Citrus Sinensis ID: 048159

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840
MDMNNFRPQSSHVAQQSRRDKLRIQQHLEDLSEHSNLEQSSSVNVRNGISFYDSSTTLVSSSELINFSANSSALTAQREAMGHQELSDSHHQHDQHSNTSRPIMTGGDLFTILPHTAVASSHHFRATGDHFQGCCDLKGLDHSQSISEWMVNYASGSSGRESNQNVMLDGEVVSNNSNSTSRKILRPNNYNEYQDHVQSTSVNQPSEKLFGDMHYATPIFPNTVQDVVTLASVGTHGLEVASLLQQSNARETGHVTWTDHSGNELVLLPSYGNQTSAIRYSDPSNWTSRPAAESFHQWSTESGLRNVASDAATQGLSLSLSSNPPSDEMNAGHFAGGYESQNLHFKTDSRSGNSSLLGSFPKPSIIRKGSGKSVQDMGTSSYNVHRNTGPLGPFTGYATILKNSRFLKPAQELLDEFCCVKKSKYGRRGNVSERFSGDRASASASAEADAADVADREVGAKGKNSTSRVSSPTFYSSNQISCEGGVGSSSGESHRPEYQEMRAKLLYLQEEVSKRYKLYHQQLQMVVSSFESVAGLSGATPYVSLAFKAISKNFRCLKSAIMNQLKHVAKALGEEMRSSATVTSSSRGHITNTSAKLNCLDQILQKHKSGGANVGFLEPQQHVWRPQRGLPERAVAILRAWLFEHFLHPYPTDTDKHMLATQTGLSRNQVSNWFINARVRVWKPMVEEIHMLETQGSVATNQDFKTKTDGQSLSDGTAGSSFNGDQPMNDKLAISAMSDEHMDYSGIGSSRSNNEEGLNAEHWNQEKRSRVDSNHRLTTSMDRSLMGFIPYQRNMIEVGGLSAVSLTLGLRHGVESSPQQQQEDQLRRQYGGQMIHDFAG
ccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccHHHHHHHHHHHHccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccc
ccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccEEEcccccEEccccEEEEEcccccccccccccccccHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccEEEEEEEcccccHccHHHccccccccHcccHHHHHccccHHHHHccccccccccHHHHHHcccccccccHHHHHHHHHcHccHHHcccccEcccccccEEEcccccccccccccccccccccccccHHccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHccccccccccHHHHHHHHccHHHHHHHHHHHHHcccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccccccccccHEHEHccc
mdmnnfrpqsshvaQQSRRDKLRIQQHLEDlsehsnleqsssvnvrngisfydssttlvssselinfsaNSSALTAQREAmghqelsdshhqhdqhsntsrpimtggdlftilphtavasshhfratgdhfqgccdlkgldhsQSISEWMVNYasgssgresnqnvMLDGEvvsnnsnstsrkilrpnnyneyqdhvqstsvnqpseklfgdmhyatpifpntVQDVVTLASVGTHGLEVASLLQQsnaretghvtwtdhsgnelvllpsygnqtsairysdpsnwtsrpaaesfhqwstesglrnvasdaatqglslslssnppsdemnaghfaggyesqnlhfktdsrsgnssllgsfpkpsiirkgsgksvqdmgtssynvhrntgplgpftgYATILKNSRFLKPAQELLDEFCcvkkskygrrgnvserfsgdrasasasaeadaadvadrevgakgknstsrvssptfyssnqisceggvgsssgeshrpEYQEMRAKLLYLQEEVSKRYKLYHQQLQMVVSSFEsvaglsgatpyVSLAFKAISKNFRCLKSAIMNQLKHVAKALGEEMrssatvtsssrghitntsaKLNCLDQILQKhksgganvgflepqqhvwrpqrglpERAVAILRAWLFEhflhpyptdtdkhmlatqtglsrnqvsnWFINARVRVWKPMVEEIHMLEtqgsvatnqdfktktdgqslsdgtagssfngdqpmndKLAISAmsdehmdysgigssrsnneeglnaehwnqekrsrvdsnhrlTTSMDRSLMGFIPYQRNMIEVGGLSAVSLTLGlrhgvesspqqqQEDQLRRQYggqmihdfag
mdmnnfrpqsshvaqqsrRDKLRIQQHLEdlsehsnleqsssvnvRNGISFYDSSTTLVSSSELINFSANSSALTAQREAMGHQELSDSHHQHDQHSNTSRPIMTGGDLFTILPHTAVASSHHFRATGDHFQGCCDLKGLDHSQSISEWMVNYASGSSGRESNQNVMLDGEVVSNNSNSTSRKILRPNNYNEYQDHVQSTSVNQPSEKLFGDMHYATPIFPNTVQDVVTLASVGTHGLEVASLLQQSNARETGHVTWTDHSGNELVLLPSYGNQTSAIRYSDPSNWTSRPAAESFHQWSTESGLRNVASDAATQGLSLSLSSNPPSDEMNAGHFAGGYESQNLHFKTDSRSGNSSLLGSFPKPSIIRKGSGKSVQDMGTSSYNVHRNTGPLGPFTGYATILKNSRFLKPAQELLDEFCCvkkskygrrgnvserfsgdrasasasaeadaadvadrevgakgknstsrvssptfyssnqiscEGGVGSSSGESHRPEYQEMRAKLLYLQEEVSKRYKLYHQQLQMVVSSFESVAGLSGATPYVSLAFKAISKNFRCLKSAIMNQLKHVAKALGEEMRSSatvtsssrghitnTSAKLNCLDQILQKHKSGGANVGFLEPQqhvwrpqrgLPERAVAILRAWLFEHFLHPYPTDTDKHMLATQTglsrnqvsnwFINARVRVWKPMVEEIHMLEtqgsvatnqdFKTKTDGQSLSDGtagssfngdqpMNDKLAISAMSDEHMDYSGIGSSRSNNEEGLNAehwnqekrsrvdsnhrltTSMDRSLMGFIPYQRNMIEVGGLSAVSLTLGLRHGVesspqqqqedqLRRQYGGQMIHDFAG
MDMNNFRPQSSHVAQQSRRDKLRIQQHLEDLSEHSNLEQSSSVNVRNGISFYDSSTTLVSSSELINFSANSSALTAQREAMGHQELsdshhqhdqhsNTSRPIMTGGDLFTILPHTAVASSHHFRATGDHFQGCCDLKGLDHSQSISEWMVNYASGSSGRESNQNVMLDGEVVSNNSNSTSRKILRPNNYNEYQDHVQSTSVNQPSEKLFGDMHYATPIFPNTVQDVVTLASVGTHGLEVASLLQQSNARETGHVTWTDHSGNELVLLPSYGNQTSAIRYSDPSNWTSRPAAESFHQWSTESGLRNVASDAATQGlslslssNPPSDEMNAGHFAGGYESQNLHFKTDSRSGNSSLLGSFPKPSIIRKGSGKSVQDMGTSSYNVHRNTGPLGPFTGYATILKNSRFLKPAQELLDEFCCVKKSKYGRRGNVSERFsgdrasasasaeadaadvadrevgaKGKNSTSRVSSPTFYSSNQISCeggvgsssgesHRPEYQEMRAKLLYLQEEVSKRYKLYHQQLQMVVSSFESVAGLSGATPYVSLAFKAISKNFRCLKSAIMNQLKHVAKALGEEMRSSATVTSSSRGHITNTSAKLNCLDQILQKHKSGGANVGFLEPQQHVWRPQRGLPERAVAILRAWLFEHFLHPYPTDTDKHMLATQTGLSRNQVSNWFINARVRVWKPMVEEIHMLETQGSVATNQDFKTKTDGQSLSDGTAGSSFNGDQPMNDKLAISAMSDEHMDYSGIGSSRSNNEEGLNAEHWNQEKRSRVDSNHRLTTSMDRSLMGFIPYQRNMIEVGGLSAVSLTLGLRHGVESSPqqqqedqlrrqYGGQMIHDFAG
