Citrus Sinensis ID: 048197

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480

MASTSLLCLGLGFLILFHACFAQIAQGTDATREQRQQQQRFQTQCNIQDLNALEPQQRVESEAGVTEFWDQNDEQLQCANVAVFRHRIQQRGLVVPSYTNTPELFYVVQGRGIHGAVFPGCPETYQESQQRSSESQSRSQDQHQKVRQIREGDLVALPTGSANWIYNDGPSELVVVALVDVGNSDNQLDQFLRKFYLGGNPQPQLQGYSQSQGSRYQGSQGGEGGDRSRRGGNLFRGFDERLLAEAFNVNPDLISKLQRPQMQKGIIVRVEEELRVLSPQRGREQEQEQEQEFQGSGDNGIEETICTMKLKHNINDPSGADAYNPRGGRVTTVNRFNLPILRYIQLSAEKGNLYQNAMMAPHWNLNAHSVVYITRGNGRMQIVAENGENVFDGQIREGQLIVVPQGFAVVKRASNRGLEWISFKTNDVAKTSQLAGRASVIRGLPLDVIQNSFQVSRDEAQRLKYNRQELTVFTPGPRSQ

ccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHcccccccccccccccccccEEEccccEEEEEcccccccccccEEEEEEEEEcccccccccccccCEEEEEEcCEEEEEEcccccccccccccccccccccccccccEEEEcccccEEEcccccEEEEECcccccEEEEEEEEccccccccccEEEEEEEccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccHHHHHHHccccccccEEEEEccHHHHccccccccHHHHHHHHcccccccccHHHHHHHccccccccccccccccccccEEEEEccccccccccccccEEEEEEcccccccccccccccEEEEEEEEEEEEEEEEccccEEEEEEEcccCEEEEccccEEEEEEccccCEEEEEEEccccccccccccccccccccHHHHHHHccccHHHHHHHHHcccccEEEccccccc

****SLLCLGLGFLILFHACFAQIAQ**************************LEPQQRVESEAGVTEFWDQNDEQLQCANVAVFRHRIQQRGLVVPSYTNTPELFYVVQGRGIHGAVFPGCP**************************IREGDLVALPTGSANWIYNDGPSELVVVALVDVGNSDNQLDQFLRKFYLGGNP********************************LFRGFDERLLAEAFNVNPDLISKLQ***MQKGIIVRVE********************************TICTMKLKHNINDPSGADAYNPRGGRVTTVNRFNLPILRYIQLSAEKGNLYQNAMMAPHWNLNAHSVVYITRGNGRMQIVAENGENVFDGQIREGQLIVVPQGFAVVKRASNRGLEWISFKTNDVAKTSQLAGRASVIRGLPLDVIQNSFQVSRDEAQRLKYNRQ************

xxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Glutelin type-A 1	Seed storage protein.	probable	P07728
Glycinin G3	Glycinin is the major seed storage protein of soybean.	probable	P11828
12S seed storage protein CRU4	Seed storage protein.	probable	P15455

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3C3V, chain A
Confidence level:very confident
Coverage over the Query: 38-206,228-282,304-475
View the alignment between query and template
View the model in PyMOL