Citrus Sinensis ID: 048172

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16

MELEITELRLGLPGRDGCDSGLNSSSNNNKNEKKRAFSDICDEANYETNGERKINPTKSQVVGWPPVCSYRRKNSFNEKDRVESSKMYVKVSMDGAPFLRKIDLGMHQGYPDLAMALEKLFGCFGLSEALKDADSSEFVPIYEDKDGDWMLAGDVPWE

cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEECccccccEEECccccccHHHHHHHHHHHHHccccccccccccccccccEEEcccccEEEccccccc

MELEITELRLGL************************************************VVGWPPVCSYR***************MYVKVSMDGAPFLRKIDLGMHQGYPDLAMALEKLFGCFGLSEALKDADSSEFVPIYEDKDGDWMLAGDVPW*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MELEITELRLGLPGRDGCDSGLNSSSNNNKNEKKRAFSDICDEANYETNGERKINPTKSQVVGWPPVCSYRRKNSFNEKDRVESSKMYVKVSMDGAPFLRKIDLGMHQGYPDLAMALEKLFGCFGLSEALKDADSSEFVPIYEDKDGDWMLAGDVPWE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Auxin-responsive protein IAA19	Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations. Repression is thought to result from the interaction with auxin response factors (ARFs), proteins that bind to the auxin-responsive promoter element (AuxRE). Formation of heterodimers with ARF proteins may alter their ability to modulate early auxin response genes expression.	probable	O24409
Auxin-induced protein AUX22	Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations. Repression is thought to result from the interaction with auxin response factors (ARFs), proteins that bind to the auxin-responsive promoter element (AuxRE). Formation of heterodimers with ARF proteins may alter their ability to modulate early auxin response genes expression.	probable	P13088

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1Q1O, chain A
Confidence level:probable
Coverage over the Query: 86-154
View the alignment between query and template
View the model in PyMOL