*******************************************************************************************************MTGGDLFTILPHTAVASSHHFRATGDHFQGCCDLKGLDHSQSISEWMVNY*******************************************************LFGDMHYATPIFPNTVQDVVTLASVGTHGLEVASLLQQSNARETGHVTWTDHSGNELVLLPSYGNQ****************************************************************************************************************NTGPLGPFTGYATILKNSRFLKPAQELLDEFCCVKKSKY*****************************************************************************AKLLYLQEEVSKRYKLYHQQLQMVVSSFESVAGLSGATPYVSLAFKAISKNFRCLKSAIMNQLKHVAK************************AKLNCLDQILQKHKSGGANVGFLEPQQHVWRPQRGLPERAVAILRAWLFEHFLHPYPTDTDKHMLATQTGLSRNQVSNWFINARVRVWKPMVEEIHMLE******************************************************************************************SLMGFIPYQRNMIEVGGLSAVSLTLGLR*****************************
*************************************************SFYDSSTTLVSSSELINFSANSSA***********************************************************************SISEWMV**************************NSTSRKILRPN********************************************************************************************************************************************************************************************************************LK*SRFLKPAQELLDEFCCVKKSK***************************************************************************EMRAKLLYLQEEVSKRYKLYHQQLQMVV***********ATPYVSLAFKAISKNFRCLKSAIM***********************************************************************AVAILRAWLFEHFLHPYPTDTDKHMLATQTGLSRNQVSNWFINARVRVWKP*****************************************************************************************************************************************************MIHDFAG
********************KLRIQQHLEDLSEHSNLEQSSSVNVRNGISFYDSSTTLVSSSELINFSANSSA**************************SRPIMTGGDLFTILPHTAVASSHHFRATGDHFQGCCDLKGLDHSQSISEWMVNYASGSSGRESNQNVMLDGEVVSNNSNSTSRKILRPNNYNEYQDHVQSTSVNQPSEKLFGDMHYATPIFPNTVQDVVTLASVGTHGLEVASLLQQSNARETGHVTWTDHSGNELVLLPSYGNQTSAIRYSDPSNWTSRPAAESFHQWSTESGLRNVASDAATQGLSLSLSSNPPSDEMNAGHFAGGYESQNLHFKTDSRSGNSSLLGSFPKPSIIR***********TSSYNVHRNTGPLGPFTGYATILKNSRFLKPAQELLDEFCCVKKSKYGRRGNVSE****************************************FYSSNQIS****************YQEMRAKLLYLQEEVSKRYKLYHQQLQMVVSSFESVAGLSGATPYVSLAFKAISKNFRCLKSAIMNQLKHVAKALGE**************HITNTSAKLNCLDQILQKHKSGGANVGFLEPQQHVWRPQRGLPERAVAILRAWLFEHFLHPYPTDTDKHMLATQTGLSRNQVSNWFINARVRVWKPMVEEIHMLETQGSVATNQDFKTKTDGQSLSDGTAGSSFNGDQPMNDKLAISAMSDEHMDYSGIGSSRSNNEEGLNAEHWNQEKRSRVDSNHRLTTSMDRSLMGFIPYQRNMIEVGGLSAVSLTLGLRH****************QYGGQMIHDFAG
******************RDKLRIQQHLEDLSEHSNLEQSSSVNVRNGISFYDSSTTLVSSSE*****************************************************************DHFQGCCDLKGLDHSQSISEWMVNYASGSSGRESNQNVMLDGEVVSNNSNSTSRKILRPNNYNEYQDHVQSTSVNQPSEKLFGDMHYATPIFPNTVQDVVTLASVGTHGLEVASLLQQSNARETGHVTWTDHSGNELVLLPSYGNQTSAIRYSDPSNWTSRPAAESFHQWSTESGLRNVASDAATQGLSLSLSSNPPSDEMNAGHFAGGYESQNLHF****************************************RNTGPLGPFTGYATILKNSRFLKPAQELLDEFCCVKK**********************************************************************SHRPEYQEMRAKLLYLQEEVSKRYKLYHQQLQMVVSSFESVAGLSGATPYVSLAFKAISKNFRCLKSAIMNQLKHVAKALG********************SAKLNCLDQILQKHKSGGANVGFLEPQQHVWRPQRGLPERAVAILRAWLFEHFLHPYPTDTDKHMLATQTGLSRNQVSNWFINARVRVWKPMVEEIHMLETQG************************************************************************************MDRSLMGFIPYQRNMIEVGGLSAVSLTLGLRHGV*************RQYGGQMIH*F*G
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDMNNFRPQSSHVAQQSRRDKLRIQQHLEDLSEHSNLEQSSSVNVRNGISFYDSSTTLVSSSELINFSANSSALTAQREAMGHQELSDSHHQHDQHSNTSRPIMTGGDLFTILPHTAVASSHHFRATGDHFQGCCDLKGLDHSQSISEWMVNYASGSSGRESNQNVMLDGEVVSNNSNSTSRKILRPNNYNEYQDHVQSTSVNQPSEKLFGDMHYATPIFPNTVQDVVTLASVGTHGLEVASLLQQSNARETGHVTWTDHSGNELVLLPSYGNQTSAIRYSDPSNWTSRPAAESFHQWSTESGLRNVASDAATQGLSLSLSSNPPSDEMNAGHFAGGYESQNLHFKTDSRSGNSSLLGSFPKPSIIRKGSGKSVQDMGTSSYNVHRNTGPLGPFTGYATILKNSRFLKPAQELLDEFCCVKKSKYGRRGNVSERFSGDRASASASAEADAADVADREVGAKGKNSTSRVSSPTFYSSNQISCEGGVGSSSGESHRPEYQEMRAKLLYLQEEVSKRYKLYHQQLQMVVSSFESVAGLSGATPYVSLAFKAISKNFRCLKSAIMNQLKHVAKALGEEMRSSATVTSSSRGHITNTSAKLNCLDQILQKHKSGGANVGFLEPQQHVWRPQRGLPERAVAILRAWLFEHFLHPYPTDTDKHMLATQTGLSRNQVSNWFINARVRVWKPMVEEIHMLETQGSVATNQDFKTKTDGQSLSDGTAGSSFNGDQPMNDKLAISAMSDEHMDYSGIGSSRSNNEEGLNAEHWNQEKRSRVDSNHRLTTSMDRSLMGFIPYQRNMIEVGGLSAVSLTLGLRHGVESSPQQQQEDQLRRQYGGQMIHDFAG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query840 2.2.26 [Sep-21-2011]
Q9SJJ3584 BEL1-like homeodomain pro yes no 0.4 0.575 0.415 3e-76
Q9SW80739 BEL1-like homeodomain pro no no 0.296 0.336 0.445 3e-61
Q94KL5627 BEL1-like homeodomain pro no no 0.296 0.397 0.444 6e-60
O65685532 BEL1-like homeodomain pro no no 0.410 0.648 0.369 8e-59
Q9FWS9524 BEL1-like homeodomain pro no no 0.317 0.509 0.406 5e-57
Q9SJ56680 BEL1-like homeodomain pro no no 0.304 0.376 0.442 3e-56
Q38897611 Homeobox protein BEL1 hom no no 0.340 0.468 0.399 3e-56
Q9SIW1482 BEL1-like homeodomain pro no no 0.302 0.526 0.405 1e-55
Q9LZM8575 BEL1-like homeodomain pro no no 0.213 0.311 0.583 2e-55
Q9FXG8538 BEL1-like homeodomain pro no no 0.298 0.466 0.405 2e-55
>sp|Q9SJJ3|BLH8_ARATH BEL1-like homeodomain protein 8 OS=Arabidopsis thaliana GN=BLH8 PE=1 SV=1 Back     alignment and function desciption
 Score =  287 bits (734), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 193/465 (41%), Positives = 243/465 (52%), Gaps = 129/465 (27%)

Query: 380 SSYNVHRNTGPLGPFTGYATILKNSRFLKPAQELLDEFCCVKKSKYGRRGNVSERFSGDR 439
           S+ N+H   GPLGPFTGYA+ILK+SRFL+PAQ++L+EFC    SK   R           
Sbjct: 245 STMNIH---GPLGPFTGYASILKSSRFLEPAQKMLEEFCISYASKIISR----------- 290

Query: 440 ASASASAEADAADVADREVGAKGKNSTSRVSSPTFYSSNQISCEGGVGSSSGESHRPEYQ 499
            S S S E D  D  +                             G  SSS E   P+ +
Sbjct: 291 -SESTSMEDDDDDDDNL---------------------------SGFSSSS-EPLEPKNR 321

Query: 500 EMRAKLLYLQEEVSKRYKLYHQQLQMVVSSFESVAGLSGATPYVSLAFKAISKNFRCLKS 559
             +AKLL+LQEEV K YKLY+ QLQ V+SSF +VAGL+ ATPY+SLA K  S++F+ L++
Sbjct: 322 LKKAKLLFLQEEVCKWYKLYNHQLQTVMSSFNTVAGLNTATPYISLALKRTSRSFKALRT 381

Query: 560 AIMNQLKHVAKALGEEMRSSATVTSSSRGHITNTSAKLNCLDQILQKHKSG--GANVGFL 617
           AI   +K ++        ++                         QK +    G NVGF 
Sbjct: 382 AIAEHVKQISSHSSNGNNNNR-----------------------FQKRQRSLIGNNVGFE 418

Query: 618 EPQQHVWRPQRGLPERAVAILRAWLFEHFLHPYPTDTDKHMLATQTGLSRNQVSNWFINA 677
             QQH+WRPQRGLPERAVA+LRAWLF+HFLHPYPTD+DK MLATQTGLSRNQVSNWFINA
Sbjct: 419 SQQQHIWRPQRGLPERAVAVLRAWLFDHFLHPYPTDSDKQMLATQTGLSRNQVSNWFINA 478

Query: 678 RVRVWKPMVEEIHMLETQGSVATNQDFKTKTDGQSLSDGTAGSSFNGDQPMNDKLAISAM 737
           RVR+WKPMVEEIH LET+                      A +S N  +P N    +S+ 
Sbjct: 479 RVRLWKPMVEEIHTLETKAI------------------KNADTSHN-IEPSNRPNTVSSP 519

Query: 738 SDEHMDYSGIGSSRSNNEEGLNAEHWNQEKRSRVDSNHRLTTSMDRSLMGFIPYQRNMIE 797
           S E    +G+  +                KRSR++        MD  ++GF         
Sbjct: 520 SHEQT-LTGLSGT----------------KRSRLE-------YMD--MVGF--------- 544

Query: 798 VGGLSAVSLTLGLRHGVESSPQQQQEDQLRRQY--GGQMIHDFAG 840
                 VSLTL LR GV++  Q Q +D    Q+  G QM HDF G
Sbjct: 545 --NRGNVSLTLELRRGVDNVIQTQTQDH---QFGTGSQMFHDFVG 584
Required for specifying floral primordia and establishing early internode patterning events during inflorescence development.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9SW80|BLH2_ARATH BEL1-like homeodomain protein 2 OS=Arabidopsis thaliana GN=BLH2 PE=1 SV=3 Back     alignment and function description
>sp|Q94KL5|BLH4_ARATH BEL1-like homeodomain protein 4 OS=Arabidopsis thaliana GN=BLH4 PE=2 SV=2 Back     alignment and function description
>sp|O65685|BLH6_ARATH BEL1-like homeodomain protein 6 OS=Arabidopsis thaliana GN=BLH6 PE=2 SV=1 Back     alignment and function description
>sp|Q9FWS9|BLH3_ARATH BEL1-like homeodomain protein 3 OS=Arabidopsis thaliana GN=BLH3 PE=1 SV=1 Back     alignment and function description
>sp|Q9SJ56|BLH1_ARATH BEL1-like homeodomain protein 1 OS=Arabidopsis thaliana GN=BLH1 PE=1 SV=1 Back     alignment and function description
>sp|Q38897|BEL1_ARATH Homeobox protein BEL1 homolog OS=Arabidopsis thaliana GN=BEL1 PE=1 SV=2 Back     alignment and function description
>sp|Q9SIW1|BLH7_ARATH BEL1-like homeodomain protein 7 OS=Arabidopsis thaliana GN=BLH7 PE=2 SV=1 Back     alignment and function description
>sp|Q9LZM8|BLH9_ARATH BEL1-like homeodomain protein 9 OS=Arabidopsis thaliana GN=BLH9 PE=1 SV=1 Back     alignment and function description
>sp|Q9FXG8|BLH10_ARATH BEL1-like homeodomain protein 10 OS=Arabidopsis thaliana GN=BLH10 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query840
359478712846 PREDICTED: uncharacterized protein LOC10 0.941 0.934 0.524 0.0
147787771874 hypothetical protein VITISV_029711 [Viti 0.939 0.902 0.504 0.0
255577084864 bel1 homeotic protein, putative [Ricinus 0.944 0.917 0.499 0.0
297746284746 unnamed protein product [Vitis vinifera] 0.798 0.899 0.518 1e-180
224106804835 predicted protein [Populus trichocarpa] 0.933 0.938 0.468 1e-172
449515961737 PREDICTED: uncharacterized protein LOC10 0.795 0.906 0.483 1e-159
449443345737 PREDICTED: uncharacterized protein LOC10 0.796 0.907 0.481 1e-158
356541930794 PREDICTED: uncharacterized protein LOC10 0.885 0.937 0.429 1e-140
356547163786 PREDICTED: uncharacterized protein LOC10 0.880 0.941 0.420 1e-140
356544650760 PREDICTED: uncharacterized protein LOC10 0.533 0.589 0.560 1e-135
>gi|359478712|ref|XP_002282519.2| PREDICTED: uncharacterized protein LOC100255350 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  754 bits (1947), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/895 (52%), Positives = 589/895 (65%), Gaps = 104/895 (11%)

Query: 1   MDMNNFRPQSSHVAQQSRRDKLRIQQH--------------LEDLSEHSNLEQS--SSVN 44
           M+M NFRP+S HVAQQSRRDKLR+Q                LE LS H  L        N
Sbjct: 1   MEMRNFRPES-HVAQQSRRDKLRVQHQSSTPAHHLEEFPNSLEQLSVHPELNPDLIQVRN 59

Query: 45  VRNGISFYDSSTTLVSSSELINFSANSSALTAQREAMGHQELSDSHHQHDQHSNTSRPIM 104
           VRNG   YD    +V SSE++NFS+NS      ++AM  Q+ S++  Q     N S PI 
Sbjct: 60  VRNGNVLYD---PIVLSSEMLNFSSNSHVFLGSKDAMVGQD-SNAVSQDASFPNLSHPIS 115

Query: 105 TGGDLFTILPHTAVASSHHFRATGDHFQGCCDLKGLDHSQSISEWMVNYASGSSGRESNQ 164
           +                   +A GD  Q C + KGL   QS  +W+VNYA+G+   ESNQ
Sbjct: 116 S-------------------KAAGDP-QNCDNWKGLGTQQSC-DWIVNYANGTVASESNQ 154

Query: 165 NVMLDGEVVSN-----NSNSTSRKILRPNNYNEYQDHVQSTSVN-------QPSEKLFGD 212
           N M  GEV+S      N+ S S   L+PN Y+ YQD VQS+  N       Q S+K +G+
Sbjct: 155 NPMYVGEVLSASSMKVNNISASSLDLKPN-YSGYQD-VQSSITNPSSEISSQDSQKHYGE 212

Query: 213 MHYATP-IFPNTVQDVVTLASVGTHGLEVASLLQQSNARETGHVTWTDHSGNELVLLPSY 271
           +H+ +P ++ NT+Q+VVT A+VGT GLE+AS   Q N R+TG  +W D  GNELVLLP++
Sbjct: 213 IHFNSPQLYRNTLQEVVTSAAVGTQGLEMASFAHQ-NIRDTGRDSWED-GGNELVLLPNF 270

Query: 272 GNQTSAIRYSDPSNWTSRPAAESFHQWS----------TESGLRNVASDAATQGLSLSLS 321
           GNQ+SA+R      W +RP  E  HQWS          +   L  +ASD+  QGLSLSLS
Sbjct: 271 GNQSSALRLDSSVAWMTRPV-EGCHQWSGGDLGVLANKSLGDLSTIASDSNAQGLSLSLS 329

Query: 322 SNPPSDEMNAGHFAGGYESQNLHFKT-------DSRSGNSSLLGSFPKPSIIRKGSGKSV 374
           S+P S ++    F   YES++L   T       D +  +S  L S  KP +  KG G S+
Sbjct: 330 SHP-SSKIQVAQFGERYESKDLRSGTAAFSCPQDLKVMSSGYLCSDSKPPVSGKGYGNSL 388

Query: 375 QDM-GTSSYNVHRNTGPLGPFTGYATILKNSRFLKPAQELLDEFCCVKKSKYGRRGNVSE 433
            D+ GTS+Y  HR+ GPLGPFTGYATILK+S+FLKPAQ++LDEFC     K  +   V+ 
Sbjct: 389 HDIVGTSTY-THRSAGPLGPFTGYATILKSSKFLKPAQQVLDEFCKAASPKLVKTCEVTR 447

Query: 434 RFSGDRASASASAEADAADVADREVGA-KGKNSTSRVSSPTFYSSNQISCEGGVGSSSGE 492
           R SGD    S S   DA + +D EVGA KG NS   VSS TFY SN+IS EGGV SSS E
Sbjct: 448 RTSGD---VSVSV-PDAVNTSDTEVGAAKGGNSA--VSSSTFYDSNEIS-EGGVKSSSCE 500

Query: 493 SHRPEYQEMRAKLLYLQEEVSKRYKLYHQQLQMVVSSFESVAGLSGATPYVSLAFKAISK 552
           S+RP+YQ+ +AKLL++QEEV +RYK YHQQ+QMVVSSFE+VAGLS ATPY++LA K +S+
Sbjct: 501 SYRPDYQQKKAKLLFMQEEVCRRYKQYHQQMQMVVSSFETVAGLSAATPYIALALKTVSR 560

Query: 553 NFRCLKSAIMNQLKHVAKALGEEMRSSATVTSSSRGHITNTSAKLNCLDQILQKHKSGGA 612
           +FR LK+AI +QL+H+ KALGE++ S +T   +S G  +  S +L  ++Q   KHK GGA
Sbjct: 561 HFRFLKNAISDQLRHIRKALGEDLSSPSTGACTSAGDAS--SPRLKFMNQSFPKHKPGGA 618

Query: 613 NVGFLEPQQHVWRPQRGLPERAVAILRAWLFEHFLHPYPTDTDKHMLATQTGLSRNQVSN 672
           N+GFLEPQQHVWRPQRGLPERAVAILRAWLFEHFLHPYPTDTDKHMLATQTGLSRNQVSN
Sbjct: 619 NLGFLEPQQHVWRPQRGLPERAVAILRAWLFEHFLHPYPTDTDKHMLATQTGLSRNQVSN 678

Query: 673 WFINARVRVWKPMVEEIHMLETQGSVATNQDFKTKTDGQSLSDGTAGSSFNGDQPMNDKL 732
           WFINARVRVWKPMVEE+HMLET+G    +Q+   K D +S+ +G   S  +G+QP N K 
Sbjct: 679 WFINARVRVWKPMVEEVHMLETKGLAERDQN-SGKKDWKSIGEGV--SQRDGNQPSN-KP 734

Query: 733 AISAMSDEHMDYSGIGSSRSNNEEGLNAEHWNQEKRSRVDSNHRLTTSMDRSLMGFIPYQ 792
           +++AMSDE ++  G+  S    +E L AE WNQEKRSRV+   ++  SMD SLMGF+PYQ
Sbjct: 735 SVNAMSDEQLECRGMCPSAGTGDE-LGAEQWNQEKRSRVEC--QIPGSMDGSLMGFVPYQ 791

Query: 793 RNMIEVGGLSAVSLTLGLRHGVESS-------PQQQQEDQLRRQYGGQMIHDFAG 840
           R+ +E+GGL AVSLTLGLRH VE++         QQQEDQLRRQ+GGQMIHDF G
Sbjct: 792 RSGVEIGGLGAVSLTLGLRHSVETAQQQQHQQQLQQQEDQLRRQFGGQMIHDFVG 846

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147787771|emb|CAN62927.1| hypothetical protein VITISV_029711 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255577084|ref|XP_002529426.1| bel1 homeotic protein, putative [Ricinus communis] gi|223531103|gb|EEF32952.1| bel1 homeotic protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297746284|emb|CBI16340.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224106804|ref|XP_002314291.1| predicted protein [Populus trichocarpa] gi|222850699|gb|EEE88246.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449515961|ref|XP_004165016.1| PREDICTED: uncharacterized protein LOC101228800 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449443345|ref|XP_004139440.1| PREDICTED: uncharacterized protein LOC101214235 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356541930|ref|XP_003539425.1| PREDICTED: uncharacterized protein LOC100790583 [Glycine max] Back     alignment and taxonomy information
>gi|356547163|ref|XP_003541986.1| PREDICTED: uncharacterized protein LOC100809720 [Glycine max] Back     alignment and taxonomy information
>gi|356544650|ref|XP_003540761.1| PREDICTED: uncharacterized protein LOC100793050 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query840
TAIR|locus:2185183575 RPL "AT5G02030" [Arabidopsis t 0.340 0.497 0.443 1.6e-74
TAIR|locus:2039250680 BLH1 "AT2G35940" [Arabidopsis 0.323 0.4 0.467 3.9e-67
TAIR|locus:2049035627 BLH4 "BEL1-like homeodomain 4" 0.361 0.484 0.406 3.8e-64
TAIR|locus:2115000739 BLH2 "AT4G36870" [Arabidopsis 0.230 0.262 0.547 7.9e-64
TAIR|locus:2177856611 BEL1 "AT5G41410" [Arabidopsis 0.25 0.343 0.486 3e-59
TAIR|locus:2018398524 BLH3 "AT1G75410" [Arabidopsis 0.266 0.427 0.458 2.3e-57
TAIR|locus:2139614532 BLH6 "AT4G34610" [Arabidopsis 0.263 0.415 0.479 3.6e-56
TAIR|locus:2013154538 BEL10 "AT1G19700" [Arabidopsis 0.286 0.447 0.430 1.2e-55
TAIR|locus:2042609482 BLH7 "AT2G16400" [Arabidopsis 0.283 0.493 0.445 5.4e-55
TAIR|locus:2057856584 BLH8 "AT2G27990" [Arabidopsis 0.215 0.309 0.497 4.5e-53
TAIR|locus:2185183 RPL "AT5G02030" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 550 (198.7 bits), Expect = 1.6e-74, Sum P(3) = 1.6e-74
 Identities = 142/320 (44%), Positives = 187/320 (58%)

Query:   502 RAKLLYLQEEVSKRYKLYHQQLQMVVSSFESVAGLSGATPYVSLAFKAISKNFRCLKSAI 561
             ++KL+ + +EV KRYK Y++QLQ V+ SFE VAGL  A PY +LA KA+SK+F+CLK+AI
Sbjct:   231 KSKLISMLDEVYKRYKQYYEQLQAVMGSFECVAGLGHAAPYANLALKALSKHFKCLKNAI 290

Query:   562 MNQLK--HVAKALGEEMRSSATVTSSSRGHITNTSAKLNCLDQILQKHKSGGANVGFLEP 619
              +QL+  H  K + ++ +    + S ++      S +    D   +   S G   GF + 
Sbjct:   291 TDQLQFSHNNK-IQQQQQCGHPMNSENK----TDSLRFGGSDSS-RGLCSAGQRHGFPDH 344

Query:   620 QQHVWRPQRGLPERAVAILRAWLFEHFLHPYPTDTDKHMLATQTGLSRNQVSNWFINARV 679
                VWRP RGLPERAV +LRAWLF+HFLHPYPTDTDK MLA QTGLSRNQVSNWFINARV
Sbjct:   345 HAPVWRPHRGLPERAVTVLRAWLFDHFLHPYPTDTDKLMLAKQTGLSRNQVSNWFINARV 404

Query:   680 RVWKPMVEEIHMLETQGSVATN----QDFKTKTDG-QSLSDGTAGSSFNGDQPMNDKLAI 734
             RVWKPMVEEIHMLET+ S  ++    +D +T T      S+    SS    +P N     
Sbjct:   405 RVWKPMVEEIHMLETRQSQRSSSSSWRDERTSTTVFPDNSNNNPSSSSAQQRPNNSSPPR 464

Query:   735 SAMSDEHMDYSGIGSSRSNNEEGLNAEHWNQEKRSRVDSNHRLTTSMDRSLMGFIPYQRN 794
              A +D   D  G     +NN   +N+        S V  ++ + +S        +P   +
Sbjct:   465 RARND---DVHGT----NNNNSYVNS---GSGGGSAVGFSYGIGSSN-------VPVMNS 507

Query:   795 MIEVGGLSAVSLTLGLRHGV 814
                 GG   VSLTLGL H +
Sbjct:   508 STN-GG---VSLTLGLHHQI 523
GO:0003677 "DNA binding" evidence=ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0043565 "sequence-specific DNA binding" evidence=IEA;IDA
GO:0005515 "protein binding" evidence=IPI
GO:0007389 "pattern specification process" evidence=RCA;IMP
GO:0010051 "xylem and phloem pattern formation" evidence=RCA;IMP
GO:0080006 "internode patterning" evidence=IMP
GO:0005829 "cytosol" evidence=IDA
GO:0010076 "maintenance of floral meristem identity" evidence=IGI
GO:0010228 "vegetative to reproductive phase transition of meristem" evidence=IGI
GO:0048645 "organ formation" evidence=IGI
GO:0045892 "negative regulation of transcription, DNA-dependent" evidence=IMP
GO:0048457 "floral whorl morphogenesis" evidence=IMP
GO:0010154 "fruit development" evidence=IMP
GO:0048367 "shoot system development" evidence=IGI
GO:0010077 "maintenance of inflorescence meristem identity" evidence=IGI
GO:0010223 "secondary shoot formation" evidence=IGI
GO:0006306 "DNA methylation" evidence=RCA
GO:0006342 "chromatin silencing" evidence=RCA
GO:0006346 "methylation-dependent chromatin silencing" evidence=RCA
GO:0007267 "cell-cell signaling" evidence=RCA
GO:0009616 "virus induced gene silencing" evidence=RCA
GO:0009855 "determination of bilateral symmetry" evidence=RCA
GO:0009886 "post-embryonic morphogenesis" evidence=RCA
GO:0009887 "organ morphogenesis" evidence=RCA
GO:0009909 "regulation of flower development" evidence=RCA
GO:0009944 "polarity specification of adaxial/abaxial axis" evidence=RCA
GO:0010014 "meristem initiation" evidence=RCA
GO:0010267 "production of ta-siRNAs involved in RNA interference" evidence=RCA
GO:0016246 "RNA interference" evidence=RCA
GO:0035196 "production of miRNAs involved in gene silencing by miRNA" evidence=RCA
GO:0048438 "floral whorl development" evidence=RCA
GO:0048439 "flower morphogenesis" evidence=RCA
GO:0048481 "ovule development" evidence=RCA
GO:0048507 "meristem development" evidence=RCA
GO:0048513 "organ development" evidence=RCA
GO:0048519 "negative regulation of biological process" evidence=RCA
TAIR|locus:2039250 BLH1 "AT2G35940" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2049035 BLH4 "BEL1-like homeodomain 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2115000 BLH2 "AT4G36870" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2177856 BEL1 "AT5G41410" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2018398 BLH3 "AT1G75410" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2139614 BLH6 "AT4G34610" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2013154 BEL10 "AT1G19700" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2042609 BLH7 "AT2G16400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2057856 BLH8 "AT2G27990" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00024567001
SubName- Full=Chromosome chr6 scaffold_3, whole genome shotgun sequence; (811 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query840
pfam07526139 pfam07526, POX, Associated with HOX 1e-40
smart00574140 smart00574, POX, domain associated with HOX domain 7e-38
pfam0592040 pfam05920, Homeobox_KN, Homeobox KN domain 3e-20
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 2e-11
smart0038957 smart00389, HOX, Homeodomain 5e-09
pfam0004657 pfam00046, Homeobox, Homeobox domain 2e-04
>gnl|CDD|219452 pfam07526, POX, Associated with HOX Back     alignment and domain information 
 Score =  145 bits (369), Expect = 1e-40
 Identities = 62/162 (38%), Positives = 91/162 (56%), Gaps = 26/162 (16%)

Query: 400 ILKNSRFLKPAQELLDEFCCVKKSKYGRRGNVSERFSGDRASASASAEADAADVADREVG 459
           +L+ S++LKPAQELL+EFC V K+K     + +   +G  +S ++S +           G
Sbjct: 2   VLRGSKYLKPAQELLEEFCSVGKNKALDDDSSNGAENGANSSGASSGD-----------G 50

Query: 460 AKGKNSTSRVSSPTFYSSNQISCEGGVGSSSGESHRPEYQEMRAKLLYLQEEVSKRYKLY 519
                  S  SS    S+ +               R E Q  +AKLL + EEV +RY+ Y
Sbjct: 51  GGSSAGDSSDSSSPELSTAE---------------RQELQRKKAKLLSMLEEVDRRYRQY 95

Query: 520 HQQLQMVVSSFESVAGLSGATPYVSLAFKAISKNFRCLKSAI 561
           + Q+QMV+SSFE+VAGL  A PY +LA +A+S++FRCL+ AI
Sbjct: 96  YDQMQMVISSFEAVAGLGAAKPYTALALQAMSRHFRCLRDAI 137

The function of this domain is unknown. It is often found in plant proteins associated with pfam00046. Length = 139
>gnl|CDD|214728 smart00574, POX, domain associated with HOX domains Back     alignment and domain information
>gnl|CDD|203350 pfam05920, Homeobox_KN, Homeobox KN domain Back     alignment and domain information
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 840
PF07526140 POX: Associated with HOX; InterPro: IPR006563 This 100.0
smart00574140 POX domain associated with HOX domains. 100.0
KOG0773342 consensus Transcription factor MEIS1 and related H 100.0
KOG0774334 consensus Transcription factor PBX and related HOX 99.81
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 99.56
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.31
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.27
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.25
KOG0775304 consensus Transcription factor SIX and related HOX 99.13
KOG0487308 consensus Transcription factor Abd-B, contains HOX 98.71
KOG0842307 consensus Transcription factor tinman/NKX2-3, cont 98.66
KOG0489261 consensus Transcription factor zerknullt and relat 98.56
KOG0843197 consensus Transcription factor EMX1 and related HO 98.56
KOG0493342 consensus Transcription factor Engrailed, contains 98.56
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 98.5
KOG0488309 consensus Transcription factor BarH and related HO 98.49
KOG0483198 consensus Transcription factor HEX, contains HOX a 98.47
KOG0850245 consensus Transcription factor DLX and related pro 98.46
KOG0485268 consensus Transcription factor NKX-5.1/HMX1, conta 98.39
KOG3802398 consensus Transcription factor OCT-1, contains POU 98.26
KOG0484125 consensus Transcription factor PHOX2/ARIX, contain 98.26
KOG0492246 consensus Transcription factor MSH, contains HOX d 98.16
KOG4577383 consensus Transcription factor LIM3, contains LIM 98.15
KOG2251228 consensus Homeobox transcription factor [Transcrip 98.13
COG5576156 Homeodomain-containing transcription factor [Trans 98.12
KOG0848317 consensus Transcription factor Caudal, contains HO 98.1
KOG0486351 consensus Transcription factor PTX1, contains HOX 97.96
KOG0494332 consensus Transcription factor CHX10 and related H 97.93
KOG0491194 consensus Transcription factor BSH, contains HOX d 97.76
KOG2252558 consensus CCAAT displacement protein and related h 97.72
KOG0847288 consensus Transcription factor, contains HOX domai 97.71
KOG0844408 consensus Transcription factor EVX1, contains HOX 97.38
KOG0773342 consensus Transcription factor MEIS1 and related H 97.33
KOG0849354 consensus Transcription factor PRD and related pro 97.28
KOG0490235 consensus Transcription factor, contains HOX domai 97.15
KOG1168385 consensus Transcription factor ACJ6/BRN-3, contain 96.96
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 95.61
KOG0490235 consensus Transcription factor, contains HOX domai 93.48
PF03792191 PBC: PBC domain; InterPro: IPR005542 Pbx proteins 92.92
KOG1146 1406 consensus Homeobox protein [General function predi 85.01
>PF07526 POX: Associated with HOX; InterPro: IPR006563 This domain in found exclusively in plant proteins, associated with HOX domains which may suggest these proteins are homeodomain transcription factors Back     alignment and domain information 
Probab=100.00  E-value=9.7e-41  Score=319.69  Aligned_cols=140  Identities=43%  Similarity=0.659  Sum_probs=99.3

Q ss_pred             hhhccCcccchHHHHHHHhhhccccccCCCCCcccccccccccccchhhhhhhcchhcccccCCCCCCCccCCCcccCCc
Q 048159          399 TILKNSRFLKPAQELLDEFCCVKKSKYGRRGNVSERFSGDRASASASAEADAADVADREVGAKGKNSTSRVSSPTFYSSN  478 (840)
Q Consensus       399 ~vL~~SRyLkpAQqLLdE~c~V~~~~~~~~~~~~~r~~~~~~~~s~~s~~d~~~~ad~e~G~~~~~~~s~~sss~~~~s~  478 (840)
                      .+|++|||||||||||||||+|++........       .....    . +..+....             .+.....++
T Consensus         1 q~l~~SryLk~aQeLL~E~~~v~~~~~~~~~~-------~~~~~----~-~~~~~~~~-------------~~~~~~~~~   55 (140)
T PF07526_consen    1 QVLLGSRYLKPAQELLDEFCSVGGANKKKSDD-------SSSGA----P-GGANSSGS-------------SSSSGGSSS   55 (140)
T ss_pred             CccccchhHHHHHHHHHHHHcccchhhhcchh-------hcccc----c-cccccCCC-------------CCCCCCCCC
Confidence            47999999999999999999998741111000       00000    0 00000000             000000011


Q ss_pred             ccccCCCCCCCCCCCChHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhccCCCCCchhHHHHHHHHHhhhhHHH
Q 048159          479 QISCEGGVGSSSGESHRPEYQEMRAKLLYLQEEVSKRYKLYHQQLQMVVSSFESVAGLSGATPYVSLAFKAISKNFRCLK  558 (840)
Q Consensus       479 ~~~~d~g~~ss~~~~~~~E~Q~kKaKLl~MLeEVdrRY~qY~~qmq~VvsSFe~vaG~gaA~pYt~lAlKamSRhFr~Lr  558 (840)
                      ...+..+...+.+..+++|+|+||+|||.||||||+||+|||+|||+|+++||+|||+|+|+|||+||+|||||||||||
T Consensus        56 ~~~~~~~~~~~ls~~~~~e~q~kK~KLl~mL~eVd~RY~qY~~Qmq~VvssFe~vaG~gaA~~YtalAlqamSrhFR~LR  135 (140)
T PF07526_consen   56 SSSSSDSSSPELSPAERQELQRKKAKLLSMLDEVDRRYRQYYDQMQAVVSSFEAVAGLGAAAPYTALALQAMSRHFRCLR  135 (140)
T ss_pred             CccccCCCCCCCChhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCcchhhHHHHHHHHHHHHHHHH
Confidence            11111122334567889999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHH
Q 048159          559 SAIMN  563 (840)
Q Consensus       559 naI~~  563 (840)
                      ++|.+
T Consensus       136 daI~~  140 (140)
T PF07526_consen  136 DAISD  140 (140)
T ss_pred             HHhcC
Confidence            99963

>smart00574 POX domain associated with HOX domains Back     alignment and domain information
>KOG0773 consensus Transcription factor MEIS1 and related HOX domain proteins [Transcription] Back     alignment and domain information
>KOG0774 consensus Transcription factor PBX and related HOX domain proteins [Transcription] Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG0775 consensus Transcription factor SIX and related HOX domain proteins [Transcription] Back     alignment and domain information
>KOG0487 consensus Transcription factor Abd-B, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0842 consensus Transcription factor tinman/NKX2-3, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0489 consensus Transcription factor zerknullt and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>KOG0843 consensus Transcription factor EMX1 and related HOX domain proteins [Transcription] Back     alignment and domain information
>KOG0493 consensus Transcription factor Engrailed, contains HOX domain [General function prediction only] Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>KOG0488 consensus Transcription factor BarH and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>KOG0483 consensus Transcription factor HEX, contains HOX and HALZ domains [Transcription] Back     alignment and domain information
>KOG0850 consensus Transcription factor DLX and related proteins with LIM Zn-binding and HOX domains [Transcription] Back     alignment and domain information
>KOG0485 consensus Transcription factor NKX-5 Back     alignment and domain information
>KOG3802 consensus Transcription factor OCT-1, contains POU and HOX domains [Transcription] Back     alignment and domain information
>KOG0484 consensus Transcription factor PHOX2/ARIX, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0492 consensus Transcription factor MSH, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG4577 consensus Transcription factor LIM3, contains LIM and HOX domains [Transcription] Back     alignment and domain information
>KOG2251 consensus Homeobox transcription factor [Transcription] Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG0848 consensus Transcription factor Caudal, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0486 consensus Transcription factor PTX1, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0494 consensus Transcription factor CHX10 and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>KOG0491 consensus Transcription factor BSH, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG2252 consensus CCAAT displacement protein and related homeoproteins [Transcription] Back     alignment and domain information
>KOG0847 consensus Transcription factor, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0844 consensus Transcription factor EVX1, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0773 consensus Transcription factor MEIS1 and related HOX domain proteins [Transcription] Back     alignment and domain information
>KOG0849 consensus Transcription factor PRD and related proteins, contain PAX and HOX domains [Transcription] Back     alignment and domain information
>KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG1168 consensus Transcription factor ACJ6/BRN-3, contains POU and HOX domains [Transcription] Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] Back     alignment and domain information
>PF03792 PBC: PBC domain; InterPro: IPR005542 Pbx proteins are members of the TALE (three-amino-acid loop extension) family of atypical homeodomain proteins, whose members are characterised by a three-residue insertion in the first helix of the homeodomain involved in their interaction with Hox proteins Back     alignment and domain information
>KOG1146 consensus Homeobox protein [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query840
1x2n_A73 Solution Structure Of The Homeobox Domain Of Human 3e-12
3k2a_A67 Crystal Structure Of The Homeobox Domain Of Human H 4e-12
2dmn_A83 The Solution Structure Of The Homeobox Domain Of Hu 5e-11
2lk2_A89 Solution Nmr Structure Of Homeobox Domain (171-248) 3e-10
1du6_A64 Solution Structure Of The Truncated Pbx Homeodomain 1e-06
1lfu_P82 Nmr Solution Stucture Of The Extended Pbx Homeodoma 2e-06
1puf_B73 Crystal Structure Of Hoxa9 And Pbx1 Homeodomains Bo 2e-06
1b72_B87 Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Le 4e-06
1b8i_B63 Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX 5e-06
4egc_A559 Crystal Structure Of Mbp-fused Human Six1 Bound To 1e-04
>pdb|1X2N|A Chain A, Solution Structure Of The Homeobox Domain Of Human Homeobox Protein Pknox1 Length = 73 Back     alignment and structure 
Iteration: 1

 Score = 70.9 bits (172), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 30/56 (53%), Positives = 42/56 (75%), Gaps = 1/56 (1%)
Query: 627 QRG-LPERAVAILRAWLFEHFLHPYPTDTDKHMLATQTGLSRNQVSNWFINARVRV 681
           +RG LP+ A  ++R+WLF+H  HPYPT+ +K  +A QT L+  QV+NWFINAR R+
Sbjct: 10  KRGVLPKHATNVMRSWLFQHIGHPYPTEDEKKQIAAQTNLTLLQVNNWFINARRRI 65
>pdb|3K2A|A Chain A, Crystal Structure Of The Homeobox Domain Of Human Homeobox Protein Meis2 Length = 67 Back     alignment and structure
>pdb|2DMN|A Chain A, The Solution Structure Of The Homeobox Domain Of Human Homeobox Protein Tgif2lx Length = 83 Back     alignment and structure
>pdb|2LK2|A Chain A, Solution Nmr Structure Of Homeobox Domain (171-248) Of Human Homeobox Protein Tgif1, Northeast Structural Genomics Consortium Target Hr4411b Length = 89 Back     alignment and structure
>pdb|1DU6|A Chain A, Solution Structure Of The Truncated Pbx Homeodomain Length = 64 Back     alignment and structure
>pdb|1LFU|P Chain P, Nmr Solution Stucture Of The Extended Pbx Homeodomain Bound To Dna Length = 82 Back     alignment and structure
>pdb|1PUF|B Chain B, Crystal Structure Of Hoxa9 And Pbx1 Homeodomains Bound To Dna Length = 73 Back     alignment and structure
>pdb|1B72|B Chain B, Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Length = 87 Back     alignment and structure
>pdb|1B8I|B Chain B, Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX Length = 63 Back     alignment and structure
>pdb|4EGC|A Chain A, Crystal Structure Of Mbp-fused Human Six1 Bound To Human Eya2 Eya Domain Length = 559 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query840
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 3e-35
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 7e-35
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 6e-34
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 1e-33
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 6e-33
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 6e-33
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 3e-30
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 5e-27
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 8e-27
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 1e-25
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 4e-07
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 7e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 2e-06
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 2e-06
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 5e-06
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 7e-06
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 2e-05
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 4e-05
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 5e-05
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 2e-04
1e3o_C160 Octamer-binding transcription factor 1; transcript 4e-04
3d1n_I151 POU domain, class 6, transcription factor 1; prote 7e-04
2xsd_C164 POU domain, class 3, transcription factor 1; trans 7e-04
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Length = 89 Back     alignment and structure
 Score =  127 bits (322), Expect = 3e-35
 Identities = 30/69 (43%), Positives = 42/69 (60%)

Query: 620 QQHVWRPQRGLPERAVAILRAWLFEHFLHPYPTDTDKHMLATQTGLSRNQVSNWFINARV 679
             H       LP+ +V ILR WL+EH  + YP++ +K +L+ QT LS  QV NWFINAR 
Sbjct: 2   GHHHHHHSHMLPKESVQILRDWLYEHRYNAYPSEQEKALLSQQTHLSTLQVCNWFINARR 61

Query: 680 RVWKPMVEE 688
           R+   M+ +
Sbjct: 62  RLLPDMLRK 70
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Length = 87 Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Length = 73 Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} Length = 67 Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Length = 83 Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Length = 87 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 76 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query840
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.71
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 99.69
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.66
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.66
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.61
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.59
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.58
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.56
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.56
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.54
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.41
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.39
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.37
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.35
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.34
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.33
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.33
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.32
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.32
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.32
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.32
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.32
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.32
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.32
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.31
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.31
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.3
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.3
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.3
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.3
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.29
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.29
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.28
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.27
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.27
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.26
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.25
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.25
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.25
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.25
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.25
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.24
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.24
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.24
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.23
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.22
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.22
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.19
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.19
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.19
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.19
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.18
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.18
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.18
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.17
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.17
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.17
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.17
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.16
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.15
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.14
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.09
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.07
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.06
2e19_A64 Transcription factor 8; homeobox domain, structura 99.04
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.03
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.01
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.01
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.01
1lfb_A99 Liver transcription factor (LFB1); transcription r 98.98
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 98.96
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 98.91
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 98.86
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 98.82
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 98.76
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 98.69
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 98.55
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 95.61
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 90.2
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
Probab=99.71  E-value=4.6e-18  Score=148.09  Aligned_cols=69  Identities=39%  Similarity=0.744  Sum_probs=63.6

Q ss_pred             CcCCCCCCCChHHHHHHHHHHHHccCCCCCCHHHHHHHHHHhCCChhhHhhccchhhhhccchhhHHhh
Q 048159          622 HVWRPQRGLPERAVAILRAWLFEHFLHPYPTDTDKHMLATQTGLSRNQVSNWFINARVRVWKPMVEEIH  690 (840)
Q Consensus       622 ~~kRkrR~Lpk~av~iLr~WL~eH~~nPYPS~eEK~~LA~qTGLS~kQVsNWFiNaRrRlkKpmiee~~  690 (840)
                      .++|+|+.|+++++.+|++||.+|..+|||+.++|..||.+|||+..||++||+|+|+|.|++++++..
T Consensus         6 ~~rk~R~~~s~~q~~~L~~~f~~~~~~pYPs~~~r~~LA~~~gLs~~qV~~WFqNrR~r~k~~~~~~~~   74 (83)
T 2dmn_A            6 SGKKRKGNLPAESVKILRDWMYKHRFKAYPSEEEKQMLSEKTNLSLLQISNWFINARRRILPDMLQQRR   74 (83)
T ss_dssp             CCCCCCSSCCHHHHHHHHHHHHHTTTTCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHTHHHHTCCCC
T ss_pred             CCCCCCCcCCHHHHHHHHHHHHHhccCCCCCHHHHHHHHHHHCcCHHHhhHHhhhhHhhhcHHHHHhcc
Confidence            456677779999999999999999999999999999999999999999999999999999999887643
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 840
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 2e-18
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 2e-16
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 2e-15
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5e-08
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 1e-06
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 2e-06
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 1e-05
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 3e-05
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 1e-04
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 2e-04
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 2e-04
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 2e-04
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 4e-04
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 4e-04
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 6e-04
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 7e-04
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 8e-04
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 0.001
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 0.001
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 0.001
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 0.002
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 0.003
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 0.003
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 0.003
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 0.004
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein pknox1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 77.9 bits (192), Expect = 2e-18
 Identities = 30/58 (51%), Positives = 43/58 (74%), Gaps = 1/58 (1%)

Query: 625 RPQRG-LPERAVAILRAWLFEHFLHPYPTDTDKHMLATQTGLSRNQVSNWFINARVRV 681
           + +RG LP+ A  ++R+WLF+H  HPYPT+ +K  +A QT L+  QV+NWFINAR R+
Sbjct: 3   KNKRGVLPKHATNVMRSWLFQHIGHPYPTEDEKKQIAAQTNLTLLQVNNWFINARRRI 60
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query840
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.71
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.7
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.64
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.4
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.38
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.37
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.37
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.37
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.37
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.35
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.35
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.35
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.34
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.34
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.33
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.33
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.32
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.31
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.31
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.3
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.29
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.28
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.27
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.27
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.26
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.23
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.2
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.17
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.17
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.15
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.1
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.01
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein pknox1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.71  E-value=3.6e-18  Score=140.74  Aligned_cols=59  Identities=47%  Similarity=0.867  Sum_probs=55.7

Q ss_pred             CCCCCCCChHHHHHHHHHHHHccCCCCCCHHHHHHHHHHhCCChhhHhhccchhhhhcc
Q 048159          624 WRPQRGLPERAVAILRAWLFEHFLHPYPTDTDKHMLATQTGLSRNQVSNWFINARVRVW  682 (840)
Q Consensus       624 kRkrR~Lpk~av~iLr~WL~eH~~nPYPS~eEK~~LA~qTGLS~kQVsNWFiNaRrRlk  682 (840)
                      +|+|..||++++.+|++||.+|..||||+.+||.+||.+|||+.+||.|||+|+|+|+.
T Consensus         3 krkR~~~~~~~~~iL~~wf~~~~~nPyPs~~e~~~La~~~~l~~~qI~~WF~N~R~R~l   61 (62)
T d1x2na1           3 KNKRGVLPKHATNVMRSWLFQHIGHPYPTEDEKKQIAAQTNLTLLQVNNWFINARRRIL   61 (62)
T ss_dssp             CCSSCCCCHHHHHHHHHHHHHTTTSCCCCHHHHHHHHHHHTCCHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCHHHHHHHHHHHHHhccCCCcCHHHHHHHHHHHCcCHHHhHHHHHHHHHHhc
Confidence            45566799999999999999999999999999999999999999999999999999975
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure