Citrus Sinensis ID: 048151

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160----

MSPINSLAIFHLVVLAARIHLSSANNATQQRYVHLHNEARRNVGIGIGMTWDKTLEDHAHSYAQKLKVDCIIEHSVSHYGENLAWADYDFTVDHIVKMWVDEKQFYDYNSNTCAPNQMCGHYTQVVWRKSVRLGCAKERCNNNHQFIAICNYDPPGNAAGERPF

cccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccEEEEEEEEcccccEEEEEEEccccccccccccc

***INSLAIFHLVVLAARIHLSSANNATQQRYVHLHNEARRNVGIGIGMTWDKTLEDHAHSYAQKLKVDCIIEHSVSHYGENLAWADYDFTVDHIVKMWVDEKQFYDYNSNTCAPNQMCGHYTQVVWRKSVRLGCAKERCNNNHQFIAICNYDPPGNAAGERPF

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MSPINSLAIFHLVVLAARIHLSSANNATQQRYVHLHNEARRNVGIGIGMTWDKTLEDHAHSYAQKLKVDCIIEHSVSHYGENLAWADYDFTVDHIVKMWVDEKQFYDYNSNTCAPNQMCGHYTQVVWRKSVRLGCAKERCNNNHQFIAICNYDPPGNAAGERPF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Pathogenesis-related protein 1A	Probably involved in the defense reaction of plants against pathogens.	probable	P08299
Pathogenesis-related protein 1A1	Probably involved in the defense reaction of plants against pathogens.	probable	Q08697
Basic form of pathogenesis-related protein 1	Probably involved in the defense reaction of plants against pathogens.	probable	P11670

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1CFE, chain A
Confidence level:very confident
Coverage over the Query: 27-164
View the alignment between query and template
View the model in PyMOL