccceeeeccccccccccceeecCCCceECCEEecCCCeeeechhhhcCCh
Confidence            589999999999988889999999999999999999999998         46799999999999999999999999998


Q ss_pred             CC-----------cCcC----CCCCccccccCCCCCCcchHHHHHHHHHHHHHHHHcCeeeCCCCCc-cChhhccceeee
Q 048149           72 KD-----------IDLR----GQNFELMPFGSGRRICPGISFAFQVMPLTLASLLRGFDFATPLDEL-VDMEEAKSLIIT  135 (154)
Q Consensus        72 ~~-----------~~~~----~~~~~~~pFg~G~r~C~G~~~A~~~~~~~~~~ll~~f~~~~~~~~~-~~~~~~~~~~~~  135 (154)
                      +.           |...    ..+..|+|||+|+|+|+|++||.+|+++++|.|+++|+|+++++++ +......+++..
T Consensus       385 ~~~~dP~~F~PeRfl~~~~~~~~~~~~~pFG~G~R~C~G~~lA~~e~~~~la~ll~~f~~~~~~~~~~~~~~~~~~~~~~  464 (479)
T 3tbg_A          385 AVWEKPFRFHPEHFLDAQGHFVKPEAFLPFSAGRRACLGEPLARMELFLFFTSLLQHFSFSVPTGQPRPSHHGVFAFLVS  464 (479)
T ss_dssp             TTSSSTTSCCGGGGBCTTCCBCCCTTCCTTCCSTTSCTTHHHHHHHHHHHHHHHHHHEEEECCTTSCCCCSCEEESSSEE
T ss_pred             hhCCCccccCccccCCCCcccCCCCceecCCCCCcCChhHHHHHHHHHHHHHHHHHccEEEeCCCCCCccccccceeeec
Confidence            44           4221    1456899999999999999999999999999999999999987754 233334455665


Q ss_pred             cCCCeEEEEeecCC
Q 048149          136 RATPFKALLTPHLS  149 (154)
Q Consensus       136 ~~~~~~v~~~~R~~  149 (154)
                      | .+++|.++||++
T Consensus       465 P-~~~~v~~~pRs~  477 (479)
T 3tbg_A          465 P-SPYELCAVPRHH  477 (479)
T ss_dssp             E-CCCCBEEEEC--
T ss_pred             C-CCeEEEEEECCC
Confidence            5 479999999986
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 154
d3czha1463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 3e-26
d1po5a_465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 4e-25
d1tqna_472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 3e-23
d1r9oa_467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 7e-17
d2ciba1445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 5e-16
d2ij2a1453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 1e-15
d1odoa_401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 4e-12
d1gwia_403 a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyce 7e-12
d1n97a_385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 1e-10
d1z8oa1402 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharo 3e-10
d1jfba_399 a.104.1.1 (A:) Cytochrome P450-NOR, nitric reducta 4e-10
d1lfka_394 a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatops 6e-10
d1izoa_411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 9e-10
d1cpta_428 a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas s 3e-09
d1io7a_366 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfata 5e-09
d1ue8a_367 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodai 5e-09
d1n40a_395 a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {My 7e-09
d1s1fa_399 a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [ 9e-09
d1q5da_401 a.104.1.1 (A:) Cytochrome P450epok {Sorangium cell 1e-08
d1ueda_403 a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatops 4e-08
d1re9a_404 a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas pu 3e-07
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Vitamin D 25-hydroxylase Cyp2R1
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  100 bits (249), Expect = 3e-26
 Identities = 38/168 (22%), Positives = 60/168 (35%), Gaps = 25/168 (14%)

Query: 3   KKAHDELDIHVGANRQVNESDIKNLVYLRAILKETMRLYPS---------MEDCTGSGYH 53
            +   E+D+ +G N + +  D   + Y  A+L E +R              ED    GY 
Sbjct: 295 GQVQKEIDLIMGPNGKPSWDDKCKMPYTEAVLHEVLRFCNIVPLGIFHATSEDAVVRGYS 354

Query: 54  VRAGTQHFVNALKVHHDPK---------------DIDLRGQNFELMPFGSGRRICPGISF 98
           +  GT    N   VH D K                     +   L+PF  GRR C G   
Sbjct: 355 IPKGTTVITNLYSVHFDEKYWRDPEVFHPERFLDSSGYFAKKEALVPFSLGRRHCLGEHL 414

Query: 99  AFQVMPLTLASLLRGFDFATPLDELVDMEEAKSLIITRATPFKALLTP 146
           A   M L   +LL+ F    P + + D++  +  +  +  P+      
Sbjct: 415 ARMEMFLFFTALLQRFHLHFPHELVPDLKP-RLGMTLQPQPYLICAER 461
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 403 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Length = 402 Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Length = 399 Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Length = 394 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Length = 428 Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 366 Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Length = 367 Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 395 Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Length = 399 Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Length = 401 Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Length = 403 Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Length = 404 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query154
d3czha1463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 100.0
d1tqna_472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 100.0
d2ciba1445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 100.0
d1r9oa_467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 100.0
d1po5a_465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 100.0
d2ij2a1453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 99.97
d1izoa_411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 99.96
d1n97a_385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 99.93
d1gwia_403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 99.92
d1cpta_428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 99.9
d1odoa_401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 99.9
d1z8oa1402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 99.9
d1n40a_395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 99.9
d1s1fa_399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 99.89
d1re9a_404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 99.89
d1ue8a_367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 99.88
d1q5da_401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 99.87
d1jfba_399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 99.87
d1lfka_394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 99.86
d1io7a_366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 99.85
d1ueda_403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 99.85
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Vitamin D 25-hydroxylase Cyp2R1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=6.5e-37  Score=234.44  Aligned_cols=147  Identities=26%  Similarity=0.386  Sum_probs=129.6

Q ss_pred             CHHHHHHHHhHhhCCCCCCCccccCCChhHHHHHHhhhcCCC---------CCCCCcccCeeeCCCCEEEeeccccccCC
Q 048149            1 ALKKAHDELDIHVGANRQVNESDIKNLVYLRAILKETMRLYP---------SMEDCTGSGYHVRAGTQHFVNALKVHHDP   71 (154)
Q Consensus         1 vq~kl~~Ei~~~~~~~~~~~~~~~~~l~~~~a~~~E~lRl~~---------~~~~~~~~g~~ip~g~~v~~~~~~~~~~~   71 (154)
                      +|+||++||+.+.+....++++++.+|||++||++||+|++|         +.+|+.++|+.||+|+.|.++.+++|+|+
T Consensus       293 ~~~kl~~Ei~~~~~~~~~~~~~~l~~lp~l~a~~~Et~Rl~~~~~~~~~r~~~~~~~~~g~~ipkG~~v~~~~~~~~~d~  372 (463)
T d3czha1         293 IQGQVQKEIDLIMGPNGKPSWDDKCKMPYTEAVLHEVLRFCNIVPLGIFHATSEDAVVRGYSIPKGTTVITNLYSVHFDE  372 (463)
T ss_dssp             HHHHHHHHHHHHTCSSSCCCGGGGGGCHHHHHHHHHHHHHHCSSTTCSCEECSSCEEETTEEECTTCEEEEEHHHHHTCT
T ss_pred             HHHHHHHHHHhhcCCCCCCCHHHHHhhhhcccccceeeeeeccccccceecccCCcccCCcEECCCCcccCcHHHhhCCc
Confidence            589999999999998888999999999999999999999987         56789999999999999999999999998


Q ss_pred             CCc-----------CcC----CCCCccccccCCCCCCcchHHHHHHHHHHHHHHHHcCeeeCCCCCccChhhccceeeec
Q 048149           72 KDI-----------DLR----GQNFELMPFGSGRRICPGISFAFQVMPLTLASLLRGFDFATPLDELVDMEEAKSLIITR  136 (154)
Q Consensus        72 ~~~-----------~~~----~~~~~~~pFg~G~r~C~G~~~A~~~~~~~~~~ll~~f~~~~~~~~~~~~~~~~~~~~~~  136 (154)
                      +.|           ...    ..+..|+|||+|+|.|+|++||++|+++++|.|+++|+|+++.+..++++...++++.|
T Consensus       373 ~~~~dp~~F~PeRfl~~~~~~~~~~~~~~FG~G~r~C~G~~~A~~~~~~~la~ll~~f~~~~~~~~~~~~~~~~~~~~~p  452 (463)
T d3czha1         373 KYWRDPEVFHPERFLDSSGYFAKKEALVPFSLGRRHCLGEHLARMEMFLFFTALLQRFHLHFPHELVPDLKPRLGMTLQP  452 (463)
T ss_dssp             TTCSSTTSCCGGGGBCTTSCBCCCTTCCTTCCSTTCCTTHHHHHHHHHHHHHHHHHHEEEECGGGCCCCCCCCSSSSCCC
T ss_pred             ccCCChhhcCccccCCCccccCCCCceeCCCCCCcCCchHHHHHHHHHHHHHHHHHhcEEEeCCCCCCCceeccCeEEec
Confidence            544           211    24567999999999999999999999999999999999999876666677777777765


Q ss_pred             CCCeEEEEeecC
Q 048149          137 ATPFKALLTPHL  148 (154)
Q Consensus       137 ~~~~~v~~~~R~  148 (154)
                      . +++|++++|+
T Consensus       453 ~-~~~v~~~~R~  463 (463)
T d3czha1         453 Q-PYLICAERRH  463 (463)
T ss_dssp             C-CCCBEEEECC
T ss_pred             c-CcEEEEEeCc
Confidence            4 7899999995
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure