Citrus Sinensis ID: 048197

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480
MASTSLLCLGLGFLILFHACFAQIAQGTDATREQRQQQQRFQTQCNIQDLNALEPQQRVESEAGVTEFWDQNDEQLQCANVAVFRHRIQQRGLVVPSYTNTPELFYVVQGRGIHGAVFPGCPETYQESQQRSSESQSRSQDQHQKVRQIREGDLVALPTGSANWIYNDGPSELVVVALVDVGNSDNQLDQFLRKFYLGGNPQPQLQGYSQSQGSRYQGSQGGEGGDRSRRGGNLFRGFDERLLAEAFNVNPDLISKLQRPQMQKGIIVRVEEELRVLSPQRGREQEQEQEQEFQGSGDNGIEETICTMKLKHNINDPSGADAYNPRGGRVTTVNRFNLPILRYIQLSAEKGNLYQNAMMAPHWNLNAHSVVYITRGNGRMQIVAENGENVFDGQIREGQLIVVPQGFAVVKRASNRGLEWISFKTNDVAKTSQLAGRASVIRGLPLDVIQNSFQVSRDEAQRLKYNRQELTVFTPGPRSQ
ccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHcccccccccccccccccccEEEccccEEEEEcccccccccccEEEEEEEEEcccccccccccccEEEEEEEcEEEEEEEcccccccccccccccccccccccccccEEEEcccccEEEcccccEEEEEEcccccEEEEEEEEccccccccccEEEEEEEccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccHHHHHHHccccccccEEEEEccHHHHcccccccHHHHHHHHHHccccccccHHHHHHHccccccccccccccccccccEEEEEccccccccccccccEEEEEEcccccccccccccccEEEEEEEEEEEEEEEEccccEEEEEEEcccEEEEEccccEEEEEEccccEEEEEEEEccccccccccccccccccccHHHHHHHccccHHHHHHHHHcccccEEEccccccc
cccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHccccccccccEEEccccEEEEEcccccHHHHccEEEEEEEEcccccccccccccccEEEEEEccEEEEEEccccccHccccccccccccccccccccEEEEEccccEEEEcccEEEEEEccccccEEEEEEEEcccccccccccccEEEEEcccccHcccccccccccccccccccccccccccccEEccccHHHHHHHHcccHHHHHHHHccccccccEEEEccccEEccccccccccHHHHccccccccccccccHccEEEccccccccccccccccccEEEEEccccccHHHHEcccEEEEEEccccEEcccccccccEEEEEEEccEEEEEEcccccEEEcccEccccEEEEcccEEEEEEEcccccEEEEEEEccccccccccccHHHHHcccHHHHHHHHcccHHHHHHHHHcccccEEEccccccc
MASTSLLCLGLGFLILFHACFAQIAQGTDATREQRQQQQRFQTqcniqdlnalepqqrveseagvtefwdqndEQLQCANVAVFRHRIQqrglvvpsytntpeLFYVVQGrgihgavfpgcpetyqesqqrssesqsrsQDQHQKVRQIRegdlvalptgsanwiyndgpsELVVVALVDVGNSDNQLDQFLRKfylggnpqpqlqgysqsqgsryqgsqggeggdrsrrggnlfrgFDERLLAEAFNvnpdlisklqrpqmqKGIIVRVEEELrvlspqrgreqEQEQEQEfqgsgdngiEETICTMKLkhnindpsgadaynprggrvttvnrfnlPILRYIQLSAEKGNlyqnammaphwnlnAHSVVYITRGNGRMQIVAengenvfdgqiregqlivvpQGFAVVKRASnrglewisfkTNDVAKTSQLAGRASVIRGLPLDVIQNSFQVSRDEAQRLKYNrqeltvftpgprsq
MASTSLLCLGLGFLILFHACFAQIAQGTDATREQRQQQQRFQTQCNIQDLNALEPQQRVESEAGVTEFWDQNDEQLQCANVAVFRHRIQQrglvvpsytNTPELFYVVQGRGIHGAVFPGCPETYQESQQRSsesqsrsqdqhQKVRQIREGDLVALPTGSANWIYNDGPSELVVVALVDVGNSDNQLDQFLRKFYLGGNPQPQLQGYSQSQGSRYQGsqggeggdrsrrGGNLFRGFDERLLAEAFNVNpdlisklqrpqmQKGIIVRVEEELRVLSpqrgreqeqeqeqefqgsgdngIEETICTMKLKHNINDPSGADAYNPRGGRVTTVNRFNLPILRYIQLSAEKGNLYQNAMMAPHWNLNAHSVVYITRGNGRMQIVAENGENVFDGQIREGQLIVVPQGFAVVKRASNRGLEWISFKTNDVAKTSQLAGRASVIRGLPLDVIQNSFQVSRDEAQRlkynrqeltvftpgprsq
MASTSllclglgflilfHACFAQIAQGTDATreqrqqqqrfqtqCNIQDLNALEPQQRVESEAGVTEFWDQNDEQLQCANVAVFRHRIQQRGLVVPSYTNTPELFYVVQGRGIHGAVFPGCPETYqesqqrssesqsrsqdqHQKVRQIREGDLVALPTGSANWIYNDGPSELVVVALVDVGNSDNQLDQFLRKFYLGGNPQPQLqgysqsqgsryqgsqggeggdrsrrggNLFRGFDERLLAEAFNVNPDLISKLQRPQMQKGIIVRVEEELRVLSPQRGReqeqeqeqefqGSGDNGIEETICTMKLKHNINDPSGADAYNPRGGRVTTVNRFNLPILRYIQLSAEKGNLYQNAMMAPHWNLNAHSVVYITRGNGRMQIVAENGENVFDGQIREGQLIVVPQGFAVVKRASNRGLEWISFKTNDVAKTSQLAGRASVIRGLPLDVIQNSFQVSRDEAQRLKYNRQELTVFTPGPRSQ
*****LLCLGLGFLILFHACFAQIAQ*************************************GVTEFWDQNDEQLQCANVAVFRHRIQQRGLVVPSYTNTPELFYVVQGRGIHGAVFPGCP*****************************GDLVALPTGSANWIYNDGPSELVVVALVDVGNSDNQLDQFLRKFYLG***********************************LFRGFDERLLAEAFNVNPDLISKLQ***MQKGIIVRVE********************************TICTMKLKH**********YNPRGGRVTTVNRFNLPILRYIQLSAEKGNLYQNAMMAPHWNLNAHSVVYITRGNGRMQIVAENGENVFDGQIREGQLIVVPQGFAVVKRASNRGLEWISFKTNDVAKTSQLAGRASVIRGLPLDVIQNSFQV*************************
****SLLCLGLGFLILFHACFA******************************LEPQQRVESEAGVTEFWDQNDEQLQCANVAVFRHRIQQRGLVVPSYTNTPELFYVVQGRGIHGAVFPGC***************************IREGDLVALPTGSANWIYNDGPSELVVVALVDVGNSDNQLDQFLRKFYLGGNP*********************************FRGFDERLLAEAFNVNPDL*******************************************************KLKHNINDPSGADAYNPRGGRVTTVNRFNLPILRYIQLSAEKGNLYQNAMMAPHWNLNAHSVVYITRGNGRMQIVAENGENVFDGQIREGQLIVVPQGFAVVKRASNRGLEWISFKTNDVAKTSQLAGRASVIRGLPLDVIQNSFQVSRDEAQRLKYNRQ************
MASTSLLCLGLGFLILFHACFAQIAQ****************TQCNIQDLNALEPQQRVESEAGVTEFWDQNDEQLQCANVAVFRHRIQQRGLVVPSYTNTPELFYVVQGRGIHGAVFPGCPE************************QIREGDLVALPTGSANWIYNDGPSELVVVALVDVGNSDNQLDQFLRKFYLGGNPQPQL**********************SRRGGNLFRGFDERLLAEAFNVNPDLISKLQRPQMQKGIIVRVEEELRVL********************DNGIEETICTMKLKHNINDPSGADAYNPRGGRVTTVNRFNLPILRYIQLSAEKGNLYQNAMMAPHWNLNAHSVVYITRGNGRMQIVAENGENVFDGQIREGQLIVVPQGFAVVKRASNRGLEWISFKTNDVAKTSQLAGRASVIRGLPLDVIQNSFQVSRDEAQRLKYNRQELTV********
**STSLLCLGLGFLILFHACFAQIAQG*****************CNIQDLNALEPQQRVESEAGVTEFWDQNDEQLQCANVAVFRHRIQQRGLVVPSYTNTPELFYVVQGRGIHGAVFPGCPETYQ****************HQKVRQIREGDLVALPTGSANWIYNDGPSELVVVALVDVGNSDNQLDQFLRKFYLGGNP******************************GNLFRGFDERLLAEAFNVNPDLISKLQRPQMQKGIIVRVEEELRVLSPQ*****************DNGIEETICTMKLKHNINDPSGADAYNPRGGRVTTVNRFNLPILRYIQLSAEKGNLYQNAMMAPHWNLNAHSVVYITRGNGRMQIVAENGENVFDGQIREGQLIVVPQGFAVVKRASNRGLEWISFKTNDVAKTSQLAGRASVIRGLPLDVIQNSFQVSRDEAQRLKYNRQELTVFT******
iiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASTSLLCLGLGFLILFHACFAQIAQGTDATREQRQQQQRFQTQCNIQDLNALEPQQRVESEAGVTEFWDQNDEQLQCANVAVFRHRIQQRGLVVPSYTNTPELFYVVQGRGIHGAVFPGCPETYQESQQRSSESQSRSQDQHQKVRQIREGDLVALPTGSANWIYNDGPSELVVVALVDVGNSDNQLDQFLRKFYLGGNPQPQLQGYSQSQGSRYQGSQGGEGGDRSRRGGNLFRGFDERLLAEAFNVNPDLISKLQRPQMQKGIIVRVEEELRVLSPQRGREQEQEQEQEFQGSGDNGIEETICTMKLKHNINDPSGADAYNPRGGRVTTVNRFNLPILRYIQLSAEKGNLYQNAMMAPHWNLNAHSVVYITRGNGRMQIVAENGENVFDGQIREGQLIVVPQGFAVVKRASNRGLEWISFKTNDVAKTSQLAGRASVIRGLPLDVIQNSFQVSRDEAQRLKYNRQELTVFTPGPRSQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query480 2.2.26 [Sep-21-2011]
P09800516 Legumin B OS=Gossypium hi N/A no 0.995 0.926 0.518 1e-139
P13744480 11S globulin subunit beta N/A no 0.968 0.968 0.464 1e-126
P09802509 Legumin A OS=Gossypium hi N/A no 0.908 0.856 0.466 1e-118
P07728499 Glutelin type-A 1 OS=Oryz yes no 0.929 0.893 0.439 1e-110
P07730499 Glutelin type-A 2 OS=Oryz no no 0.929 0.893 0.432 1e-108
Q02498479 Cruciferin PGCRURSE5 OS=R N/A no 0.918 0.920 0.419 1e-105
Q6ERU3500 Glutelin type-B 5 OS=Oryz no no 0.956 0.918 0.419 1e-105
P14614500 Glutelin type-B 4 OS=Oryz no no 0.956 0.918 0.419 1e-105
Q09151496 Glutelin type-A 3 OS=Oryz no no 0.931 0.901 0.445 1e-104
P15455472 12S seed storage protein yes no 0.939 0.955 0.446 1e-104
>sp|P09800|LEGB_GOSHI Legumin B OS=Gossypium hirsutum GN=LEGB PE=2 SV=1 Back     alignment and function desciption
 Score =  494 bits (1271), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 268/517 (51%), Positives = 352/517 (68%), Gaps = 39/517 (7%)

Query: 1   MASTSLLCLGLGFLILFHACFAQIAQGTD-----ATREQRQQQQRFQTQCNIQDLNALEP 55
           MA TSLL   +  L+LFH C AQI   T+        + +Q Q R Q+QC +Q+LNAL+P
Sbjct: 1   MAYTSLLSFSVCLLVLFHGCCAQIDLVTNHHQDPPWGQPQQPQPRHQSQCQLQNLNALQP 60

Query: 56  QQRVESEAGVTEFWDQNDEQLQCANVAVFRHRIQQRGLVVPSYTNTPELFYVVQGRGIHG 115
           + R  SEAG TEFWDQN++Q QCA VA  RH+IQ++GL++PS+T+ P LFYV QG GIHG
Sbjct: 61  KHRFRSEAGETEFWDQNEDQFQCAGVAFLRHKIQRKGLLLPSFTSAPMLFYVEQGEGIHG 120

Query: 116 AVFPGCPETYQESQQRSSESQSRSQDQHQKVRQIREGDLVALPTGSANWIYNDGPSELVV 175
           AVFPGCPETYQ   Q++ + + + +DQHQK+R+++EGD+VALP G A+WI+N+G S+LV+
Sbjct: 121 AVFPGCPETYQSQSQQNIQDRPQ-RDQHQKLRRLKEGDVVALPAGVAHWIFNNGRSQLVL 179

Query: 176 VALVDVGNSDNQLDQFLRKFYLGGNPQPQLQGYSQSQG-----SRYQGSQGGEGGDRSRR 230
           VALVDVGN  NQLD+  RKF+L G+PQ  +    QS+      SR Q  +  E   +   
Sbjct: 180 VALVDVGNDANQLDENFRKFFLAGSPQGGVVRGGQSRDRNQRQSRTQRGEREEEESQESG 239

Query: 231 GGNLFRGFDERLLAEAFNVNPDLISKLQRPQMQKGIIVRVEEELR--------------- 275
           G N+  GF + LLA+AF ++  L  KLQ  +  +G IVR+E                   
Sbjct: 240 GNNVLSGFRDNLLAQAFGIDTRLARKLQNERDNRGAIVRMEHGFEWPEEGQRRQGREEEG 299

Query: 276 --VLSPQRGREQEQEQEQEFQGSGD----------NGIEETICTMKLKHNINDPSGADAY 323
                P+  R QE ++E   +   +          NG+EET C+M+LKH     S AD +
Sbjct: 300 EEEREPKWQRRQESQEEGSEEEEREERGRGRRRSGNGLEETFCSMRLKHR-TPASSADVF 358

Query: 324 NPRGGRVTTVNRFNLPILRYIQLSAEKGNLYQNAMMAPHWNLNAHSVVYITRGNGRMQIV 383
           NPRGGR+TTVN FNLPIL+Y+QLSAE+G LY NA+ APHWN+NAHS+VYITRGNGR+QIV
Sbjct: 359 NPRGGRITTVNSFNLPILQYLQLSAERGVLYNNAIYAPHWNMNAHSIVYITRGNGRIQIV 418

Query: 384 AENGENVFDGQIREGQLIVVPQGFAVVKRASNRGLEWISFKTNDVAKTSQLAGRASVIRG 443
           +ENGE +FD Q+  GQ+I VPQ  AVVK+A  RG EWI+FKTN  AK SQ+AGR S++RG
Sbjct: 419 SENGEAIFDEQVERGQVITVPQNHAVVKKAGRRGFEWIAFKTNANAKISQIAGRVSIMRG 478

Query: 444 LPLDVIQNSFQVSRDEAQRLKYNRQELTVFTPGPRSQ 480
           LP+DV+ NSF +SR+EA RLK+NRQE++VF+P   SQ
Sbjct: 479 LPVDVLANSFGISREEAMRLKHNRQEVSVFSPRQGSQ 515
This is a seed storage protein.
Gossypium hirsutum (taxid: 3635)
>sp|P13744|11SB_CUCMA 11S globulin subunit beta OS=Cucurbita maxima PE=1 SV=1 Back     alignment and function description
>sp|P09802|LEGA_GOSHI Legumin A OS=Gossypium hirsutum GN=LEGA PE=2 SV=2 Back     alignment and function description
>sp|P07728|GLUA1_ORYSJ Glutelin type-A 1 OS=Oryza sativa subsp. japonica GN=GLUA1 PE=1 SV=2 Back     alignment and function description
>sp|P07730|GLUA2_ORYSJ Glutelin type-A 2 OS=Oryza sativa subsp. japonica GN=GLUA2 PE=1 SV=1 Back     alignment and function description
>sp|Q02498|CRU1_RAPSA Cruciferin PGCRURSE5 OS=Raphanus sativus GN=CRURS PE=3 SV=1 Back     alignment and function description
>sp|Q6ERU3|GLUB5_ORYSJ Glutelin type-B 5 OS=Oryza sativa subsp. japonica GN=GLUB5 PE=2 SV=1 Back     alignment and function description
>sp|P14614|GLUB4_ORYSJ Glutelin type-B 4 OS=Oryza sativa subsp. japonica GN=GLUB4 PE=1 SV=1 Back     alignment and function description
>sp|Q09151|GLUA3_ORYSJ Glutelin type-A 3 OS=Oryza sativa subsp. japonica GN=GLUA3 PE=2 SV=2 Back     alignment and function description
>sp|P15455|CRU4_ARATH 12S seed storage protein CRU4 OS=Arabidopsis thaliana GN=CRU4 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query480
1061408486 citrin [Citrus sinensis] 0.983 0.971 0.75 0.0
110349085472 Pis v 2.0201 allergen 11S globulin precu 0.925 0.940 0.648 1e-166
156001070472 11S globulin [Pistacia vera] 0.925 0.940 0.646 1e-165
224126787493 predicted protein [Populus trichocarpa] 0.989 0.963 0.579 1e-160
224126783494 predicted protein [Populus trichocarpa] 0.991 0.963 0.569 1e-159
110349083496 Pis v 2.0101 allergen11S globulin precus 0.954 0.923 0.621 1e-152
224147821495 predicted protein [Populus trichocarpa] 1.0 0.969 0.549 1e-151
224126933465 predicted protein [Populus trichocarpa] 0.931 0.961 0.556 1e-144
255585552497 glutelin type-A 3 precursor, putative [R 0.943 0.911 0.534 1e-139
386278582498 glutelin type-A 3 precursor, partial [Ve 0.960 0.925 0.527 1e-138
>gi|1061408|gb|AAB52963.1| citrin [Citrus sinensis] Back     alignment and taxonomy information
 Score =  694 bits (1791), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/488 (75%), Positives = 407/488 (83%), Gaps = 16/488 (3%)

Query: 1   MASTSLLCLGLGFLILFHACFAQIAQGTDATREQRQQQQRFQTQ---CNIQDLNALEPQQ 57
           MAS+SLLC GL  L+LF+ACFAQI Q TD TRE +QQ+QR Q     CNIQ+LNALEP+Q
Sbjct: 1   MASSSLLCFGLCLLVLFNACFAQIEQVTDITREGKQQRQRQQRFQTQCNIQNLNALEPRQ 60

Query: 58  RVESEAGVTEFWDQNDEQLQCANVAVFRHRIQQRGLVVPSYTNTPELFYVVQGRGIHGAV 117
           +VESEAGVTEFWDQN+EQLQCANVAVFR RIQQRGL+VP+YTNTPE+FYVVQGRGIHG V
Sbjct: 61  KVESEAGVTEFWDQNNEQLQCANVAVFRQRIQQRGLLVPAYTNTPEIFYVVQGRGIHGVV 120

Query: 118 FPGCPETYQESQQRSSESQSRSQDQHQKVRQ----IREGDLVALPTGSANWIYNDGPSEL 173
           FPGC ET+Q+SQ   + S+SR+ +     ++    +R   L  L      +    G S L
Sbjct: 121 FPGCAETFQDSQ---ASSRSRAVNPKNNTKRSDNYVRVMSLHCLLEQLTGFTTMAGTS-L 176

Query: 174 VVVALVDVGNSDNQLDQFLRKFYLGGNPQPQLQGYSQSQGSRYQGSQGGEGGDRSRRGGN 233
                ++VGNS NQLDQ+ RKFYLGGNPQPQLQG+SQSQG R QGSQG + G    RGGN
Sbjct: 177 FWSPSLNVGNSQNQLDQYFRKFYLGGNPQPQLQGFSQSQGGRSQGSQGSDDG----RGGN 232

Query: 234 LFRGFDERLLAEAFNVNPDLISKLQRPQMQKGIIVRVEEELRVLSPQRGREQEQEQEQEF 293
           LFRGFDERLLAEAFNVNPDLI +LQRPQ+Q+GII+RVEEELRVLSPQR REQEQE+ +E 
Sbjct: 233 LFRGFDERLLAEAFNVNPDLIRRLQRPQIQRGIIIRVEEELRVLSPQRDREQEQEECEET 292

Query: 294 QG-SGDNGIEETICTMKLKHNINDPSGADAYNPRGGRVTTVNRFNLPILRYIQLSAEKGN 352
                DNG EETICTMKL+HNI+ PS AD YNPR GRVTTVNRFNLPILR +QLSAEKGN
Sbjct: 293 PSYERDNGFEETICTMKLRHNIDKPSHADVYNPRAGRVTTVNRFNLPILRDLQLSAEKGN 352

Query: 353 LYQNAMMAPHWNLNAHSVVYITRGNGRMQIVAENGENVFDGQIREGQLIVVPQGFAVVKR 412
           LY NA++AP WNLNAHS+VY+TRGNGRMQIVAENGENVFDGQIREGQLIVVPQGFAVVKR
Sbjct: 353 LYPNALLAPQWNLNAHSIVYVTRGNGRMQIVAENGENVFDGQIREGQLIVVPQGFAVVKR 412

Query: 413 ASNRGLEWISFKTNDVAKTSQLAGRASVIRGLPLDVIQNSFQVSRDEAQRLKYNRQELTV 472
           A NRGLEWISFKTNDVA TSQLAGRASV+RGLPLDVIQNSFQVSRDEAQRLKYNRQELTV
Sbjct: 413 AGNRGLEWISFKTNDVAMTSQLAGRASVLRGLPLDVIQNSFQVSRDEAQRLKYNRQELTV 472

Query: 473 FTPGPRSQ 480
           FTPGPRSQ
Sbjct: 473 FTPGPRSQ 480

Source: Citrus sinensis

Species: Citrus sinensis

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|110349085|gb|ABG73110.1| Pis v 2.0201 allergen 11S globulin precusor [Pistacia vera] Back     alignment and taxonomy information
>gi|156001070|gb|ABU42022.1| 11S globulin [Pistacia vera] Back     alignment and taxonomy information
>gi|224126787|ref|XP_002329473.1| predicted protein [Populus trichocarpa] gi|222870153|gb|EEF07284.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224126783|ref|XP_002329472.1| predicted protein [Populus trichocarpa] gi|222870152|gb|EEF07283.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|110349083|gb|ABG73109.1| Pis v 2.0101 allergen11S globulin precusor [Pistacia vera] Back     alignment and taxonomy information
>gi|224147821|ref|XP_002336547.1| predicted protein [Populus trichocarpa] gi|222835926|gb|EEE74347.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224126933|ref|XP_002329509.1| predicted protein [Populus trichocarpa] gi|222870189|gb|EEF07320.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255585552|ref|XP_002533466.1| glutelin type-A 3 precursor, putative [Ricinus communis] gi|223526681|gb|EEF28918.1| glutelin type-A 3 precursor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|386278582|gb|AFJ04523.1| glutelin type-A 3 precursor, partial [Vernicia fordii] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query480
UNIPROTKB|Q9M4Q7353 Q9M4Q7 "Seed storage protein" 0.7 0.951 0.527 5.5e-93
TAIR|locus:2167654472 CRA1 "CRUCIFERINA" [Arabidopsi 0.514 0.523 0.464 2.1e-92
TAIR|locus:2121308524 CRU3 "AT4G28520" [Arabidopsis 0.670 0.614 0.428 2.7e-90
TAIR|locus:2024234455 CRU2 "AT1G03880" [Arabidopsis 0.864 0.912 0.409 8.9e-86
UNIPROTKB|Q9XHP0459 Q9XHP0 "11S globulin seed stor 0.860 0.899 0.384 4.4e-84
TAIR|locus:2024219451 AT1G03890 [Arabidopsis thalian 0.493 0.525 0.435 1.3e-52
TAIR|locus:2065516356 AT2G28680 "AT2G28680" [Arabido 0.306 0.412 0.331 6.9e-31
TAIR|locus:2026545356 AT1G07750 "AT1G07750" [Arabido 0.310 0.418 0.32 9.8e-29
TAIR|locus:2056568511 AT2G28490 [Arabidopsis thalian 0.362 0.340 0.260 6.7e-14
TAIR|locus:2046273 707 AT2G18540 "AT2G18540" [Arabido 0.495 0.336 0.242 2.3e-09
UNIPROTKB|Q9M4Q7 Q9M4Q7 "Seed storage protein" [Ricinus communis (taxid:3988)] Back     alignment and assigned GO terms
 Score = 926 (331.0 bits), Expect = 5.5e-93, P = 5.5e-93
 Identities = 182/345 (52%), Positives = 234/345 (67%)

Query:   143 HQKVRQIREGDLVALPTGSANWIYNDGPSELVVVALVDVGNSDNQLDQFLRKFYLGGNPQ 202
             HQKVRQIREGD++AL  G A WIYN+G S LV+V ++D  N  NQLDQ  R F+L GNPQ
Sbjct:     9 HQKVRQIREGDVIALHAGVAQWIYNNGRSPLVLVQIIDTSNPANQLDQNHRDFFLAGNPQ 68

Query:   203 PQLXXXXXXXXXXXXXXXXXXXXXXXXXXXNLFRGFDERLLAEAFNVNPDLISKLQRPQM 262
              ++                           N+F G DER++AE+FN+N DL  KL+    
Sbjct:    69 REVQSQRGERGRTSERRSTSTGSAHDNSG-NVFSGMDERVIAESFNINTDLARKLRGEND 127

Query:   263 QKGIIVRVEEELRVLSPQRGRXXXXXXXXXXXG--------SGDNGIEETICTMKLKHNI 314
              +GIIV VE +L +L+PQR +                    +  NG+EET CT +L+HNI
Sbjct:   128 LRGIIVSVEHDLEMLAPQRSQEEEREEREEEAQRQLERSPRARFNGLEETFCTRRLRHNI 187

Query:   315 NDPSGADAYNPRGGRVTTVNRFNLPILRYIQLSAEKGNLYQNAMMAPHWNLNAHSVVYIT 374
             N PS AD YNPR GRVT+VN  NLPILRY+QLS +K  LY+NA+M PHWN+NAHS+ YIT
Sbjct:   188 NKPSEADIYNPRAGRVTSVNSHNLPILRYLQLSIQKAVLYKNALMTPHWNINAHSIRYIT 247

Query:   375 RGNGRMQIVAENGENVFDGQIREGQLIVVPQGFAVVKRASNRGLEWISFKTNDVAKTSQL 434
             RG+GR+QIV ENG++VFDGQ++ GQ+  VPQ F V+ +ASN GLEW+SFKTND AK +QL
Sbjct:   248 RGSGRVQIVNENGDSVFDGQVQRGQMFTVPQNFVVITKASNEGLEWVSFKTNDNAKINQL 307

Query:   435 AGRASVIRGLPLDVIQNSFQVSRDEAQRLKYNRQELTVFTPGPRS 479
             AGR S IR +P +V+ N+FQVS ++A+RLK NRQE+T+ +PG RS
Sbjct:   308 AGRVSAIRSMPEEVVANAFQVSVEDARRLKDNRQEVTLLSPGSRS 352
GO:0005783 "endoplasmic reticulum" evidence=IDA
TAIR|locus:2167654 CRA1 "CRUCIFERINA" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2121308 CRU3 "AT4G28520" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024234 CRU2 "AT1G03880" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q9XHP0 Q9XHP0 "11S globulin seed storage protein 2" [Sesamum indicum (taxid:4182)] Back     alignment and assigned GO terms
TAIR|locus:2024219 AT1G03890 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2065516 AT2G28680 "AT2G28680" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026545 AT1G07750 "AT1G07750" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2056568 AT2G28490 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046273 AT2G18540 "AT2G18540" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P15455CRU4_ARATHNo assigned EC number0.44620.93950.9555yesno
P11828GLYG3_SOYBNNo assigned EC number0.41630.95200.9501yesno
P09800LEGB_GOSHINo assigned EC number0.51830.99580.9263N/Ano
P07728GLUA1_ORYSJNo assigned EC number0.43900.92910.8937yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query480
PLN00212493 PLN00212, PLN00212, glutelin; Provisional 1e-154
smart00835146 smart00835, Cupin_1, Cupin 9e-49
pfam00190139 pfam00190, Cupin_1, Cupin 8e-37
pfam00190139 pfam00190, Cupin_1, Cupin 3e-31
smart00835146 smart00835, Cupin_1, Cupin 2e-23
pfam12128 1198 pfam12128, DUF3584, Protein of unknown function (D 0.003
>gnl|CDD|215106 PLN00212, PLN00212, glutelin; Provisional Back     alignment and domain information 
 Score =  448 bits (1153), Expect = e-154
 Identities = 218/491 (44%), Positives = 309/491 (62%), Gaps = 36/491 (7%)

Query: 4   TSLLCLGLGFLILFHACFAQI-AQGTDATREQRQQQQRFQTQCNIQDLNALEPQQRVESE 62
            S L +    L+L H   AQ+ +Q T+  +  RQ   R   +C    L A EP ++V SE
Sbjct: 5   FSRLSICFCVLLLCHGSMAQLFSQSTNPWQSPRQGSFR---ECRFDRLQAFEPLRKVRSE 61

Query: 63  AGVTEFWDQNDEQLQCANVAVFRHRIQQRGLVVPSYTNTPELFYVVQGRGIHGAVFPGCP 122
           AGVTE++D+ +EQ QC  V V R  I+ +GL++P Y+NTP L Y++QGRG  G  FPGCP
Sbjct: 62  AGVTEYFDEKNEQFQCTGVFVIRRVIEPQGLLLPRYSNTPGLVYIIQGRGSMGLTFPGCP 121

Query: 123 ETYQE-SQQRSSESQSRSQ---DQHQKVRQIREGDLVALPTGSANWIYNDGPSELVVVAL 178
            TYQ+  QQ  +E QS+SQ   D+HQK+ Q R+GD+VALP G A+W YNDG + +V + +
Sbjct: 122 ATYQQQFQQFLTEGQSQSQKFRDEHQKIHQFRQGDVVALPAGVAHWFYNDGDAPVVALYV 181

Query: 179 VDVGNSDNQLDQFLRKFYLGGNPQPQLQGYSQSQGSRYQGSQGGEGGDRSRRGGNLFRGF 238
            D+ N+ NQL+   R+F L GN   Q Q Y +S                   G N+F GF
Sbjct: 182 YDINNNANQLEPRQREFLLAGNNNRQQQVYGRSI--------------EQHSGQNIFSGF 227

Query: 239 DERLLAEAFNVNPDLISKLQRPQMQKGIIVRVEEELRVLSPQRGREQEQEQEQE------ 292
              LL+EA  +N  +  +LQ    Q+G I+RV+  L++L P   ++QEQ Q+Q+      
Sbjct: 228 STELLSEALGINAQVAKRLQSQNDQRGEIIRVKNGLQLLQPTLTQQQEQAQQQQQRLYQQ 287

Query: 293 -------FQGSGDNGIEETICTMKLKHNINDPSGADAYNPRGGRVTTVNRFNLPILRYIQ 345
                        NG++E  CT+K++ NI +PS AD YNPR GR+T +N    PIL  IQ
Sbjct: 288 VQYQQSQQTSGRWNGLDENFCTIKVRLNIENPSRADTYNPRAGRITRLNSQKFPILNLIQ 347

Query: 346 LSAEKGNLYQNAMMAPHWNLNAHSVVYITRGNGRMQIVAENGENVFDGQIREGQLIVVPQ 405
           +SA + NLYQNA+++P WN+NAHSVVYIT+G  R+Q+V+ NG+ VF+G +R GQL+++PQ
Sbjct: 348 MSATRVNLYQNALLSPFWNVNAHSVVYITQGRARVQVVSNNGKTVFNGVLRPGQLLIIPQ 407

Query: 406 GFAVVKRASNRGLEWISFKTNDVAKTSQLAGRASVIRGLPLDVIQNSFQVSRDEAQRLKY 465
            +AV+K+A   G ++I+FKTN  A  S +AG+ S+ R LP+DVI N++++SR+EA+RLK 
Sbjct: 408 HYAVLKKAEREGCQYIAFKTNANAMVSHIAGKNSIFRALPVDVIANAYRISREEARRLKN 467

Query: 466 NR-QELTVFTP 475
           NR  EL  FTP
Sbjct: 468 NRGDELGAFTP 478

Length = 493
>gnl|CDD|214845 smart00835, Cupin_1, Cupin Back     alignment and domain information
>gnl|CDD|215780 pfam00190, Cupin_1, Cupin Back     alignment and domain information
>gnl|CDD|215780 pfam00190, Cupin_1, Cupin Back     alignment and domain information
>gnl|CDD|214845 smart00835, Cupin_1, Cupin Back     alignment and domain information
>gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 480
PLN00212493 glutelin; Provisional 100.0
TIGR03404367 bicupin_oxalic bicupin, oxalate decarboxylase fami 100.0
PF00190144 Cupin_1: Cupin; InterPro: IPR006045 This family re 99.95
PF00190144 Cupin_1: Cupin; InterPro: IPR006045 This family re 99.92
smart00835146 Cupin_1 Cupin. This family represents the conserve 99.89
smart00835146 Cupin_1 Cupin. This family represents the conserve 99.88
TIGR03404 367 bicupin_oxalic bicupin, oxalate decarboxylase fami 99.86
PLN00212 493 glutelin; Provisional 99.85
COG2140209 Thermophilic glucose-6-phosphate isomerase and rel 99.76
TIGR03214260 ura-cupin putative allantoin catabolism protein. T 99.38
PRK11171266 hypothetical protein; Provisional 99.32
COG2140209 Thermophilic glucose-6-phosphate isomerase and rel 99.18
COG0662127 {ManC} Mannose-6-phosphate isomerase [Carbohydrate 99.05
TIGR02272335 gentisate_1_2 gentisate 1,2-dioxygenase. This fami 99.0
PF0788371 Cupin_2: Cupin domain; InterPro: IPR013096 This fa 98.96
COG1917131 Uncharacterized conserved protein, contains double 98.93
PRK13290125 ectC L-ectoine synthase; Reviewed 98.87
PRK04190191 glucose-6-phosphate isomerase; Provisional 98.86
PRK04190191 glucose-6-phosphate isomerase; Provisional 98.84
PF0788371 Cupin_2: Cupin domain; InterPro: IPR013096 This fa 98.75
TIGR03214260 ura-cupin putative allantoin catabolism protein. T 98.75
COG3837161 Uncharacterized conserved protein, contains double 98.69
COG3435351 Gentisate 1,2-dioxygenase [Secondary metabolites b 98.53
PRK13290125 ectC L-ectoine synthase; Reviewed 98.52
COG0662127 {ManC} Mannose-6-phosphate isomerase [Carbohydrate 98.5
PRK11171266 hypothetical protein; Provisional 98.45
PRK15460478 cpsB mannose-1-phosphate guanyltransferase; Provis 98.41
PF01050151 MannoseP_isomer: Mannose-6-phosphate isomerase; In 98.4
COG4297163 Uncharacterized protein containing double-stranded 98.37
COG1917131 Uncharacterized conserved protein, contains double 98.34
TIGR01479468 GMP_PMI mannose-1-phosphate guanylyltransferase/ma 98.29
PF01050151 MannoseP_isomer: Mannose-6-phosphate isomerase; In 98.23
PRK09943185 DNA-binding transcriptional repressor PuuR; Provis 98.21
PF06560182 GPI: Glucose-6-phosphate isomerase (GPI); InterPro 98.09
TIGR01479468 GMP_PMI mannose-1-phosphate guanylyltransferase/ma 98.01
COG4101142 Predicted mannose-6-phosphate isomerase [Carbohydr 97.98
COG3837161 Uncharacterized conserved protein, contains double 97.96
PF06560182 GPI: Glucose-6-phosphate isomerase (GPI); InterPro 97.96
PF1169985 CENP-C_C: Mif2/CENP-C like; PDB: 2VPV_B. 97.89
PRK09943185 DNA-binding transcriptional repressor PuuR; Provis 97.82
COG4101142 Predicted mannose-6-phosphate isomerase [Carbohydr 97.79
PRK15460478 cpsB mannose-1-phosphate guanyltransferase; Provis 97.77
PF02041167 Auxin_BP: Auxin binding protein; InterPro: IPR0005 97.73
PF03079157 ARD: ARD/ARD' family; InterPro: IPR004313 The two 97.67
TIGR03037159 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase 97.66
PF06339126 Ectoine_synth: Ectoine synthase; InterPro: IPR0104 97.64
PRK13264177 3-hydroxyanthranilate 3,4-dioxygenase; Provisional 97.62
COG1791181 Uncharacterized conserved protein, contains double 97.59
PRK13264177 3-hydroxyanthranilate 3,4-dioxygenase; Provisional 97.56
PF03079157 ARD: ARD/ARD' family; InterPro: IPR004313 The two 97.55
PF02311136 AraC_binding: AraC-like ligand binding domain; Int 97.51
TIGR03037159 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase 97.44
PRK15457233 ethanolamine utilization protein EutQ; Provisional 97.39
PF02311136 AraC_binding: AraC-like ligand binding domain; Int 97.32
PF05523131 FdtA: WxcM-like, C-terminal ; InterPro: IPR008894 97.32
COG4297163 Uncharacterized protein containing double-stranded 97.3
PRK15457233 ethanolamine utilization protein EutQ; Provisional 97.28
TIGR02451215 anti_sig_ChrR anti-sigma factor, putative, ChrR fa 97.02
PF1169985 CENP-C_C: Mif2/CENP-C like; PDB: 2VPV_B. 96.98
PF1297391 Cupin_7: ChrR Cupin-like domain; PDB: 3O14_B 2Z2S_ 96.98
PF02041167 Auxin_BP: Auxin binding protein; InterPro: IPR0005 96.77
PF0589974 Cupin_3: Protein of unknown function (DUF861); Int 96.75
PRK13501290 transcriptional activator RhaR; Provisional 96.74
PRK10371302 DNA-binding transcriptional regulator MelR; Provis 96.72
PF1297391 Cupin_7: ChrR Cupin-like domain; PDB: 3O14_B 2Z2S_ 96.7
COG1791181 Uncharacterized conserved protein, contains double 96.65
PRK13500312 transcriptional activator RhaR; Provisional 96.65
PF06339126 Ectoine_synth: Ectoine synthase; InterPro: IPR0104 96.61
TIGR02272 335 gentisate_1_2 gentisate 1,2-dioxygenase. This fami 96.6
PRK10296 278 DNA-binding transcriptional regulator ChbR; Provis 96.54
PF0589974 Cupin_3: Protein of unknown function (DUF861); Int 96.53
PRK10296278 DNA-binding transcriptional regulator ChbR; Provis 96.51
PRK13503278 transcriptional activator RhaS; Provisional 96.5
PRK13501 290 transcriptional activator RhaR; Provisional 96.37
PRK10371 302 DNA-binding transcriptional regulator MelR; Provis 96.34
PRK13500 312 transcriptional activator RhaR; Provisional 96.3
PF06249152 EutQ: Ethanolamine utilisation protein EutQ; Inter 96.26
PRK13502 282 transcriptional activator RhaR; Provisional 96.17
PF06052151 3-HAO: 3-hydroxyanthranilic acid dioxygenase; Inte 96.12
TIGR02297 287 HpaA 4-hydroxyphenylacetate catabolism regulatory 96.06
TIGR02297287 HpaA 4-hydroxyphenylacetate catabolism regulatory 96.02
PF00908176 dTDP_sugar_isom: dTDP-4-dehydrorhamnose 3,5-epimer 96.0
TIGR01221176 rmlC dTDP-4-dehydrorhamnose 3,5-epimerase. This en 95.97
PRK13502282 transcriptional activator RhaR; Provisional 95.95
TIGR02451215 anti_sig_ChrR anti-sigma factor, putative, ChrR fa 95.92
PRK15131389 mannose-6-phosphate isomerase; Provisional 95.87
COG1898173 RfbC dTDP-4-dehydrorhamnose 3,5-epimerase and rela 95.73
COG3435351 Gentisate 1,2-dioxygenase [Secondary metabolites b 95.7
PF14499251 DUF4437: Domain of unknown function (DUF4437); PDB 95.69
PF06052151 3-HAO: 3-hydroxyanthranilic acid dioxygenase; Inte 95.68
PF06249152 EutQ: Ethanolamine utilisation protein EutQ; Inter 95.63
KOG2107179 consensus Uncharacterized conserved protein, conta 95.53
PF14499251 DUF4437: Domain of unknown function (DUF4437); PDB 95.45
TIGR00218302 manA mannose-6-phosphate isomerase, class I. The n 95.45
PF13621251 Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XU 95.37
PRK13503 278 transcriptional activator RhaS; Provisional 95.34
COG3450116 Predicted enzyme of the cupin superfamily [General 95.15
PF05523131 FdtA: WxcM-like, C-terminal ; InterPro: IPR008894 95.01
PF12852186 Cupin_6: Cupin 94.84
COG4766176 EutQ Ethanolamine utilization protein [Amino acid 94.45
COG3450116 Predicted enzyme of the cupin superfamily [General 94.39
PF00908176 dTDP_sugar_isom: dTDP-4-dehydrorhamnose 3,5-epimer 94.27
KOG2107179 consensus Uncharacterized conserved protein, conta 94.26
PF13621251 Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XU 93.52
PF02373114 JmjC: JmjC domain, hydroxylase; InterPro: IPR01312 93.14
TIGR01221176 rmlC dTDP-4-dehydrorhamnose 3,5-epimerase. This en 93.14
PF08007319 Cupin_4: Cupin superfamily protein; InterPro: IPR0 92.94
COG4766176 EutQ Ethanolamine utilization protein [Amino acid 92.91
COG3257264 GlxB Uncharacterized protein, possibly involved in 91.44
PF13759101 2OG-FeII_Oxy_5: Putative 2OG-Fe(II) oxygenase; PDB 91.11
PF05118163 Asp_Arg_Hydrox: Aspartyl/Asparaginyl beta-hydroxyl 90.84
KOG3706 629 consensus Uncharacterized conserved protein [Funct 90.68
PF05726104 Pirin_C: Pirin C-terminal cupin domain; InterPro: 90.27
COG1898173 RfbC dTDP-4-dehydrorhamnose 3,5-epimerase and rela 89.72
COG3257264 GlxB Uncharacterized protein, possibly involved in 89.45
PF12852186 Cupin_6: Cupin 89.41
PRK05341438 homogentisate 1,2-dioxygenase; Provisional 89.38
KOG2757411 consensus Mannose-6-phosphate isomerase [Carbohydr 88.79
PF04209424 HgmA: homogentisate 1,2-dioxygenase; InterPro: IPR 88.53
PF08007319 Cupin_4: Cupin superfamily protein; InterPro: IPR0 88.49
PF04209 424 HgmA: homogentisate 1,2-dioxygenase; InterPro: IPR 88.27
PRK10572290 DNA-binding transcriptional regulator AraC; Provis 88.23
TIGR01015429 hmgA homogentisate 1,2-dioxygenase. Missing in hum 87.66
PRK15131389 mannose-6-phosphate isomerase; Provisional 87.56
TIGR02466201 conserved hypothetical protein. This family consis 87.01
PRK12335 287 tellurite resistance protein TehB; Provisional 86.05
KOG2757411 consensus Mannose-6-phosphate isomerase [Carbohydr 85.91
PLN02658435 homogentisate 1,2-dioxygenase 84.46
PRK05341 438 homogentisate 1,2-dioxygenase; Provisional 83.55
PF1346477 DUF4115: Domain of unknown function (DUF4115) 83.28
PF05726104 Pirin_C: Pirin C-terminal cupin domain; InterPro: 83.12
PF06172139 Cupin_5: Cupin superfamily (DUF985); InterPro: IPR 80.95
COG2850 383 Uncharacterized conserved protein [Function unknow 80.58
PF0931382 DUF1971: Domain of unknown function (DUF1971); Int 80.1
>PLN00212 glutelin; Provisional Back     alignment and domain information 
Probab=100.00  E-value=2.2e-123  Score=982.23  Aligned_cols=460  Identities=45%  Similarity=0.800  Sum_probs=406.8

Q ss_pred             CCcc-hhHHHHHHHHHHhhhhhhhhccCCchhhHHHhhhhcccCcccccccCCCCCCcceecCCceEEEeCCCChhcccc
Q 048197            1 MAST-SLLCLGLGFLILFHACFAQIAQGTDATREQRQQQQRFQTQCNIQDLNALEPQQRVESEAGVTEFWDQNDEQLQCA   79 (480)
Q Consensus         1 m~~~-~~~~~~l~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~C~~~~L~a~eP~~~~~se~G~~e~~~~~~~~l~~~   79 (480)
                      ||++ +||+|||||||||++|+|+..+..  ++++++.+++.+++|+|++|+|+||+++|+||||+||+||+++++|+|+
T Consensus         1 ~~~~~~~l~~~~~~l~l~~~~~a~~~~~~--~~~~~~~~~~~~~~C~~~~l~a~ep~~ri~se~G~~E~~~~~~~q~~ca   78 (493)
T PLN00212          1 ASSAFSRLSICFCVLLLCHGSMAQLFSQS--TNPWQSPRQGSFRECRFDRLQAFEPLRKVRSEAGVTEYFDEKNEQFQCT   78 (493)
T ss_pred             CcchHHHHHHHHHHHHHHhhHhhhhcccc--cccccccccccCCcccccccccCCCchhhcccCceeeecCCCChhhccc
Confidence            7766 788899999999999999754211  1111121222478999999999999999999999999999999999999


Q ss_pred             CeeEEEEEEcCCeeecCcccCCCeEEEEEeceEEEEEEcCCCccchhhhhhc----ccccccccccccceeEeecCCcEE
Q 048197           80 NVAVFRHRIQQRGLVVPSYTNTPELFYVVQGRGIHGAVFPGCPETYQESQQR----SSESQSRSQDQHQKVRQIREGDLV  155 (480)
Q Consensus        80 gvs~~r~~i~p~gl~lPh~~~a~el~yV~~G~g~~g~v~pg~~etf~~~~~~----~~~~~~~~~d~~qk~~~l~~GDV~  155 (480)
                      ||++.|++|+|+||++|||++|++++||++|+|++|+|+|||||||++.+++    +++++++++|+|||+++|++||||
T Consensus        79 Gv~~~R~~i~p~gL~lP~y~na~~liyV~qG~G~~G~v~pGcpeT~~~~~~~~~~~~~~~~~~~~d~hqkv~~lr~GDVi  158 (493)
T PLN00212         79 GVFVIRRVIEPQGLLLPRYSNTPGLVYIIQGRGSMGLTFPGCPATYQQQFQQFLTEGQSQSQKFRDEHQKIHQFRQGDVV  158 (493)
T ss_pred             ceEEEEEEecCCcccCccccCCCeEEEEEeCeEEEEEEeCCCcchhhhhcccccccccccccccccccccceEeccCCEE
Confidence            9999999999999999999999999999999999999999999999876553    334567889999999999999999


Q ss_pred             EeCCCCEEEEEcCCCCcEEEEEEeeCCCCCccccccceeeeecCCCCcCccccccccCccccCCCCCCCCCcccccCccc
Q 048197          156 ALPTGSANWIYNDGPSELVVVALVDVGNSDNQLDQFLRKFYLGGNPQPQLQGYSQSQGSRYQGSQGGEGGDRSRRGGNLF  235 (480)
Q Consensus       156 ~iPaG~~h~~~N~G~~~l~~v~~~d~~n~~nqld~~~~~F~LaG~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~ni~  235 (480)
                      +||||++||+||+||+++++|+++|++|+.||||+.++.||||||++++++++         |++     +++..+.|||
T Consensus       159 aiPaG~~hw~yN~Gd~~~v~v~~~d~~n~~Nqld~~~r~F~LaG~~~~~~~~~---------~~~-----~~~~~~~nif  224 (493)
T PLN00212        159 ALPAGVAHWFYNDGDAPVVALYVYDINNNANQLEPRQREFLLAGNNNRQQQVY---------GRS-----IEQHSGQNIF  224 (493)
T ss_pred             EECCCCeEEEEeCCCCcEEEEEEEeccccccccCCCcceeeccCCCccccccc---------ccc-----ccccccCchh
Confidence            99999999999999999999999999999999999999999999976433211         111     1111358999


Q ss_pred             ccCCHHHHHhhcCCCHHHHHHhccccccceeEEEeccceeccCCcccchhhHHHh-----------h--hhcCCCCCCCc
Q 048197          236 RGFDERLLAEAFNVNPDLISKLQRPQMQKGIIVRVEEELRVLSPQRGREQEQEQE-----------Q--EFQGSGDNGIE  302 (480)
Q Consensus       236 ~gf~~~~La~af~v~~~~~~kl~~~~~~rg~Iv~v~~~l~~~~P~~~~~~e~~~~-----------~--~~~~~~~nG~e  302 (480)
                      +||++++||+||||+.++++||++++|+||.||+|+++|++++|+..+++|++++           .  ....+..||+|
T Consensus       225 sGF~~e~La~Afnv~~e~~~klq~~~d~rG~IVrv~~~l~~~~P~~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~ngle  304 (493)
T PLN00212        225 SGFSTELLSEALGINAQVAKRLQSQNDQRGEIIRVKNGLQLLQPTLTQQQEQAQQQQQRLYQQVQYQQSQQTSGRWNGLD  304 (493)
T ss_pred             hcCCHHHHHHHHCCCHHHHHHHhccccCCccEEEECCCcccCCCchhhhhHHHHhhhhcccccchhhhccccccCCCCcc
Confidence            9999999999999999999999999999999999999999999976543221111           0  11122349999


Q ss_pred             cceeccccccCCCCCCCCCcccCCCeEEEEEecCCCCcccccceeEEeeeeccccccccccccCCceEEEEEEeeEEEEE
Q 048197          303 ETICTMKLKHNINDPSGADAYNPRGGRVTTVNRFNLPILRYIQLSAEKGNLYQNAMMAPHWNLNAHSVVYITRGNGRMQI  382 (480)
Q Consensus       303 e~~~~~~l~~ni~~p~~~~~~~~~~G~i~~~~~~~~P~L~~l~lsa~~v~L~pgam~~PHwh~nA~ei~yV~~G~grv~v  382 (480)
                      ||+|+||+++||++|+++|+|++.+|+++++|+.+||+|++++|||++++|+||||++||||||||+|+||++|+|+|+|
T Consensus       305 Et~c~~rlr~Ni~~p~~ad~y~~~~G~it~v~~~~~P~L~~L~LSa~rv~L~~gam~~PHwn~nA~eI~yV~rG~g~vqv  384 (493)
T PLN00212        305 ENFCTIKVRLNIENPSRADTYNPRAGRITRLNSQKFPILNLIQMSATRVNLYQNALLSPFWNVNAHSVVYITQGRARVQV  384 (493)
T ss_pred             ccccccccccccCCccccCccCCCceEEEEechhhCccccccCeeEEEEEEcCCcccCCeecCCCCEEEEEeecceEEEE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EecCCceEEeeecCCccEEEECCCcEEEEEcCCCCeEEEEEEecCCCcceeeccccccccCCCHHHHHHHcCCCHHHHHH
Q 048197          383 VAENGENVFDGQIREGQLIVVPQGFAVVKRASNRGLEWISFKTNDVAKTSQLAGRASVIRGLPLDVIQNSFQVSRDEAQR  462 (480)
Q Consensus       383 v~~~G~~~f~~~l~~GdV~vVPqg~~~~~~ag~e~l~~v~f~ts~~~~~~~LAG~~svl~~lp~eVla~af~vs~e~~~~  462 (480)
                      |+++|+++|+++|++||||||||||+|++.|++++|+|++|+|++++..++|||++|+|++||.+||++||+++++++++
T Consensus       385 V~~~g~~vf~~~L~~GdvfVVPqg~~v~~~A~~egfe~v~F~tna~~~~s~laG~~Sv~~alp~eVla~Af~is~eea~~  464 (493)
T PLN00212        385 VSNNGKTVFNGVLRPGQLLIIPQHYAVLKKAEREGCQYIAFKTNANAMVSHIAGKNSIFRALPVDVIANAYRISREEARR  464 (493)
T ss_pred             EcCCCCEEEEEEEcCCCEEEECCCCeEEEeecCCceEEEEeecCCCccccccccHHHHHHhCCHHHHHHHcCCCHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhcCCCe-EEeCCC
Q 048197          463 LKYNRQEL-TVFTPG  476 (480)
Q Consensus       463 l~~~q~e~-~i~~p~  476 (480)
                      ||.++.+. .+++|+
T Consensus       465 lk~n~~~e~~~~~p~  479 (493)
T PLN00212        465 LKNNRGDELGAFTPR  479 (493)
T ss_pred             HHhcccCceeecCCC
Confidence            99997555 455775

>TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family Back     alignment and domain information
>PF00190 Cupin_1: Cupin; InterPro: IPR006045 This family represents the conserved barrel domain of the 'cupin' superfamily ('cupa' is the Latin term for a small barrel) Back     alignment and domain information
>PF00190 Cupin_1: Cupin; InterPro: IPR006045 This family represents the conserved barrel domain of the 'cupin' superfamily ('cupa' is the Latin term for a small barrel) Back     alignment and domain information
>smart00835 Cupin_1 Cupin Back     alignment and domain information
>smart00835 Cupin_1 Cupin Back     alignment and domain information
>TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family Back     alignment and domain information
>PLN00212 glutelin; Provisional Back     alignment and domain information
>COG2140 Thermophilic glucose-6-phosphate isomerase and related metalloenzymes [Carbohydrate transport and metabolism / General function prediction only] Back     alignment and domain information
>TIGR03214 ura-cupin putative allantoin catabolism protein Back     alignment and domain information
>PRK11171 hypothetical protein; Provisional Back     alignment and domain information
>COG2140 Thermophilic glucose-6-phosphate isomerase and related metalloenzymes [Carbohydrate transport and metabolism / General function prediction only] Back     alignment and domain information
>COG0662 {ManC} Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02272 gentisate_1_2 gentisate 1,2-dioxygenase Back     alignment and domain information
>PF07883 Cupin_2: Cupin domain; InterPro: IPR013096 This family represents the conserved barrel domain of the cupin superfamily [] (cupa is the Latin term for a small barrel) Back     alignment and domain information
>COG1917 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>PRK13290 ectC L-ectoine synthase; Reviewed Back     alignment and domain information
>PRK04190 glucose-6-phosphate isomerase; Provisional Back     alignment and domain information
>PRK04190 glucose-6-phosphate isomerase; Provisional Back     alignment and domain information
>PF07883 Cupin_2: Cupin domain; InterPro: IPR013096 This family represents the conserved barrel domain of the cupin superfamily [] (cupa is the Latin term for a small barrel) Back     alignment and domain information
>TIGR03214 ura-cupin putative allantoin catabolism protein Back     alignment and domain information
>COG3837 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>COG3435 Gentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK13290 ectC L-ectoine synthase; Reviewed Back     alignment and domain information
>COG0662 {ManC} Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11171 hypothetical protein; Provisional Back     alignment and domain information
>PRK15460 cpsB mannose-1-phosphate guanyltransferase; Provisional Back     alignment and domain information
>PF01050 MannoseP_isomer: Mannose-6-phosphate isomerase; InterPro: IPR001538 Mannose-6-phosphate isomerase or phosphomannose isomerase (5 Back     alignment and domain information
>COG4297 Uncharacterized protein containing double-stranded beta helix domain [Function unknown] Back     alignment and domain information
>COG1917 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>TIGR01479 GMP_PMI mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase Back     alignment and domain information
>PF01050 MannoseP_isomer: Mannose-6-phosphate isomerase; InterPro: IPR001538 Mannose-6-phosphate isomerase or phosphomannose isomerase (5 Back     alignment and domain information
>PRK09943 DNA-binding transcriptional repressor PuuR; Provisional Back     alignment and domain information
>PF06560 GPI: Glucose-6-phosphate isomerase (GPI); InterPro: IPR010551 This entry consists of several bacterial and archaeal glucose-6-phosphate isomerase (GPI) proteins (5 Back     alignment and domain information
>TIGR01479 GMP_PMI mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase Back     alignment and domain information
>COG4101 Predicted mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3837 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>PF06560 GPI: Glucose-6-phosphate isomerase (GPI); InterPro: IPR010551 This entry consists of several bacterial and archaeal glucose-6-phosphate isomerase (GPI) proteins (5 Back     alignment and domain information
>PF11699 CENP-C_C: Mif2/CENP-C like; PDB: 2VPV_B Back     alignment and domain information
>PRK09943 DNA-binding transcriptional repressor PuuR; Provisional Back     alignment and domain information
>COG4101 Predicted mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK15460 cpsB mannose-1-phosphate guanyltransferase; Provisional Back     alignment and domain information
>PF02041 Auxin_BP: Auxin binding protein; InterPro: IPR000526 Auxin binding protein is located in the lumen of the endoplasmic reticulum (ER) Back     alignment and domain information
>PF03079 ARD: ARD/ARD' family; InterPro: IPR004313 The two acireductone dioxygenase enzymes (ARD and ARD', previously known as E-2 and E-2') from Klebsiella pneumoniae share the same amino acid sequence Q9ZFE7 from SWISSPROT, but bind different metal ions: ARD binds Ni2+, ARD' binds Fe2+ [] Back     alignment and domain information
>TIGR03037 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase Back     alignment and domain information
>PF06339 Ectoine_synth: Ectoine synthase; InterPro: IPR010462 This family consists of several bacterial ectoine synthase proteins Back     alignment and domain information
>PRK13264 3-hydroxyanthranilate 3,4-dioxygenase; Provisional Back     alignment and domain information
>COG1791 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>PRK13264 3-hydroxyanthranilate 3,4-dioxygenase; Provisional Back     alignment and domain information
>PF03079 ARD: ARD/ARD' family; InterPro: IPR004313 The two acireductone dioxygenase enzymes (ARD and ARD', previously known as E-2 and E-2') from Klebsiella pneumoniae share the same amino acid sequence Q9ZFE7 from SWISSPROT, but bind different metal ions: ARD binds Ni2+, ARD' binds Fe2+ [] Back     alignment and domain information
>PF02311 AraC_binding: AraC-like ligand binding domain; InterPro: IPR003313 This entry defines the arabinose-binding and dimerisation domain of the bacterial gene regulatory protein AraC Back     alignment and domain information
>TIGR03037 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase Back     alignment and domain information
>PRK15457 ethanolamine utilization protein EutQ; Provisional Back     alignment and domain information
>PF02311 AraC_binding: AraC-like ligand binding domain; InterPro: IPR003313 This entry defines the arabinose-binding and dimerisation domain of the bacterial gene regulatory protein AraC Back     alignment and domain information
>PF05523 FdtA: WxcM-like, C-terminal ; InterPro: IPR008894 This entry includes FdtA (Q6T1W8 from SWISSPROT) from Aneurinibacillus thermoaerophilus, which has been characterised as a dTDP-6-deoxy-3,4-keto-hexulose isomerase [] Back     alignment and domain information
>COG4297 Uncharacterized protein containing double-stranded beta helix domain [Function unknown] Back     alignment and domain information
>PRK15457 ethanolamine utilization protein EutQ; Provisional Back     alignment and domain information
>TIGR02451 anti_sig_ChrR anti-sigma factor, putative, ChrR family Back     alignment and domain information
>PF11699 CENP-C_C: Mif2/CENP-C like; PDB: 2VPV_B Back     alignment and domain information
>PF12973 Cupin_7: ChrR Cupin-like domain; PDB: 3O14_B 2Z2S_F 2Q1Z_B 3EBR_A Back     alignment and domain information
>PF02041 Auxin_BP: Auxin binding protein; InterPro: IPR000526 Auxin binding protein is located in the lumen of the endoplasmic reticulum (ER) Back     alignment and domain information
>PF05899 Cupin_3: Protein of unknown function (DUF861); InterPro: IPR008579 The function of the proteins in this entry are unknown Back     alignment and domain information
>PRK13501 transcriptional activator RhaR; Provisional Back     alignment and domain information
>PRK10371 DNA-binding transcriptional regulator MelR; Provisional Back     alignment and domain information
>PF12973 Cupin_7: ChrR Cupin-like domain; PDB: 3O14_B 2Z2S_F 2Q1Z_B 3EBR_A Back     alignment and domain information
>COG1791 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>PRK13500 transcriptional activator RhaR; Provisional Back     alignment and domain information
>PF06339 Ectoine_synth: Ectoine synthase; InterPro: IPR010462 This family consists of several bacterial ectoine synthase proteins Back     alignment and domain information
>TIGR02272 gentisate_1_2 gentisate 1,2-dioxygenase Back     alignment and domain information
>PRK10296 DNA-binding transcriptional regulator ChbR; Provisional Back     alignment and domain information
>PF05899 Cupin_3: Protein of unknown function (DUF861); InterPro: IPR008579 The function of the proteins in this entry are unknown Back     alignment and domain information
>PRK10296 DNA-binding transcriptional regulator ChbR; Provisional Back     alignment and domain information
>PRK13503 transcriptional activator RhaS; Provisional Back     alignment and domain information
>PRK13501 transcriptional activator RhaR; Provisional Back     alignment and domain information
>PRK10371 DNA-binding transcriptional regulator MelR; Provisional Back     alignment and domain information
>PRK13500 transcriptional activator RhaR; Provisional Back     alignment and domain information
>PF06249 EutQ: Ethanolamine utilisation protein EutQ; InterPro: IPR010424 The eut operon of Salmonella typhimurium encodes proteins involved in the cobalamin-dependent degradation of ethanolamine Back     alignment and domain information
>PRK13502 transcriptional activator RhaR; Provisional Back     alignment and domain information
>PF06052 3-HAO: 3-hydroxyanthranilic acid dioxygenase; InterPro: IPR010329 Members of this protein family, from both bacteria and eukaryotes, are the enzyme 3-hydroxyanthranilate 3,4-dioxygenase (1 Back     alignment and domain information
>TIGR02297 HpaA 4-hydroxyphenylacetate catabolism regulatory protein HpaA Back     alignment and domain information
>TIGR02297 HpaA 4-hydroxyphenylacetate catabolism regulatory protein HpaA Back     alignment and domain information
>PF00908 dTDP_sugar_isom: dTDP-4-dehydrorhamnose 3,5-epimerase; InterPro: IPR000888 Deoxythymidine diphosphate (dTDP)-4-keto-6-deoxy-d-hexulose 3, 5-epimerase (RmlC, 5 Back     alignment and domain information
>TIGR01221 rmlC dTDP-4-dehydrorhamnose 3,5-epimerase Back     alignment and domain information
>PRK13502 transcriptional activator RhaR; Provisional Back     alignment and domain information
>TIGR02451 anti_sig_ChrR anti-sigma factor, putative, ChrR family Back     alignment and domain information
>PRK15131 mannose-6-phosphate isomerase; Provisional Back     alignment and domain information
>COG1898 RfbC dTDP-4-dehydrorhamnose 3,5-epimerase and related enzymes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG3435 Gentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF14499 DUF4437: Domain of unknown function (DUF4437); PDB: 2QDR_A Back     alignment and domain information
>PF06052 3-HAO: 3-hydroxyanthranilic acid dioxygenase; InterPro: IPR010329 Members of this protein family, from both bacteria and eukaryotes, are the enzyme 3-hydroxyanthranilate 3,4-dioxygenase (1 Back     alignment and domain information
>PF06249 EutQ: Ethanolamine utilisation protein EutQ; InterPro: IPR010424 The eut operon of Salmonella typhimurium encodes proteins involved in the cobalamin-dependent degradation of ethanolamine Back     alignment and domain information
>KOG2107 consensus Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>PF14499 DUF4437: Domain of unknown function (DUF4437); PDB: 2QDR_A Back     alignment and domain information
>TIGR00218 manA mannose-6-phosphate isomerase, class I Back     alignment and domain information
>PF13621 Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XUM_A 2Y0I_A 1MZE_A 3KCY_A 1MZF_A 1YCI_A 2ILM_A 1H2L_A Back     alignment and domain information
>PRK13503 transcriptional activator RhaS; Provisional Back     alignment and domain information
>COG3450 Predicted enzyme of the cupin superfamily [General function prediction only] Back     alignment and domain information
>PF05523 FdtA: WxcM-like, C-terminal ; InterPro: IPR008894 This entry includes FdtA (Q6T1W8 from SWISSPROT) from Aneurinibacillus thermoaerophilus, which has been characterised as a dTDP-6-deoxy-3,4-keto-hexulose isomerase [] Back     alignment and domain information
>PF12852 Cupin_6: Cupin Back     alignment and domain information
>COG4766 EutQ Ethanolamine utilization protein [Amino acid transport and metabolism] Back     alignment and domain information
>COG3450 Predicted enzyme of the cupin superfamily [General function prediction only] Back     alignment and domain information
>PF00908 dTDP_sugar_isom: dTDP-4-dehydrorhamnose 3,5-epimerase; InterPro: IPR000888 Deoxythymidine diphosphate (dTDP)-4-keto-6-deoxy-d-hexulose 3, 5-epimerase (RmlC, 5 Back     alignment and domain information
>KOG2107 consensus Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>PF13621 Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XUM_A 2Y0I_A 1MZE_A 3KCY_A 1MZF_A 1YCI_A 2ILM_A 1H2L_A Back     alignment and domain information
>PF02373 JmjC: JmjC domain, hydroxylase; InterPro: IPR013129 Jumonji protein is required for neural tube formation in mice [] Back     alignment and domain information
>TIGR01221 rmlC dTDP-4-dehydrorhamnose 3,5-epimerase Back     alignment and domain information
>PF08007 Cupin_4: Cupin superfamily protein; InterPro: IPR022777 This signature represents primarily the cupin fold found in JmjC transcription factors Back     alignment and domain information
>COG4766 EutQ Ethanolamine utilization protein [Amino acid transport and metabolism] Back     alignment and domain information
>COG3257 GlxB Uncharacterized protein, possibly involved in glyoxylate utilization [General function prediction only] Back     alignment and domain information
>PF13759 2OG-FeII_Oxy_5: Putative 2OG-Fe(II) oxygenase; PDB: 3BVC_B 2RG4_A Back     alignment and domain information
>PF05118 Asp_Arg_Hydrox: Aspartyl/Asparaginyl beta-hydroxylase; InterPro: IPR007803 The alpha-ketoglutarate-dependent dioxygenase aspartyl (asparaginyl) beta-hydroxylase (1 Back     alignment and domain information
>KOG3706 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05726 Pirin_C: Pirin C-terminal cupin domain; InterPro: IPR008778 This entry represents C-terminal domain of Pirin proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>COG1898 RfbC dTDP-4-dehydrorhamnose 3,5-epimerase and related enzymes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG3257 GlxB Uncharacterized protein, possibly involved in glyoxylate utilization [General function prediction only] Back     alignment and domain information
>PF12852 Cupin_6: Cupin Back     alignment and domain information
>PRK05341 homogentisate 1,2-dioxygenase; Provisional Back     alignment and domain information
>KOG2757 consensus Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF04209 HgmA: homogentisate 1,2-dioxygenase; InterPro: IPR005708 Alkaptonuria (AKU), a rare hereditary disorder, was the first disease to be interpreted as an inborn error of metabolism Back     alignment and domain information
>PF08007 Cupin_4: Cupin superfamily protein; InterPro: IPR022777 This signature represents primarily the cupin fold found in JmjC transcription factors Back     alignment and domain information
>PF04209 HgmA: homogentisate 1,2-dioxygenase; InterPro: IPR005708 Alkaptonuria (AKU), a rare hereditary disorder, was the first disease to be interpreted as an inborn error of metabolism Back     alignment and domain information
>PRK10572 DNA-binding transcriptional regulator AraC; Provisional Back     alignment and domain information
>TIGR01015 hmgA homogentisate 1,2-dioxygenase Back     alignment and domain information
>PRK15131 mannose-6-phosphate isomerase; Provisional Back     alignment and domain information
>TIGR02466 conserved hypothetical protein Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>KOG2757 consensus Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02658 homogentisate 1,2-dioxygenase Back     alignment and domain information
>PRK05341 homogentisate 1,2-dioxygenase; Provisional Back     alignment and domain information
>PF13464 DUF4115: Domain of unknown function (DUF4115) Back     alignment and domain information
>PF05726 Pirin_C: Pirin C-terminal cupin domain; InterPro: IPR008778 This entry represents C-terminal domain of Pirin proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>PF06172 Cupin_5: Cupin superfamily (DUF985); InterPro: IPR009327 This is a family of uncharacterised proteins found in bacteria and eukaryotes Back     alignment and domain information
>COG2850 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09313 DUF1971: Domain of unknown function (DUF1971); InterPro: IPR015392 This uncharacterised domain is predominantly found in bacterial Tellurite resistance proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query480
2evx_A459 Crystal Structure Of Pumpkin Seed Globulin Length = 1e-114
3qac_A465 Structure Of Amaranth 11s Proglobulin Seed Storage 1e-112
1fxz_A476 Crystal Structure Of Soybean Proglycinin A1ab1b Hom 2e-84
1ucx_A476 Crystal Structure Of Proglycinin C12g Mutant Length 2e-83
1ud1_A476 Crystal Structure Of Proglycinin Mutant C88s Length 3e-83
3kgl_A466 Crystal Structure Of Procruciferin, 11s Globulin Fr 7e-83
3c3v_A510 Crystal Structure Of Peanut Major Allergen Ara H 3 2e-79
3ehk_A531 Crystal Structure Of Pru Du Amandin, An Allergenic 6e-75
3ksc_A496 Crystal Structure Of Pea Prolegumin, An 11s Seed Gl 6e-47
2d5f_A493 Crystal Structure Of Recombinant Soybean Proglycini 2e-43
1od5_A492 Crystal Structure Of Glycinin A3b4 Subunit Homohexa 5e-43
>pdb|2EVX|A Chain A, Crystal Structure Of Pumpkin Seed Globulin Length = 459 Back     alignment and structure 
Iteration: 1

 Score =  408 bits (1049), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 198/437 (45%), Positives = 280/437 (64%), Gaps = 9/437 (2%)
Query: 45  CNIQDLNALEPQQRVESEAGVTEFWDQNDEQLQCANVAVFRHRIQQRGLVVPSYTNTPEL 104
           C +++L A +P +R E+EAG TE WDQ++++ QCA V + RH I+ +GL++P ++N P+L
Sbjct: 27  CRLENLRAQDPVRRAEAEAGFTEVWDQDNDEFQCAGVNMIRHTIRPKGLLLPGFSNAPKL 86
Query: 105 FYVVQGRGIHGAVFPGCPETYXXXXXXXXXXXXXXXXXHQKVRQIREGDLVALPTGSANW 164
            +V QG GI G   PGC ETY                 HQK+R  REGDL+ +P G ++W
Sbjct: 87  IFVAQGFGIRGIAIPGCAETYQTDLRRSQSAGSAFKDQHQKIRPFREGDLLVVPAGVSHW 146
Query: 165 IYNDGPSELVVVALVDVGNSDNQLDQFLRKFYLGGNPQPQLXXXXXXXXXXXXXXXXXXX 224
           +YN G S+LV++   D  N  NQ+D +LRKFYL G P+                      
Sbjct: 147 MYNRGQSDLVLIVFADTRNVANQIDPYLRKFYLAGRPE-------QVERGVEEWERSSRK 199
Query: 225 XXXXXXXXNLFRGFDERLLAEAFNVNPDLISKLQRPQMQKGIIVRVEEELRVLSPQRGRX 284
                   N+F GF +  L EAF ++  L+ KL+    ++  IV+V+E+  VL P++   
Sbjct: 200 GSSGEKSGNIFSGFADEFLEEAFQIDGGLVRKLKGEDDERDRIVQVDEDFEVLLPEKDEE 259
Query: 285 XXXXXXXXXXGS-GDNGIEETICTMKLKHNINDPSGADAYNPRGGRVTTVNRFNLPILRY 343
                      S  +NG+EETICT++LK NI     AD +NPRGGR++T N   LPILR 
Sbjct: 260 ERSRGRYIESESESENGLEETICTLRLKQNIGRSERADVFNPRGGRISTANYHTLPILRQ 319
Query: 344 IQLSAEKGNLYQNAMMAPHWNLNAHSVVYITRGNGRMQIVAENGENVFDGQIREGQLIVV 403
           ++LSAE+G LY NAM+APH+ +N+HSV+Y TRGN R+Q+V   G++VFDG++REGQ++++
Sbjct: 320 VRLSAERGVLYSNAMVAPHYTVNSHSVMYATRGNARVQVVDNFGQSVFDGEVREGQVLMI 379
Query: 404 PQGFAVVKRASNRGLEWISFKTNDVAKTSQLAGRASVIRGLPLDVIQNSFQVSRDEAQRL 463
           PQ F V+KRAS+RG EWI+FKTND A T+ LAGR S +R LPL V+ N +++SR+EAQRL
Sbjct: 380 PQNFVVIKRASDRGFEWIAFKTNDNAITNLLAGRVSQMRMLPLGVLSNMYRISREEAQRL 439
Query: 464 KYNRQELTVFTPGPRSQ 480
           KY +QE+ V +PG RSQ
Sbjct: 440 KYGQQEMRVLSPG-RSQ 455
>pdb|3QAC|A Chain A, Structure Of Amaranth 11s Proglobulin Seed Storage Protein From Amaranthus Hypochondriacus L Length = 465 Back     alignment and structure
>pdb|1FXZ|A Chain A, Crystal Structure Of Soybean Proglycinin A1ab1b Homotrimer Length = 476 Back     alignment and structure
>pdb|1UCX|A Chain A, Crystal Structure Of Proglycinin C12g Mutant Length = 476 Back     alignment and structure
>pdb|1UD1|A Chain A, Crystal Structure Of Proglycinin Mutant C88s Length = 476 Back     alignment and structure
>pdb|3KGL|A Chain A, Crystal Structure Of Procruciferin, 11s Globulin From Brassica Napus Length = 466 Back     alignment and structure
>pdb|3C3V|A Chain A, Crystal Structure Of Peanut Major Allergen Ara H 3 Length = 510 Back     alignment and structure
>pdb|3EHK|A Chain A, Crystal Structure Of Pru Du Amandin, An Allergenic Protein From Prunus Dulcis Length = 531 Back     alignment and structure
>pdb|3KSC|A Chain A, Crystal Structure Of Pea Prolegumin, An 11s Seed Globulin From Pisum Sativum L. Length = 496 Back     alignment and structure
>pdb|2D5F|A Chain A, Crystal Structure Of Recombinant Soybean Proglycinin A3b4 Subunit, Its Comparison With Mature Glycinin A3b4 Subunit, Responsible For Hexamer Assembly Length = 493 Back     alignment and structure
>pdb|1OD5|A Chain A, Crystal Structure Of Glycinin A3b4 Subunit Homohexamer Length = 492 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query480
2e9q_A459 11S globulin subunit beta; cucubitin, pumpkin SEED 1e-147
1fxz_A476 Glycinin G1; proglycinin, legumin, SEED storage pr 1e-145
3qac_A465 11S globulin SEED storage protein; 11S SEED storag 1e-143
3fz3_A531 Prunin; TREE NUT allergen, allergy, amandin, almon 1e-141
3ksc_A496 LEGA class, prolegumin; PEA prolegumin, 11S SEED s 1e-141
3c3v_A510 Arachin ARAH3 isoform; peanut allergen, allergy, g 1e-138
3kgl_A466 Cruciferin; 11S SEED globulin, rapeseed, SEED stor 1e-138
2d5f_A493 Glycinin A3B4 subunit; soybean, globulin, 11S,SEED 1e-133
3s7i_A418 Allergen ARA H 1, clone P41B; bicupin, vicilin, st 6e-88
3s7i_A418 Allergen ARA H 1, clone P41B; bicupin, vicilin, st 2e-08
2ea7_A434 7S globulin-1; beta barrel, cupin superfamily, pla 3e-83
2ea7_A434 7S globulin-1; beta barrel, cupin superfamily, pla 5e-10
2cav_A445 Protein (canavalin); vicilin, 7S SEED protein, dom 3e-80
1uij_A416 Beta subunit of beta conglycinin; double-stranded 2e-73
2phl_A397 Phaseolin; plant SEED storage protein(vicilin); HE 2e-72
2vqa_A361 SLL1358 protein, MNCA; periplasmic binding protein 2e-42
2vqa_A 361 SLL1358 protein, MNCA; periplasmic binding protein 9e-28
1dgw_A178 Canavalin; duplicated swiss-roll beta barrels, loo 7e-37
1dgw_A178 Canavalin; duplicated swiss-roll beta barrels, loo 2e-13
1j58_A385 YVRK protein; cupin, decarboxyklase, oxalate, mang 4e-32
1j58_A 385 YVRK protein; cupin, decarboxyklase, oxalate, mang 5e-30
1j58_A385 YVRK protein; cupin, decarboxyklase, oxalate, mang 3e-04
1fi2_A201 Oxalate oxidase, germin; beta-jellyroll, oxidoredu 2e-27
1dgw_X79 Canavalin; duplicated swiss-roll beta barrels, loo 2e-18
1dgw_Y93 Canavalin; duplicated swiss-roll beta barrels, loo 3e-06
>2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A Length = 459 Back     alignment and structure
 Score =  427 bits (1098), Expect = e-147
 Identities = 212/463 (45%), Positives = 311/463 (67%), Gaps = 12/463 (2%)

Query: 23  QIAQGTDATREQ----RQQQQRFQTQCNIQDLNALEPQQRVESEAGVTEFWDQNDEQLQC 78
           QI Q +    +     +Q + +    C +++L A +P +R E+EAG TE WDQ++++ QC
Sbjct: 1   QIEQQSPWEFQGSEVWQQHRYQSPRACRLENLRAQDPVRRAEAEAGFTEVWDQDNDEFQC 60

Query: 79  ANVAVFRHRIQQRGLVVPSYTNTPELFYVVQGRGIHGAVFPGCPETYQESQQRSSESQSR 138
           A V + RH I+ +GL++P ++N P+L +V QG GI G   PGC ETYQ   +RS  + S 
Sbjct: 61  AGVNMIRHTIRPKGLLLPGFSNAPKLIFVAQGFGIRGIAIPGCAETYQTDLRRSQSAGSA 120

Query: 139 SQDQHQKVRQIREGDLVALPTGSANWIYNDGPSELVVVALVDVGNSDNQLDQFLRKFYLG 198
            +DQHQK+R  REGDL+ +P G ++W+YN G S+LV++   D  N  NQ+D +LRKFYL 
Sbjct: 121 FKDQHQKIRPFREGDLLVVPAGVSHWMYNRGQSDLVLIVFADTRNVANQIDPYLRKFYLA 180

Query: 199 GNPQPQLQGYSQSQGSRYQGSQGGEGGDRSRRGGNLFRGFDERLLAEAFNVNPDLISKLQ 258
           G P+   +G  + + S  +GS G        + GN+F GF +  L EAF ++  L+ KL+
Sbjct: 181 GRPEQVERGVEEWERSSRKGSSG-------EKSGNIFSGFADEFLEEAFQIDGGLVRKLK 233

Query: 259 RPQMQKGIIVRVEEELRVLSPQRGR-EQEQEQEQEFQGSGDNGIEETICTMKLKHNINDP 317
               ++  IV+V+E+  VL P++   E+ + +  E +   +NG+EETICT++LK NI   
Sbjct: 234 GEDDERDRIVQVDEDFEVLLPEKDEEERSRGRYIESESESENGLEETICTLRLKQNIGRS 293

Query: 318 SGADAYNPRGGRVTTVNRFNLPILRYIQLSAEKGNLYQNAMMAPHWNLNAHSVVYITRGN 377
             AD +NPRGGR++T N   LPILR ++LSAE+G LY NAM+APH+ +N+HSV+Y TRGN
Sbjct: 294 ERADVFNPRGGRISTANYHTLPILRQVRLSAERGVLYSNAMVAPHYTVNSHSVMYATRGN 353

Query: 378 GRMQIVAENGENVFDGQIREGQLIVVPQGFAVVKRASNRGLEWISFKTNDVAKTSQLAGR 437
            R+Q+V   G++VFDG++REGQ++++PQ F V+KRAS+RG EWI+FKTND A T+ LAGR
Sbjct: 354 ARVQVVDNFGQSVFDGEVREGQVLMIPQNFVVIKRASDRGFEWIAFKTNDNAITNLLAGR 413

Query: 438 ASVIRGLPLDVIQNSFQVSRDEAQRLKYNRQELTVFTPGPRSQ 480
            S +R LPL V+ N +++SR+EAQRLKY +QE+ V +PG    
Sbjct: 414 VSQMRMLPLGVLSNMYRISREEAQRLKYGQQEMRVLSPGRSQG 456
>1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A Length = 476 Back     alignment and structure
>3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus} Length = 465 Back     alignment and structure
>3fz3_A Prunin; TREE NUT allergen, allergy, amandin, almond, 11S SEED storage protein, allergen; 2.40A {Prunus dulcis} PDB: 3ehk_A Length = 531 Back     alignment and structure
>3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} Length = 496 Back     alignment and structure
>3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} Length = 510 Back     alignment and structure
>3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus} Length = 466 Back     alignment and structure
>3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A Length = 418 Back     alignment and structure
>3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A Length = 418 Back     alignment and structure
>2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A Length = 434 Back     alignment and structure
>2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A Length = 434 Back     alignment and structure
>2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B Length = 445 Back     alignment and structure
>1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* Length = 416 Back     alignment and structure
>2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A* Length = 397 Back     alignment and structure
>2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Length = 361 Back     alignment and structure
>2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Length = 361 Back     alignment and structure
>1dgw_A Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_A 1cau_A 1cav_A 1caw_A 1cax_A Length = 178 Back     alignment and structure
>1dgw_A Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_A 1cau_A 1cav_A 1caw_A 1cax_A Length = 178 Back     alignment and structure
>1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Length = 385 Back     alignment and structure
>1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Length = 385 Back     alignment and structure
>1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Length = 385 Back     alignment and structure
>1fi2_A Oxalate oxidase, germin; beta-jellyroll, oxidoreductase; 1.60A {Hordeum vulgare} SCOP: b.82.1.2 PDB: 2et1_A 2ete_A* 2et7_A Length = 201 Back     alignment and structure
>1dgw_X Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_X Length = 79 Back     alignment and structure
>1dgw_Y Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_Y Length = 93 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query480
3fz3_A531 Prunin; TREE NUT allergen, allergy, amandin, almon 100.0
3qac_A465 11S globulin SEED storage protein; 11S SEED storag 100.0
3ksc_A496 LEGA class, prolegumin; PEA prolegumin, 11S SEED s 100.0
3kgl_A466 Cruciferin; 11S SEED globulin, rapeseed, SEED stor 100.0
2e9q_A459 11S globulin subunit beta; cucubitin, pumpkin SEED 100.0
3c3v_A510 Arachin ARAH3 isoform; peanut allergen, allergy, g 100.0
1fxz_A476 Glycinin G1; proglycinin, legumin, SEED storage pr 100.0
2d5f_A493 Glycinin A3B4 subunit; soybean, globulin, 11S,SEED 100.0
2cav_A445 Protein (canavalin); vicilin, 7S SEED protein, dom 100.0
2ea7_A434 7S globulin-1; beta barrel, cupin superfamily, pla 100.0
3s7i_A418 Allergen ARA H 1, clone P41B; bicupin, vicilin, st 100.0
1uij_A416 Beta subunit of beta conglycinin; double-stranded 100.0
2phl_A397 Phaseolin; plant SEED storage protein(vicilin); HE 100.0
2vqa_A361 SLL1358 protein, MNCA; periplasmic binding protein 100.0
1j58_A385 YVRK protein; cupin, decarboxyklase, oxalate, mang 100.0
1dgw_A178 Canavalin; duplicated swiss-roll beta barrels, loo 100.0
3s7i_A418 Allergen ARA H 1, clone P41B; bicupin, vicilin, st 99.96
1dgw_A178 Canavalin; duplicated swiss-roll beta barrels, loo 99.94
3kgl_A466 Cruciferin; 11S SEED globulin, rapeseed, SEED stor 99.93
3ksc_A496 LEGA class, prolegumin; PEA prolegumin, 11S SEED s 99.93
1uij_A416 Beta subunit of beta conglycinin; double-stranded 99.92
2e9q_A459 11S globulin subunit beta; cucubitin, pumpkin SEED 99.91
3qac_A465 11S globulin SEED storage protein; 11S SEED storag 99.91
2phl_A 397 Phaseolin; plant SEED storage protein(vicilin); HE 99.91
3fz3_A531 Prunin; TREE NUT allergen, allergy, amandin, almon 99.9
2ea7_A434 7S globulin-1; beta barrel, cupin superfamily, pla 99.9
2cav_A445 Protein (canavalin); vicilin, 7S SEED protein, dom 99.9
1fi2_A201 Oxalate oxidase, germin; beta-jellyroll, oxidoredu 99.89
2d5f_A 493 Glycinin A3B4 subunit; soybean, globulin, 11S,SEED 99.89
3c3v_A510 Arachin ARAH3 isoform; peanut allergen, allergy, g 99.88
1fxz_A476 Glycinin G1; proglycinin, legumin, SEED storage pr 99.88
1dgw_Y93 Canavalin; duplicated swiss-roll beta barrels, loo 99.85
2d40_A354 Z3393, putative gentisate 1,2-dioxygenase; gentisi 99.85
1dgw_X79 Canavalin; duplicated swiss-roll beta barrels, loo 99.84
2vqa_A 361 SLL1358 protein, MNCA; periplasmic binding protein 99.84
1fi2_A201 Oxalate oxidase, germin; beta-jellyroll, oxidoredu 99.79
1y3t_A337 Hypothetical protein YXAG; BI cupin, dioxygenase, 99.73
1j58_A 385 YVRK protein; cupin, decarboxyklase, oxalate, mang 99.71
3bu7_A394 Gentisate 1,2-dioxygenase; cupin domain, oxidoredu 99.65
1rc6_A261 Hypothetical protein YLBA; structural genomics, NY 99.61
1juh_A350 Quercetin 2,3-dioxygenase; cupin, glycoprotein, be 99.58
3nw4_A368 Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc 99.55
1sef_A274 Conserved hypothetical protein; structural genomic 99.54
3h7j_A243 Bacilysin biosynthesis protein BACB; YWFC, bacilys 99.53
3rns_A227 Cupin 2 conserved barrel domain protein; structura 99.48
1sq4_A278 GLXB, glyoxylate-induced protein; structural genom 99.45
1dgw_Y93 Canavalin; duplicated swiss-roll beta barrels, loo 99.4
1sfn_A246 Conserved hypothetical protein; structural genomic 99.37
4e2q_A266 Ureidoglycine aminohydrolase; BI-cupin, manganese 99.31
1dgw_X79 Canavalin; duplicated swiss-roll beta barrels, loo 99.24
3ibm_A167 Cupin 2, conserved barrel domain protein; cupin 2 99.11
1lr5_A163 Auxin binding protein 1; beta jellyroll, double st 99.11
3h8u_A125 Uncharacterized conserved protein with double-STR 99.04
3kgz_A156 Cupin 2 conserved barrel domain protein; metallopr 99.01
3l2h_A162 Putative sugar phosphate isomerase; AFE_0303, stru 98.99
3ht1_A145 REMF protein; cupin fold, Zn-binding, antibiotic b 98.95
1v70_A105 Probable antibiotics synthesis protein; structural 98.95
3jzv_A166 Uncharacterized protein RRU_A2000; structural geno 98.95
2b8m_A117 Hypothetical protein MJ0764; structural genomics, 98.92
2gu9_A113 Tetracenomycin polyketide synthesis protein; X-RAY 98.92
3h8u_A125 Uncharacterized conserved protein with double-STR 98.9
3fjs_A114 Uncharacterized protein with RMLC-like cupin fold; 98.9
2oa2_A148 BH2720 protein; 10175341, structural genomics, joi 98.88
2oa2_A148 BH2720 protein; 10175341, structural genomics, joi 98.87
1x82_A190 Glucose-6-phosphate isomerase; cupin superfamily, 98.87
2fqp_A97 Hypothetical protein BP2299; double-stranded beta- 98.86
1o4t_A133 Putative oxalate decarboxylase; double-stranded be 98.86
3l2h_A162 Putative sugar phosphate isomerase; AFE_0303, stru 98.85
4e2g_A126 Cupin 2 conserved barrel domain protein; MCSG, PSI 98.85
4i4a_A128 Similar to unknown protein; structural genomics, P 98.84
1v70_A105 Probable antibiotics synthesis protein; structural 98.84
1vj2_A126 Novel manganese-containing cupin TM1459; structura 98.83
1lr5_A163 Auxin binding protein 1; beta jellyroll, double st 98.81
2bnm_A198 Epoxidase; oxidoreductase, cupin, HTH, cation-depe 98.81
3i7d_A163 Sugar phosphate isomerase; YP_168127.1, structural 98.8
2f4p_A147 Hypothetical protein TM1010; double-stranded beta- 98.8
3lag_A98 Uncharacterized protein RPA4178; functionally unkn 98.79
2ozi_A98 Hypothetical protein RPA4178; APC6210, putative pr 98.77
1sef_A274 Conserved hypothetical protein; structural genomic 98.77
1x82_A190 Glucose-6-phosphate isomerase; cupin superfamily, 98.77
3cew_A125 Uncharacterized cupin protein; all beta-protein, j 98.77
2gu9_A113 Tetracenomycin polyketide synthesis protein; X-RAY 98.75
2d40_A354 Z3393, putative gentisate 1,2-dioxygenase; gentisi 98.75
3ibm_A167 Cupin 2, conserved barrel domain protein; cupin 2 98.74
3kgz_A156 Cupin 2 conserved barrel domain protein; metallopr 98.73
1yhf_A115 Hypothetical protein SPY1581; structural genomics, 98.72
2pfw_A116 Cupin 2, conserved barrel domain protein; cupin do 98.71
4e2q_A266 Ureidoglycine aminohydrolase; BI-cupin, manganese 98.7
1rc6_A261 Hypothetical protein YLBA; structural genomics, NY 98.7
4e2g_A126 Cupin 2 conserved barrel domain protein; MCSG, PSI 98.69
2xlg_A239 SLL1785 protein, CUCA; metal binding protein, cupi 98.69
3i7d_A163 Sugar phosphate isomerase; YP_168127.1, structural 98.67
2xlg_A239 SLL1785 protein, CUCA; metal binding protein, cupi 98.66
2o8q_A134 Hypothetical protein; cpuin-like fold, structural 98.66
3es1_A172 Cupin 2, conserved barrel domain protein; YP_00116 98.66
1y9q_A192 Transcriptional regulator, HTH_3 family; transcrip 98.65
1sfn_A246 Conserved hypothetical protein; structural genomic 98.65
1sq4_A278 GLXB, glyoxylate-induced protein; structural genom 98.64
3lwc_A119 Uncharacterized protein; structural genomics, unkn 98.63
2f4p_A147 Hypothetical protein TM1010; double-stranded beta- 98.62
2pfw_A116 Cupin 2, conserved barrel domain protein; cupin do 98.62
2o8q_A134 Hypothetical protein; cpuin-like fold, structural 98.61
2b8m_A117 Hypothetical protein MJ0764; structural genomics, 98.61
3jzv_A166 Uncharacterized protein RRU_A2000; structural geno 98.61
3lwc_A119 Uncharacterized protein; structural genomics, unkn 98.61
4i4a_A128 Similar to unknown protein; structural genomics, P 98.59
3lag_A98 Uncharacterized protein RPA4178; functionally unkn 98.59
2fqp_A97 Hypothetical protein BP2299; double-stranded beta- 98.59
3bu7_A394 Gentisate 1,2-dioxygenase; cupin domain, oxidoredu 98.57
2opk_A112 Hypothetical protein; putative mannose-6-phosphate 98.56
2q30_A110 Uncharacterized protein; double-stranded beta-heli 98.56
3cew_A125 Uncharacterized cupin protein; all beta-protein, j 98.56
3ht1_A145 REMF protein; cupin fold, Zn-binding, antibiotic b 98.56
1o4t_A133 Putative oxalate decarboxylase; double-stranded be 98.55
1vj2_A126 Novel manganese-containing cupin TM1459; structura 98.54
3myx_A238 Uncharacterized protein pspto_0244; protein of unk 98.53
3h7j_A243 Bacilysin biosynthesis protein BACB; YWFC, bacilys 98.52
2ozj_A114 Cupin 2, conserved barrel; cupin superfamily prote 98.52
1yhf_A115 Hypothetical protein SPY1581; structural genomics, 98.51
2bnm_A198 Epoxidase; oxidoreductase, cupin, HTH, cation-depe 98.5
3fjs_A114 Uncharacterized protein with RMLC-like cupin fold; 98.46
1y3t_A 337 Hypothetical protein YXAG; BI cupin, dioxygenase, 98.46
2vpv_A166 Protein MIF2, MIF2P; nucleus, mitosis, centromere, 98.45
3rns_A227 Cupin 2 conserved barrel domain protein; structura 98.42
2q30_A110 Uncharacterized protein; double-stranded beta-heli 98.4
4h7l_A157 Uncharacterized protein; structural genomics, PSI- 98.38
2pyt_A133 Ethanolamine utilization protein EUTQ; structural 98.32
2pyt_A133 Ethanolamine utilization protein EUTQ; structural 98.31
2ozj_A114 Cupin 2, conserved barrel; cupin superfamily prote 98.31
2ozi_A98 Hypothetical protein RPA4178; APC6210, putative pr 98.3
4b29_A217 Dimethylsulfoniopropionate lyase; hydrolase, dimet 98.3
4axo_A151 EUTQ, ethanolamine utilization protein; structural 98.29
2i45_A107 Hypothetical protein; neisseria meningitidis cupin 98.28
2i45_A107 Hypothetical protein; neisseria meningitidis cupin 98.28
3d82_A102 Cupin 2, conserved barrel domain protein; structur 98.27
3d82_A102 Cupin 2, conserved barrel domain protein; structur 98.26
1y9q_A192 Transcriptional regulator, HTH_3 family; transcrip 98.26
2vpv_A166 Protein MIF2, MIF2P; nucleus, mitosis, centromere, 98.2
1vr3_A191 Acireductone dioxygenase; 13543033, structural gen 98.19
1juh_A 350 Quercetin 2,3-dioxygenase; cupin, glycoprotein, be 98.17
4axo_A151 EUTQ, ethanolamine utilization protein; structural 98.17
1vr3_A191 Acireductone dioxygenase; 13543033, structural gen 98.15
4h7l_A157 Uncharacterized protein; structural genomics, PSI- 98.14
1zrr_A179 E-2/E-2' protein; nickel, cupin, beta helix, methi 98.11
1o5u_A101 Novel thermotoga maritima enzyme TM1112; cupin, st 98.06
3es1_A172 Cupin 2, conserved barrel domain protein; YP_00116 98.02
3nw4_A368 Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc 98.02
3bcw_A123 Uncharacterized protein; structural genomics, join 97.97
2opk_A112 Hypothetical protein; putative mannose-6-phosphate 97.94
3o14_A223 Anti-ecfsigma factor, CHRR; cupin, structural geno 97.92
3st7_A369 Capsular polysaccharide synthesis enzyme CAP5F; ro 97.86
1zrr_A179 E-2/E-2' protein; nickel, cupin, beta helix, methi 97.86
4b29_A217 Dimethylsulfoniopropionate lyase; hydrolase, dimet 97.82
3st7_A369 Capsular polysaccharide synthesis enzyme CAP5F; ro 97.82
3ebr_A159 Uncharacterized RMLC-like cupin; structural genomi 97.74
2o1q_A145 Putative acetyl/propionyl-COA carboxylase, alpha; 97.69
3bcw_A123 Uncharacterized protein; structural genomics, join 97.69
2q1z_B195 Anti-sigma factor CHRR, transcriptional activator; 97.63
1o5u_A101 Novel thermotoga maritima enzyme TM1112; cupin, st 97.62
3cjx_A165 Protein of unknown function with A cupin-like FOL; 97.59
2arc_A164 ARAC, arabinose operon regulatory protein; transcr 97.57
1yfu_A174 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxid 97.54
3d0j_A140 Uncharacterized protein CA_C3497; beta-barrel, str 97.53
2o1q_A145 Putative acetyl/propionyl-COA carboxylase, alpha; 97.5
2y0o_A175 Probable D-lyxose ketol-isomerase; carbohydrate me 97.47
3ebr_A159 Uncharacterized RMLC-like cupin; structural genomi 97.47
1zvf_A176 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll b 97.38
2q1z_B195 Anti-sigma factor CHRR, transcriptional activator; 97.34
1yfu_A174 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxid 97.26
2y0o_A175 Probable D-lyxose ketol-isomerase; carbohydrate me 97.14
2pa7_A141 DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysug 97.13
1yud_A170 Hypothetical protein SO0799; SOR12, Q8E1N8, PSI, p 97.03
1zvf_A176 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll b 97.03
3ejk_A174 DTDP sugar isomerase; YP_390184.1, structural geno 96.98
2arc_A164 ARAC, arabinose operon regulatory protein; transcr 96.96
3cjx_A165 Protein of unknown function with A cupin-like FOL; 96.96
1yud_A170 Hypothetical protein SO0799; SOR12, Q8E1N8, PSI, p 96.85
3es4_A116 Uncharacterized protein DUF861 with A RMLC-like C; 96.8
2qnk_A 286 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fol 96.76
3myx_A238 Uncharacterized protein pspto_0244; protein of unk 96.72
3es4_A116 Uncharacterized protein DUF861 with A RMLC-like C; 96.6
3eqe_A171 Putative cystein deoxygenase; YUBC, SR112, NESG, s 96.57
2qnk_A286 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fol 96.52
3eqe_A171 Putative cystein deoxygenase; YUBC, SR112, NESG, s 96.43
3o14_A223 Anti-ecfsigma factor, CHRR; cupin, structural geno 96.4
3bal_A153 Acetylacetone-cleaving enzyme; jelly roll, tetrame 96.39
3d0j_A140 Uncharacterized protein CA_C3497; beta-barrel, str 96.37
2gm6_A208 Cysteine dioxygenase type I; structural genomics, 96.37
3bal_A153 Acetylacetone-cleaving enzyme; jelly roll, tetrame 96.25
2gm6_A208 Cysteine dioxygenase type I; structural genomics, 96.16
3gbg_A276 TCP pilus virulence regulatory protein; cupin, hel 95.96
3ejk_A174 DTDP sugar isomerase; YP_390184.1, structural geno 95.8
1ep0_A185 DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; race 95.75
1wlt_A196 176AA long hypothetical DTDP-4-dehydrorhamnose 3, 95.7
1nxm_A197 DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; jell 95.62
1dzr_A183 DTDP-4-dehydrorhamnose 3\,5-epimerase; isomerase, 95.59
3gbg_A 276 TCP pilus virulence regulatory protein; cupin, hel 95.57
2ixk_A184 DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, l 95.56
3ryk_A205 DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pat 95.55
4hn1_A201 Putative 3-epimerase in D-allose pathway; 3'-monoe 95.36
1oi6_A205 PCZA361.16; epimerase, vancomycin group antibiotic 95.29
4gjz_A235 Lysine-specific demethylase 8; JMJC, beta barrel, 95.19
1vrb_A342 Putative asparaginyl hydroxylase; 2636534, structu 95.07
2c0z_A216 NOVW; isomerase, epimerase, antibiotic biosynthesi 94.92
2xdv_A 442 MYC-induced nuclear antigen; ribosome biogenesis, 94.75
3eln_A200 Cysteine dioxygenase type 1; peroxysulfenate, non- 94.64
1upi_A225 DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pat 94.64
3d8c_A349 Hypoxia-inducible factor 1 alpha inhibitor; FIH, H 94.53
1e5r_A290 Proline oxidase; oxidoreductase, oxygenase, 2-oxog 94.19
3bb6_A127 Uncharacterized protein YEAR; structural genomics, 94.12
1nxm_A197 DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; jell 93.8
4diq_A 489 Lysine-specific demethylase NO66; structural genom 93.72
3eln_A200 Cysteine dioxygenase type 1; peroxysulfenate, non- 93.71
4gjz_A235 Lysine-specific demethylase 8; JMJC, beta barrel, 93.6
1vrb_A342 Putative asparaginyl hydroxylase; 2636534, structu 93.57
3al5_A338 HTYW5, JMJC domain-containing protein C2ORF60; tRN 93.49
3loi_A172 Putative uncharacterized protein; beta barrel, unk 93.07
2pa7_A141 DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysug 92.28
1oi6_A205 PCZA361.16; epimerase, vancomycin group antibiotic 91.59
3k2o_A336 Bifunctional arginine demethylase and lysyl-hydro 91.45
3ryk_A205 DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pat 91.17
1dzr_A183 DTDP-4-dehydrorhamnose 3\,5-epimerase; isomerase, 91.02
1ep0_A185 DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; race 90.91
1wlt_A196 176AA long hypothetical DTDP-4-dehydrorhamnose 3, 90.72
1xe7_A203 YML079WP, hypothetical 22.5 kDa protein in TUB1-CP 90.71
2ixk_A184 DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, l 90.6
3uss_A211 Putative uncharacterized protein; cupin, three his 90.13
1upi_A225 DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pat 90.03
4hn1_A201 Putative 3-epimerase in D-allose pathway; 3'-monoe 89.77
3d8c_A349 Hypoxia-inducible factor 1 alpha inhibitor; FIH, H 89.54
4diq_A489 Lysine-specific demethylase NO66; structural genom 89.35
2c0z_A216 NOVW; isomerase, epimerase, antibiotic biosynthesi 89.22
3al5_A338 HTYW5, JMJC domain-containing protein C2ORF60; tRN 89.19
2xdv_A442 MYC-induced nuclear antigen; ribosome biogenesis, 89.09
3kv4_A447 PHD finger protein 8; epigenetics, histone CODE, c 88.71
2yu1_A451 JMJC domain-containing histone demethylation PROT; 88.55
3kv5_D488 JMJC domain-containing histone demethylation prote 88.39
3uss_A211 Putative uncharacterized protein; cupin, three his 88.34
3k3o_A371 PHF8, PHD finger protein 8; histone demethylase, c 88.31
3rcq_A197 Aspartyl/asparaginyl beta-hydroxylase; structural 87.74
3kv4_A447 PHD finger protein 8; epigenetics, histone CODE, c 87.62
2vec_A256 YHAK, pirin-like protein YHAK; ROS, bicupin, sulfe 87.59
3k2o_A336 Bifunctional arginine demethylase and lysyl-hydro 87.46
1eyb_A471 Homogentisate 1,2-dioxygenase; jelly roll, beta sa 87.33
3kv9_A397 JMJC domain-containing histone demethylation prote 87.24
3m3i_A225 Putative uncharacterized protein; PFAM:PF06172, st 87.09
3kv9_A397 JMJC domain-containing histone demethylation prote 87.09
2qdr_A303 Uncharacterized protein; double-stranded beta-heli 86.79
2yu1_A451 JMJC domain-containing histone demethylation PROT; 86.44
3pua_A392 GRC5, PHD finger protein 2; alpha-ketoglutarate-Fe 86.44
3pua_A392 GRC5, PHD finger protein 2; alpha-ketoglutarate-Fe 85.96
3kv5_D488 JMJC domain-containing histone demethylation prote 85.87
3k3o_A371 PHF8, PHD finger protein 8; histone demethylase, c 85.4
1znp_A154 Hypothetical protein ATU3615; NESG, ATR55, Q8U9W0, 83.75
1pmi_A440 PMI, phosphomannose isomerase; aldose-ketose isome 83.27
2p17_A277 Pirin-like protein; GK1651, structural genomics, s 83.0
2qjv_A270 Uncharacterized IOLB-like protein; structural geno 82.78
3pur_A528 Lysine-specific demethylase 7 homolog; oxidoreduct 81.19
3pur_A528 Lysine-specific demethylase 7 homolog; oxidoreduct 80.43
>3fz3_A Prunin; TREE NUT allergen, allergy, amandin, almond, 11S SEED storage protein, allergen; 2.40A {Prunus dulcis} PDB: 3ehk_A Back     alignment and structure
Probab=100.00  E-value=3.7e-114  Score=916.25  Aligned_cols=440  Identities=48%  Similarity=0.834  Sum_probs=373.7

Q ss_pred             hcccCcccccccCCCCCCcceecCCceEEEeCCCChhccccCeeEEEEEEcCCeeecCcccCCCeEEEEEeceEEEEEEc
Q 048197           39 QRFQTQCNIQDLNALEPQQRVESEAGVTEFWDQNDEQLQCANVAVFRHRIQQRGLVVPSYTNTPELFYVVQGRGIHGAVF  118 (480)
Q Consensus        39 ~~~~~~C~~~~L~a~eP~~~~~se~G~~e~~~~~~~~l~~~gvs~~r~~i~p~gl~lPh~~~a~el~yV~~G~g~~g~v~  118 (480)
                      ...+++|+|++|+|++|+++|+||||.||+||+++|+|+|+||+++|++|.|+||++||||+|++++||++|++++|+|+
T Consensus         6 ~~~~~~C~~~~l~a~eP~~~i~se~G~~e~w~~~~p~l~~~Gvs~~R~~i~p~Gl~lPh~~~a~el~yV~qG~g~~G~v~   85 (531)
T 3fz3_A            6 LSPQNQCQLNQLQAREPDNRIQAEAGQIETWNFNQGDFQCAGVAASRITIQRNGLHLPSYSNAPQLIYIVQGRGVLGAVF   85 (531)
T ss_dssp             -CTTTTTCCCCCCCBCCCEEEEETTEEEEECCTTSHHHHHHTEEEEEEEECTTEEEEEEEESSCEEEEEEECEEEEEECC
T ss_pred             ccccccccccccCcCCCchhcccCCceEEEeCCCChhhccCcceEEEEEecCCCEeCCccCCCCeEEEEEECcEEEEEEc
Confidence            45678999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCccchhhhhhccc----------------------------------------------------------ccccccc
Q 048197          119 PGCPETYQESQQRSS----------------------------------------------------------ESQSRSQ  140 (480)
Q Consensus       119 pg~~etf~~~~~~~~----------------------------------------------------------~~~~~~~  140 (480)
                      |||||||+++++++.                                                          +++++++
T Consensus        86 Pgcpet~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  165 (531)
T 3fz3_A           86 SGCPETFEESQQSSQQGRQQEQEQERQQQQQGEQGRQQGQQEQQQERQGRQQGRQQQEEGRQQEQQQGQQGRPQQQQQFR  165 (531)
T ss_dssp             TTCCCCEECCCC-------------------------------------------------------------------C
T ss_pred             CCCccccccccccccccccccccccccccccccccccccccccccccccccccchhcccccccccccccccccccccccc
Confidence            999999976552100                                                          0123455


Q ss_pred             --cccceeEeecCCcEEEeCCCCEEEEEcCCCCcEEEEEEeeCCCCCccccccceeeeecCCCCcCccccccccCcc--c
Q 048197          141 --DQHQKVRQIREGDLVALPTGSANWIYNDGPSELVVVALVDVGNSDNQLDQFLRKFYLGGNPQPQLQGYSQSQGSR--Y  216 (480)
Q Consensus       141 --d~~qk~~~l~~GDV~~iPaG~~h~~~N~G~~~l~~v~~~d~~n~~nqld~~~~~F~LaG~~~~~~~~~~~~~~~~--~  216 (480)
                        |+||||++|++||||+||+|++||+||+||++|++|+++||+|.+||||++||.||||||++++++.+++.++++  +
T Consensus       166 ~~d~hqkv~~vr~GDviaiPaG~~~w~yN~G~~~l~iv~~~Dt~n~~NQld~~~r~F~LAGn~~~~~~~~~~~~~~~~~~  245 (531)
T 3fz3_A          166 QLDRHQKTRRIREGDVVAIPAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNPRKFYLAGNPENEFNQQGQSQPRQQGE  245 (531)
T ss_dssp             CSCEESCCEEEETTEEEEECTTCCEEEECCSSSCEEEEEEEETTCTTCCSCSSCCEEESSSCCCCTTCC-----------
T ss_pred             ccccceeeecccCCcEEEECCCCeEEEEeCCCceEEEEEEEccccccccCCCccceeEEcCCCccccccccccccccccc
Confidence              999999999999999999999999999999999999999999999999999999999999887655442211110  1


Q ss_pred             c----CCCCCCCC----CcccccCcccccCCHHHHHhhcCCCHHHHHHhccccccceeEEEeccceeccCCcccchhhH-
Q 048197          217 Q----GSQGGEGG----DRSRRGGNLFRGFDERLLAEAFNVNPDLISKLQRPQMQKGIIVRVEEELRVLSPQRGREQEQ-  287 (480)
Q Consensus       217 ~----g~~~~~~~----~~~~~~~ni~~gf~~~~La~af~v~~~~~~kl~~~~~~rg~Iv~v~~~l~~~~P~~~~~~e~-  287 (480)
                      +    ++++++++    +++...+|||+||++++||+||||+.++|+||++++|+||.||||+++|++++|+..+++++ 
T Consensus       246 ~~~~~~~~~~~~~~~~~~~~~~~~nifsGFs~e~La~A~~v~~~~a~kLq~~~~~rg~IVrv~~~l~~~~P~~~~~~~~~  325 (531)
T 3fz3_A          246 QGRPGQHQQPFGRPRQQEQQGNGNNVFSGFNTQLLAQALNVNEETARNLQGQNDNRNQIIQVRGNLDFVQPPRGRQEREH  325 (531)
T ss_dssp             ---------------------CCSSGGGGSCHHHHHHHHTSCHHHHHHHHTSSCCSCSEEECSSSCCCSCCC--------
T ss_pred             ccccccccccccccchhhhcccCCCeeecCCHHHHHHHHCCCHHHHHHHhcccccCceEEEecCCCcccCCchhhhhhhh
Confidence            1    11212221    12224589999999999999999999999999999999999999999999999986443211 


Q ss_pred             -----HHhhh-----hcCCCCCCCccceeccccccCCCCCCCCCcccCCCeEEEEEecCCCCcccccceeEEeeeecccc
Q 048197          288 -----EQEQE-----FQGSGDNGIEETICTMKLKHNINDPSGADAYNPRGGRVTTVNRFNLPILRYIQLSAEKGNLYQNA  357 (480)
Q Consensus       288 -----~~~~~-----~~~~~~nG~ee~~~~~~l~~ni~~p~~~~~~~~~~G~i~~~~~~~~P~L~~l~lsa~~v~L~pga  357 (480)
                           +++.+     .+....||||||+|+||+++||++|+++|+|++.+|+++++|+.+||+|++|+||+++++|+|||
T Consensus       326 ~~~~~~~~~~~~~~~~~~~~~nGleet~c~~rl~~Ni~~ps~~d~~n~~GG~v~~a~~~~fP~L~~LgiS~a~v~L~pGg  405 (531)
T 3fz3_A          326 EERQQEQLQQERQQQGEQLMANGLEETFCSLRLKENIGNPERADIFSPRAGRISTLNSHNLPILRFLRLSAERGFFYRNG  405 (531)
T ss_dssp             ----------------------CGGGTGGGCCCEEECCCGGGCSEEETTTEEEEEESTTTCTHHHHHTCEEEEEEECTTC
T ss_pred             cccccccccccccccccccCCCCcccccccceeeeccCCcccCCcccCCCeEEEEeccccCCccccCceeEEEEEeecCc
Confidence                 11110     11134699999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccccccCCceEEEEEEeeEEEEEEecCCceEEeeecCCccEEEECCCcEEEEEcCCCCeEEEEEEecCCCcceeeccc
Q 048197          358 MMAPHWNLNAHSVVYITRGNGRMQIVAENGENVFDGQIREGQLIVVPQGFAVVKRASNRGLEWISFKTNDVAKTSQLAGR  437 (480)
Q Consensus       358 m~~PHwh~nA~ei~yV~~G~grv~vv~~~G~~~f~~~l~~GdV~vVPqg~~~~~~ag~e~l~~v~f~ts~~~~~~~LAG~  437 (480)
                      |++|||||+|+||+||++|+++|+||+++|+++|+.+|++|||+|||+|++|++++++++++|++|+++++|+.++|||+
T Consensus       406 m~~PHwHp~A~Ei~yVl~G~~rv~~V~~~G~~v~~~~L~~GDV~v~P~G~~H~~~ag~e~l~flaF~ss~np~~~~LaG~  485 (531)
T 3fz3_A          406 IYSPHWNVNAHSVVYVIRGNARVQVVNENGDAILDQEVQQGQLFIVPQNHGVIQQAGNQGFEYFAFKTEENAFINTLAGR  485 (531)
T ss_dssp             EEEEEEESSCCEEEEEEEEEEEEEEECTTSCEEEEEEEETTCEEEECTTCEEEEEEEEEEEEEEEEESSTTCCEEESSST
T ss_pred             cccceEcCCCCEEEEEEeCcEEEEEEeCCCcEEEEEEecCCeEEEECCCCeEEEecCCCCEEEEEEecCCCCcceeccch
Confidence            99999999999999999999999999999999999999999999999999999998888999999999899999999999


Q ss_pred             cccccCCCHHHHHHHcCCCHHHHHHHHhcCCCeEEeCCCCC
Q 048197          438 ASVIRGLPLDVIQNSFQVSRDEAQRLKYNRQELTVFTPGPR  478 (480)
Q Consensus       438 ~svl~~lp~eVla~af~vs~e~~~~l~~~q~e~~i~~p~~~  478 (480)
                      ++||++||.+||+++|+++++++++|++++++++||+|+++
T Consensus       486 ~svf~~lP~eVLa~aF~v~~e~v~kLk~~~~es~i~~pp~~  526 (531)
T 3fz3_A          486 TSFLRALPDEVLANAYQISREQARQLKYNRQETIALSSSQQ  526 (531)
T ss_dssp             TCHHHHSCHHHHHHHHTCCHHHHHHHHHSCCCSSEECC---
T ss_pred             hHHHHhCCHHHHHHHhCcCHHHHHHHHhcCCCceEECCCCC
Confidence            99999999999999999999999999999999999977554
>3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus} Back     alignment and structure
>3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} Back     alignment and structure
>3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus} Back     alignment and structure
>2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A Back     alignment and structure
>3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} Back     alignment and structure
>1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A Back     alignment and structure
>2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B Back     alignment and structure
>2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A Back     alignment and structure
>3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A Back     alignment and structure
>1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* Back     alignment and structure
>2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A* Back     alignment and structure
>2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Back     alignment and structure
>1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Back     alignment and structure
>1dgw_A Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_A 1cau_A 1cav_A 1caw_A 1cax_A Back     alignment and structure
>3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A Back     alignment and structure
>1dgw_A Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_A 1cau_A 1cav_A 1caw_A 1cax_A Back     alignment and structure
>3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus} Back     alignment and structure
>3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} Back     alignment and structure
>1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* Back     alignment and structure
>2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A Back     alignment and structure
>3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus} Back     alignment and structure
>2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A* Back     alignment and structure
>3fz3_A Prunin; TREE NUT allergen, allergy, amandin, almond, 11S SEED storage protein, allergen; 2.40A {Prunus dulcis} PDB: 3ehk_A Back     alignment and structure
>2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A Back     alignment and structure
>2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B Back     alignment and structure
>1fi2_A Oxalate oxidase, germin; beta-jellyroll, oxidoreductase; 1.60A {Hordeum vulgare} SCOP: b.82.1.2 PDB: 2et1_A 2ete_A* 2et7_A Back     alignment and structure
>2d5f_A Glycinin A3B4 subunit; soybean, globulin, 11S,SEED storage protein, plant; 1.90A {Glycine max} PDB: 2d5h_A 1od5_A Back     alignment and structure
>3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} Back     alignment and structure
>1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A Back     alignment and structure
>1dgw_Y Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_Y Back     alignment and structure
>2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 Back     alignment and structure
>1dgw_X Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_X Back     alignment and structure
>2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Back     alignment and structure
>1fi2_A Oxalate oxidase, germin; beta-jellyroll, oxidoreductase; 1.60A {Hordeum vulgare} SCOP: b.82.1.2 PDB: 2et1_A 2ete_A* 2et7_A Back     alignment and structure
>1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* Back     alignment and structure
>1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Back     alignment and structure
>3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 Back     alignment and structure
>1rc6_A Hypothetical protein YLBA; structural genomics, NYSGXRC, SGX clone NAME 3174C1TCT3B1, T T1521, PSI, protein initiative; 2.60A {Escherichia coli} SCOP: b.82.1.11 Back     alignment and structure
>1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* Back     alignment and structure
>3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* 4fag_A* 4fbf_A 4fah_A Back     alignment and structure
>1sef_A Conserved hypothetical protein; structural genomics, nysgxrc target T1582, PSI, protein STRU initiative; 2.05A {Enterococcus faecalis} SCOP: b.82.1.11 Back     alignment and structure
>3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* Back     alignment and structure
>3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} Back     alignment and structure
>1sq4_A GLXB, glyoxylate-induced protein; structural genomics, double beta barrel protein, PSI, protei structure initiative; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.11 Back     alignment and structure
>1dgw_Y Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_Y Back     alignment and structure
>1sfn_A Conserved hypothetical protein; structural genomics, nysgxrc target T1583, PSI, protein STRU initiative; 2.46A {Deinococcus radiodurans} SCOP: b.82.1.11 Back     alignment and structure
>4e2q_A Ureidoglycine aminohydrolase; BI-cupin, manganese binding, endoplasmic RET hydrolase; 2.50A {Arabidopsis thaliana} PDB: 4e2s_A Back     alignment and structure
>1dgw_X Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_X Back     alignment and structure
>3ibm_A Cupin 2, conserved barrel domain protein; cupin 2 family, metal-binding site, beta barrel, PSI-2, NYSG structural genomics; 2.00A {Halorhodospira halophila SL1} Back     alignment and structure
>1lr5_A Auxin binding protein 1; beta jellyroll, double stranded beta helix, germin-like PROT protein binding; HET: NAG BMA MAN; 1.90A {Zea mays} SCOP: b.82.1.2 PDB: 1lrh_A* Back     alignment and structure
>3h8u_A Uncharacterized conserved protein with double-STR beta-helix domain; YP_001338853.1; HET: 2PE; 1.80A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3kgz_A Cupin 2 conserved barrel domain protein; metalloprotein, structural genomics, PSI-2, protein structur initiative; 1.85A {Rhodopseudomonas palustris} Back     alignment and structure
>3l2h_A Putative sugar phosphate isomerase; AFE_0303, structural GEN joint center for structural genomics, JCSG; HET: MSE CXS; 1.85A {Acidithiobacillus ferrooxidans} Back     alignment and structure
>3ht1_A REMF protein; cupin fold, Zn-binding, antibiotic biosynthesis, resistomycin, metalloprotein, cyclase, lyase; 1.20A {Streptomyces resistomycificus} PDB: 3ht2_A Back     alignment and structure
>1v70_A Probable antibiotics synthesis protein; structural genomics, thermus thermophilus HB8, riken structu genomics/proteomics initiative, RSGI; 1.30A {Thermus thermophilus} SCOP: b.82.1.9 PDB: 2dct_A Back     alignment and structure
>3jzv_A Uncharacterized protein RRU_A2000; structural genomics, cupin-2 fold, unknown function, PSI-2, structure initiative; HET: MSE; 2.30A {Rhodospirillum rubrum} Back     alignment and structure
>2b8m_A Hypothetical protein MJ0764; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.70A {Methanocaldococcus jannaschii} SCOP: b.82.1.18 Back     alignment and structure
>2gu9_A Tetracenomycin polyketide synthesis protein; X-RAY diffraction, cupin, immune system; 1.40A {Xanthomonas campestris} PDB: 2ilb_A 3h50_A Back     alignment and structure
>3h8u_A Uncharacterized conserved protein with double-STR beta-helix domain; YP_001338853.1; HET: 2PE; 1.80A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3fjs_A Uncharacterized protein with RMLC-like cupin fold; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.90A {Ralstonia eutropha JMP134} Back     alignment and structure
>2oa2_A BH2720 protein; 10175341, structural genomics, joint center for STRU genomics, JCSG, protein structure initiative, PSI-2, unknow function; HET: MSE; 1.41A {Bacillus halodurans} Back     alignment and structure
>2oa2_A BH2720 protein; 10175341, structural genomics, joint center for STRU genomics, JCSG, protein structure initiative, PSI-2, unknow function; HET: MSE; 1.41A {Bacillus halodurans} Back     alignment and structure
>1x82_A Glucose-6-phosphate isomerase; cupin superfamily, hyperthermophIle, phosphoglucose isomerase, extremeophIle; HET: PA5; 1.50A {Pyrococcus furiosus} SCOP: b.82.1.7 PDB: 1x7n_A* 1x8e_A 1qxr_A* 1qxj_A* 1qy4_A* 2gc1_A* 2gc0_A* 2gc2_A* 2gc3_A* 3sxw_A 1j3q_A 1j3p_A 1j3r_A* Back     alignment and structure
>2fqp_A Hypothetical protein BP2299; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: 1PE; 1.80A {Bordetella pertussis tohama I} Back     alignment and structure
>1o4t_A Putative oxalate decarboxylase; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; 1.95A {Thermotoga maritima} SCOP: b.82.1.9 Back     alignment and structure
>3l2h_A Putative sugar phosphate isomerase; AFE_0303, structural GEN joint center for structural genomics, JCSG; HET: MSE CXS; 1.85A {Acidithiobacillus ferrooxidans} Back     alignment and structure
>4e2g_A Cupin 2 conserved barrel domain protein; MCSG, PSI-biology, structural genomics, GEBA, midwest center structural genomics; HET: MSE; 1.86A {Sphaerobacter thermophilus} Back     alignment and structure
>4i4a_A Similar to unknown protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.35A {Photorhabdus luminescens subsp} Back     alignment and structure
>1v70_A Probable antibiotics synthesis protein; structural genomics, thermus thermophilus HB8, riken structu genomics/proteomics initiative, RSGI; 1.30A {Thermus thermophilus} SCOP: b.82.1.9 PDB: 2dct_A Back     alignment and structure
>1vj2_A Novel manganese-containing cupin TM1459; structural genomics, joint for structural genomics, JCSG; 1.65A {Thermotoga maritima} SCOP: b.82.1.10 Back     alignment and structure
>1lr5_A Auxin binding protein 1; beta jellyroll, double stranded beta helix, germin-like PROT protein binding; HET: NAG BMA MAN; 1.90A {Zea mays} SCOP: b.82.1.2 PDB: 1lrh_A* Back     alignment and structure
>2bnm_A Epoxidase; oxidoreductase, cupin, HTH, cation-dependant, zinc, fosfomycin; 1.7A {Streptomyces wedmorensis} SCOP: a.35.1.3 b.82.1.10 PDB: 1zz7_A 1zz8_A 1zz9_A 1zzb_A 1zz6_A 1zzc_A 2bnn_A 2bno_A 3scf_A 3scg_A 3sch_A Back     alignment and structure
>3i7d_A Sugar phosphate isomerase; YP_168127.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.30A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>2f4p_A Hypothetical protein TM1010; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: UNL; 1.90A {Thermotoga maritima} SCOP: b.82.1.9 Back     alignment and structure
>3lag_A Uncharacterized protein RPA4178; functionally unknown protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.15A {Rhodopseudomonas palustris} Back     alignment and structure
>1sef_A Conserved hypothetical protein; structural genomics, nysgxrc target T1582, PSI, protein STRU initiative; 2.05A {Enterococcus faecalis} SCOP: b.82.1.11 Back     alignment and structure
>1x82_A Glucose-6-phosphate isomerase; cupin superfamily, hyperthermophIle, phosphoglucose isomerase, extremeophIle; HET: PA5; 1.50A {Pyrococcus furiosus} SCOP: b.82.1.7 PDB: 1x7n_A* 1x8e_A 1qxr_A* 1qxj_A* 1qy4_A* 2gc1_A* 2gc0_A* 2gc2_A* 2gc3_A* 3sxw_A 1j3q_A 1j3p_A 1j3r_A* Back     alignment and structure
>3cew_A Uncharacterized cupin protein; all beta-protein, jelly-roll (cupin-2), structural genomics, protein structure initiative; 2.31A {Bacteroides fragilis} Back     alignment and structure
>2gu9_A Tetracenomycin polyketide synthesis protein; X-RAY diffraction, cupin, immune system; 1.40A {Xanthomonas campestris} PDB: 2ilb_A 3h50_A Back     alignment and structure
>2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 Back     alignment and structure
>3ibm_A Cupin 2, conserved barrel domain protein; cupin 2 family, metal-binding site, beta barrel, PSI-2, NYSG structural genomics; 2.00A {Halorhodospira halophila SL1} Back     alignment and structure
>3kgz_A Cupin 2 conserved barrel domain protein; metalloprotein, structural genomics, PSI-2, protein structur initiative; 1.85A {Rhodopseudomonas palustris} Back     alignment and structure
>1yhf_A Hypothetical protein SPY1581; structural genomics, conserved hypothetical protein, PSI, PR structure initiative; 2.00A {Streptococcus pyogenes} SCOP: b.82.1.9 Back     alignment and structure
>2pfw_A Cupin 2, conserved barrel domain protein; cupin domain, struc genomics, joint center for structural genomics, JCSG; 1.90A {Shewanella frigidimarina} Back     alignment and structure
>4e2q_A Ureidoglycine aminohydrolase; BI-cupin, manganese binding, endoplasmic RET hydrolase; 2.50A {Arabidopsis thaliana} PDB: 4e2s_A Back     alignment and structure
>1rc6_A Hypothetical protein YLBA; structural genomics, NYSGXRC, SGX clone NAME 3174C1TCT3B1, T T1521, PSI, protein initiative; 2.60A {Escherichia coli} SCOP: b.82.1.11 Back     alignment and structure
>4e2g_A Cupin 2 conserved barrel domain protein; MCSG, PSI-biology, structural genomics, GEBA, midwest center structural genomics; HET: MSE; 1.86A {Sphaerobacter thermophilus} Back     alignment and structure
>2xlg_A SLL1785 protein, CUCA; metal binding protein, cupin; 1.80A {Synechocystis SP} PDB: 2xl7_A 2xl9_A 2xlf_A* 2xla_A Back     alignment and structure
>3i7d_A Sugar phosphate isomerase; YP_168127.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.30A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>2xlg_A SLL1785 protein, CUCA; metal binding protein, cupin; 1.80A {Synechocystis SP} PDB: 2xl7_A 2xl9_A 2xlf_A* 2xla_A Back     alignment and structure
>2o8q_A Hypothetical protein; cpuin-like fold, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.55A {Burkholderia xenovorans} Back     alignment and structure
>3es1_A Cupin 2, conserved barrel domain protein; YP_001165807.1; HET: MSE; 1.91A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Back     alignment and structure
>1y9q_A Transcriptional regulator, HTH_3 family; transcriptional regulaator, strucutral genomics, protein structure initiative, PSI; 1.90A {Vibrio cholerae} SCOP: a.35.1.8 b.82.1.15 Back     alignment and structure
>1sfn_A Conserved hypothetical protein; structural genomics, nysgxrc target T1583, PSI, protein STRU initiative; 2.46A {Deinococcus radiodurans} SCOP: b.82.1.11 Back     alignment and structure
>1sq4_A GLXB, glyoxylate-induced protein; structural genomics, double beta barrel protein, PSI, protei structure initiative; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.11 Back     alignment and structure
>3lwc_A Uncharacterized protein; structural genomics, unknown function, joint center for STRU genomics, JCSG, protein structure initiative; HET: MSE; 1.40A {Rhizobium leguminosarum} Back     alignment and structure
>2f4p_A Hypothetical protein TM1010; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: UNL; 1.90A {Thermotoga maritima} SCOP: b.82.1.9 Back     alignment and structure
>2pfw_A Cupin 2, conserved barrel domain protein; cupin domain, struc genomics, joint center for structural genomics, JCSG; 1.90A {Shewanella frigidimarina} Back     alignment and structure
>2o8q_A Hypothetical protein; cpuin-like fold, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.55A {Burkholderia xenovorans} Back     alignment and structure
>2b8m_A Hypothetical protein MJ0764; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.70A {Methanocaldococcus jannaschii} SCOP: b.82.1.18 Back     alignment and structure
>3jzv_A Uncharacterized protein RRU_A2000; structural genomics, cupin-2 fold, unknown function, PSI-2, structure initiative; HET: MSE; 2.30A {Rhodospirillum rubrum} Back     alignment and structure
>3lwc_A Uncharacterized protein; structural genomics, unknown function, joint center for STRU genomics, JCSG, protein structure initiative; HET: MSE; 1.40A {Rhizobium leguminosarum} Back     alignment and structure
>4i4a_A Similar to unknown protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.35A {Photorhabdus luminescens subsp} Back     alignment and structure
>3lag_A Uncharacterized protein RPA4178; functionally unknown protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.15A {Rhodopseudomonas palustris} Back     alignment and structure
>2fqp_A Hypothetical protein BP2299; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: 1PE; 1.80A {Bordetella pertussis tohama I} Back     alignment and structure
>3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 Back     alignment and structure
>2opk_A Hypothetical protein; putative mannose-6-phosphate isomerase, structural genomics, center for structural genomics, JCSG; 2.10A {Ralstonia eutropha} Back     alignment and structure
>2q30_A Uncharacterized protein; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.94A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>3cew_A Uncharacterized cupin protein; all beta-protein, jelly-roll (cupin-2), structural genomics, protein structure initiative; 2.31A {Bacteroides fragilis} Back     alignment and structure
>3ht1_A REMF protein; cupin fold, Zn-binding, antibiotic biosynthesis, resistomycin, metalloprotein, cyclase, lyase; 1.20A {Streptomyces resistomycificus} PDB: 3ht2_A Back     alignment and structure
>1o4t_A Putative oxalate decarboxylase; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; 1.95A {Thermotoga maritima} SCOP: b.82.1.9 Back     alignment and structure
>1vj2_A Novel manganese-containing cupin TM1459; structural genomics, joint for structural genomics, JCSG; 1.65A {Thermotoga maritima} SCOP: b.82.1.10 Back     alignment and structure
>3myx_A Uncharacterized protein pspto_0244; protein of unknown function (DUF861), cupin_3 (PF05899), STR genomics; HET: MSE; 1.30A {Pseudomonas syringae PV} Back     alignment and structure
>3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* Back     alignment and structure
>2ozj_A Cupin 2, conserved barrel; cupin superfamily protein, struct genomics, joint center for structural genomics, JCSG; HET: MSE; 1.60A {Desulfitobacterium hafniense} Back     alignment and structure
>1yhf_A Hypothetical protein SPY1581; structural genomics, conserved hypothetical protein, PSI, PR structure initiative; 2.00A {Streptococcus pyogenes} SCOP: b.82.1.9 Back     alignment and structure
>2bnm_A Epoxidase; oxidoreductase, cupin, HTH, cation-dependant, zinc, fosfomycin; 1.7A {Streptomyces wedmorensis} SCOP: a.35.1.3 b.82.1.10 PDB: 1zz7_A 1zz8_A 1zz9_A 1zzb_A 1zz6_A 1zzc_A 2bnn_A 2bno_A 3scf_A 3scg_A 3sch_A Back     alignment and structure
>3fjs_A Uncharacterized protein with RMLC-like cupin fold; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.90A {Ralstonia eutropha JMP134} Back     alignment and structure
>1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* Back     alignment and structure
>2vpv_A Protein MIF2, MIF2P; nucleus, mitosis, centromere, cell cycle, DNA-binding, kinetochore, cell division, phosphoprotein, jelly-roll fold; 2.7A {Saccharomyces cerevisiae} Back     alignment and structure
>3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} Back     alignment and structure
>2q30_A Uncharacterized protein; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.94A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>4h7l_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, cupin, unknown function; 2.45A {Planctomyces limnophilus} Back     alignment and structure
>2pyt_A Ethanolamine utilization protein EUTQ; structural genomics, joint center for structural genomics, J protein structure initiative; 1.90A {Salmonella typhimurium LT2} SCOP: b.82.1.24 Back     alignment and structure
>2pyt_A Ethanolamine utilization protein EUTQ; structural genomics, joint center for structural genomics, J protein structure initiative; 1.90A {Salmonella typhimurium LT2} SCOP: b.82.1.24 Back     alignment and structure
>2ozj_A Cupin 2, conserved barrel; cupin superfamily protein, struct genomics, joint center for structural genomics, JCSG; HET: MSE; 1.60A {Desulfitobacterium hafniense} Back     alignment and structure
>4b29_A Dimethylsulfoniopropionate lyase; hydrolase, dimethylsulfide, sulphur cycle; 1.72A {Roseovarius nubinhibens ism} Back     alignment and structure
>4axo_A EUTQ, ethanolamine utilization protein; structural protein, bacterial microcompartment, BMC; 1.00A {Clostridium difficile} Back     alignment and structure
>2i45_A Hypothetical protein; neisseria meningitidis cupin domain, structural genomics, PS protein structure initiative; 2.50A {Neisseria meningitidis} Back     alignment and structure
>2i45_A Hypothetical protein; neisseria meningitidis cupin domain, structural genomics, PS protein structure initiative; 2.50A {Neisseria meningitidis} Back     alignment and structure
>3d82_A Cupin 2, conserved barrel domain protein; structural genomics, joint center for structural genomics; 2.05A {Shewanella frigidimarina ncimb 400} Back     alignment and structure
>3d82_A Cupin 2, conserved barrel domain protein; structural genomics, joint center for structural genomics; 2.05A {Shewanella frigidimarina ncimb 400} Back     alignment and structure
>1y9q_A Transcriptional regulator, HTH_3 family; transcriptional regulaator, strucutral genomics, protein structure initiative, PSI; 1.90A {Vibrio cholerae} SCOP: a.35.1.8 b.82.1.15 Back     alignment and structure
>2vpv_A Protein MIF2, MIF2P; nucleus, mitosis, centromere, cell cycle, DNA-binding, kinetochore, cell division, phosphoprotein, jelly-roll fold; 2.7A {Saccharomyces cerevisiae} Back     alignment and structure
>1vr3_A Acireductone dioxygenase; 13543033, structural genomics, JOI for structural genomics, JCSG, protein structure initiative oxidoreductase; 2.06A {Mus musculus} SCOP: b.82.1.6 Back     alignment and structure
>1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* Back     alignment and structure
>4axo_A EUTQ, ethanolamine utilization protein; structural protein, bacterial microcompartment, BMC; 1.00A {Clostridium difficile} Back     alignment and structure
>1vr3_A Acireductone dioxygenase; 13543033, structural genomics, JOI for structural genomics, JCSG, protein structure initiative oxidoreductase; 2.06A {Mus musculus} SCOP: b.82.1.6 Back     alignment and structure
>4h7l_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, cupin, unknown function; 2.45A {Planctomyces limnophilus} Back     alignment and structure
>1zrr_A E-2/E-2' protein; nickel, cupin, beta helix, methionine salvage, oxidoreductase; NMR {Klebsiella oxytoca} SCOP: b.82.1.6 PDB: 2hji_A Back     alignment and structure
>1o5u_A Novel thermotoga maritima enzyme TM1112; cupin, structural genomics center for structural genomics, JCSG, protein structure INI PSI; 1.83A {Thermotoga maritima} SCOP: b.82.1.8 PDB: 1lkn_A 2k9z_A Back     alignment and structure
>3es1_A Cupin 2, conserved barrel domain protein; YP_001165807.1; HET: MSE; 1.91A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Back     alignment and structure
>3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* 4fag_A* 4fbf_A 4fah_A Back     alignment and structure
>3bcw_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.60A {Bordetella bronchiseptica RB50} Back     alignment and structure
>2opk_A Hypothetical protein; putative mannose-6-phosphate isomerase, structural genomics, center for structural genomics, JCSG; 2.10A {Ralstonia eutropha} Back     alignment and structure
>3o14_A Anti-ecfsigma factor, CHRR; cupin, structural genomics, joint center for structura genomics, JCSG, protein structure initiative; HET: MSE; 1.70A {Marinobacter aquaeolei} Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>1zrr_A E-2/E-2' protein; nickel, cupin, beta helix, methionine salvage, oxidoreductase; NMR {Klebsiella oxytoca} SCOP: b.82.1.6 PDB: 2hji_A Back     alignment and structure
>4b29_A Dimethylsulfoniopropionate lyase; hydrolase, dimethylsulfide, sulphur cycle; 1.72A {Roseovarius nubinhibens ism} Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>3ebr_A Uncharacterized RMLC-like cupin; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.60A {Ralstonia eutropha JMP134} Back     alignment and structure
>2o1q_A Putative acetyl/propionyl-COA carboxylase, alpha; putative acetylacetone dioxygenase, structural genomics; HET: MSE PG4; 1.50A {Methylibium petroleiphilum} SCOP: b.82.1.21 Back     alignment and structure
>3bcw_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.60A {Bordetella bronchiseptica RB50} Back     alignment and structure
>1o5u_A Novel thermotoga maritima enzyme TM1112; cupin, structural genomics center for structural genomics, JCSG, protein structure INI PSI; 1.83A {Thermotoga maritima} SCOP: b.82.1.8 PDB: 1lkn_A 2k9z_A Back     alignment and structure
>3cjx_A Protein of unknown function with A cupin-like FOL; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.60A {Ralstonia eutropha} Back     alignment and structure
>2arc_A ARAC, arabinose operon regulatory protein; transcription factor, carbohydrate binding, coiled-coil, jelly roll; HET: ARA; 1.50A {Escherichia coli} SCOP: b.82.4.1 PDB: 2aac_A* 1xja_A 2ara_A Back     alignment and structure
>1yfu_A 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxidoreductase; 1.90A {Cupriavidus metallidurans} SCOP: b.82.1.20 PDB: 1yfw_A* 1yfx_A* 1yfy_A* Back     alignment and structure
>3d0j_A Uncharacterized protein CA_C3497; beta-barrel, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.53A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>2o1q_A Putative acetyl/propionyl-COA carboxylase, alpha; putative acetylacetone dioxygenase, structural genomics; HET: MSE PG4; 1.50A {Methylibium petroleiphilum} SCOP: b.82.1.21 Back     alignment and structure
>2y0o_A Probable D-lyxose ketol-isomerase; carbohydrate metabolism, metal-binding, sugar ISO stress response; HET: MSE; 1.23A {Bacillus subtilis subsp} Back     alignment and structure
>3ebr_A Uncharacterized RMLC-like cupin; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.60A {Ralstonia eutropha JMP134} Back     alignment and structure
>1zvf_A 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll beta-barrel, oxidoreductase; 2.41A {Saccharomyces cerevisiae} SCOP: b.82.1.20 Back     alignment and structure
>1yfu_A 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxidoreductase; 1.90A {Cupriavidus metallidurans} SCOP: b.82.1.20 PDB: 1yfw_A* 1yfx_A* 1yfy_A* Back     alignment and structure
>2y0o_A Probable D-lyxose ketol-isomerase; carbohydrate metabolism, metal-binding, sugar ISO stress response; HET: MSE; 1.23A {Bacillus subtilis subsp} Back     alignment and structure
>2pa7_A DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysugar biosynthesis, S-layer biosynthesis, ketoisomerase; HET: TYD; 1.50A {Aneurinibacillus thermoaerophilus} SCOP: b.82.1.1 PDB: 2pae_A* 2pak_A* 2pam_A* Back     alignment and structure
>1yud_A Hypothetical protein SO0799; SOR12, Q8E1N8, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.70A {Shewanella oneidensis} SCOP: b.82.1.16 Back     alignment and structure
>1zvf_A 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll beta-barrel, oxidoreductase; 2.41A {Saccharomyces cerevisiae} SCOP: b.82.1.20 Back     alignment and structure
>3ejk_A DTDP sugar isomerase; YP_390184.1, structural genomics, JOIN for structural genomics, JCSG; HET: CIT; 1.95A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>2arc_A ARAC, arabinose operon regulatory protein; transcription factor, carbohydrate binding, coiled-coil, jelly roll; HET: ARA; 1.50A {Escherichia coli} SCOP: b.82.4.1 PDB: 2aac_A* 1xja_A 2ara_A Back     alignment and structure
>3cjx_A Protein of unknown function with A cupin-like FOL; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.60A {Ralstonia eutropha} Back     alignment and structure
>1yud_A Hypothetical protein SO0799; SOR12, Q8E1N8, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.70A {Shewanella oneidensis} SCOP: b.82.1.16 Back     alignment and structure
>3es4_A Uncharacterized protein DUF861 with A RMLC-like C; 17741406, protein of unknown function (DUF861) with A RMLC-L fold; HET: MSE; 1.64A {Agrobacterium tumefaciens str} Back     alignment and structure
>2qnk_A 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fold, cupin barrel, extradiol dioxygenase, metalloen trytophan catabolism, NAD+ synthesis; HET: MSE; 1.60A {Homo sapiens} PDB: 3fe5_A Back     alignment and structure
>3myx_A Uncharacterized protein pspto_0244; protein of unknown function (DUF861), cupin_3 (PF05899), STR genomics; HET: MSE; 1.30A {Pseudomonas syringae PV} Back     alignment and structure
>3es4_A Uncharacterized protein DUF861 with A RMLC-like C; 17741406, protein of unknown function (DUF861) with A RMLC-L fold; HET: MSE; 1.64A {Agrobacterium tumefaciens str} Back     alignment and structure
>3eqe_A Putative cystein deoxygenase; YUBC, SR112, NESG, structural genomics, PSI-2, protein structure initiative; 2.82A {Bacillus subtilis} Back     alignment and structure
>2qnk_A 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fold, cupin barrel, extradiol dioxygenase, metalloen trytophan catabolism, NAD+ synthesis; HET: MSE; 1.60A {Homo sapiens} PDB: 3fe5_A Back     alignment and structure
>3eqe_A Putative cystein deoxygenase; YUBC, SR112, NESG, structural genomics, PSI-2, protein structure initiative; 2.82A {Bacillus subtilis} Back     alignment and structure
>3o14_A Anti-ecfsigma factor, CHRR; cupin, structural genomics, joint center for structura genomics, JCSG, protein structure initiative; HET: MSE; 1.70A {Marinobacter aquaeolei} Back     alignment and structure
>3bal_A Acetylacetone-cleaving enzyme; jelly roll, tetramer, dioxygenase, iron, metal-binding, oxidoreductase; 1.95A {Acinetobacter johnsonii} Back     alignment and structure
>3d0j_A Uncharacterized protein CA_C3497; beta-barrel, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.53A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>2gm6_A Cysteine dioxygenase type I; structural genomics, J center for structural genomics, JCSG, protein structure INI PSI-2, oxidoreductase; 1.84A {Ralstonia eutropha} SCOP: b.82.1.19 Back     alignment and structure
>3bal_A Acetylacetone-cleaving enzyme; jelly roll, tetramer, dioxygenase, iron, metal-binding, oxidoreductase; 1.95A {Acinetobacter johnsonii} Back     alignment and structure
>2gm6_A Cysteine dioxygenase type I; structural genomics, J center for structural genomics, JCSG, protein structure INI PSI-2, oxidoreductase; 1.84A {Ralstonia eutropha} SCOP: b.82.1.19 Back     alignment and structure
>3gbg_A TCP pilus virulence regulatory protein; cupin, helix-turn-helix, ARAC family, activator, DNA-binding transcription, transcription regulation; HET: PAM; 1.90A {Vibrio cholerae} Back     alignment and structure
>3ejk_A DTDP sugar isomerase; YP_390184.1, structural genomics, JOIN for structural genomics, JCSG; HET: CIT; 1.95A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>1ep0_A DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; racemase, DTDP-4-dehydrorhamnose epimerase, structural genomics, PSI; 1.50A {Methanothermobacterthermautotrophicus} SCOP: b.82.1.1 PDB: 1epz_A* Back     alignment and structure
>1wlt_A 176AA long hypothetical DTDP-4-dehydrorhamnose 3, 5-epimerase; jelly roll-like topology, flattened barrel, isomerase; 1.90A {Sulfolobus tokodaii} SCOP: b.82.1.1 PDB: 2b9u_A Back     alignment and structure
>1nxm_A DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; jelly roll-like structure, beta sheet, isomerase; 1.30A {Streptococcus suis} SCOP: b.82.1.1 PDB: 1nyw_A* 1nzc_A* 2ixl_A* Back     alignment and structure
>1dzr_A DTDP-4-dehydrorhamnose 3\,5-epimerase; isomerase, 3\,5-hexulose epimerase; 2.17A {Salmonella typhimurium} SCOP: b.82.1.1 PDB: 1dzt_A* Back     alignment and structure
>3gbg_A TCP pilus virulence regulatory protein; cupin, helix-turn-helix, ARAC family, activator, DNA-binding transcription, transcription regulation; HET: PAM; 1.90A {Vibrio cholerae} Back     alignment and structure
>2ixk_A DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, lipopolysaccharide biosynthesis, epimerise, epimerize; HET: TDO; 1.7A {Pseudomonas aeruginosa} PDB: 2ixi_A* 2ixh_A* 1rtv_A* 2ixj_A* Back     alignment and structure
>3ryk_A DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pathway, STRU genomics, infectious diseases; HET: TYD; 1.63A {Bacillus anthracis str} Back     alignment and structure
>4hn1_A Putative 3-epimerase in D-allose pathway; 3'-monoepimerase, natural product, deoxysugar, chalcomycin, mycinose, cupin fold; HET: TYD THM; 1.60A {Streptomyces bikiniensis} PDB: 4hmz_A* 4hn0_A Back     alignment and structure
>1oi6_A PCZA361.16; epimerase, vancomycin group antibiotic, EVAD, isomerase; HET: TMP; 1.4A {Amycolatopsis orientalis} SCOP: b.82.1.1 PDB: 1ofn_A* 1wa4_A Back     alignment and structure
>4gjz_A Lysine-specific demethylase 8; JMJC, beta barrel, Fe(II) and 2-oxoglutarate binding, oxidor; HET: AKG BME; 1.05A {Homo sapiens} PDB: 4gjy_A* 4aap_A* 3uyj_A* Back     alignment and structure
>1vrb_A Putative asparaginyl hydroxylase; 2636534, structural genomi center for structural genomics, JCSG, protein structure INI PSI, oxidoreductase; 2.60A {Bacillus subtilis} SCOP: b.82.2.11 Back     alignment and structure
>2c0z_A NOVW; isomerase, epimerase, antibiotic biosynthesis, RMLC-like cupin; 1.60A {Streptomyces sphaeroides} SCOP: b.82.1.1 Back     alignment and structure
>2xdv_A MYC-induced nuclear antigen; ribosome biogenesis, nuclear protein; HET: OGA; 2.57A {Homo sapiens} Back     alignment and structure
>3eln_A Cysteine dioxygenase type 1; peroxysulfenate, non-heme dioxygenases, Fe2+ metalloenzyme, taurine, thioether, iron, metal- binding; 1.42A {Rattus norvegicus} SCOP: b.82.1.19 PDB: 2gh2_A 2b5h_A 2atf_A* 2q4s_A 2ic1_A Back     alignment and structure
>1upi_A DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pathway, PSI, protein structure initiative, TB structural genomics consortium, TB; HET: CME; 1.7A {Mycobacterium tuberculosis} SCOP: b.82.1.1 PDB: 2ixc_A* 1pm7_A* Back     alignment and structure
>3d8c_A Hypoxia-inducible factor 1 alpha inhibitor; FIH, HIF, DSBH, oxygenase, transcription, inhibitor oxoglutarate, asparaginyl hydroxylase; HET: AKG; 2.10A {Homo sapiens} PDB: 2ilm_A* 2w0x_A* 1h2l_A* 1h2m_A* 1h2n_A* 1yci_A* 2cgn_A 2cgo_A* 1h2k_A* 2wa3_A* 2wa4_A* 3od4_A* 3p3n_A* 3p3p_A* 2yc0_A* 2y0i_A* 2yde_A* 1mze_A* 1mzf_A* 2xum_A* ... Back     alignment and structure
>1e5r_A Proline oxidase; oxidoreductase, oxygenase, 2-oxoglutarate dependent oxygenase; 2.30A {Streptomyces SP} SCOP: b.82.2.4 PDB: 1e5s_A Back     alignment and structure
>3bb6_A Uncharacterized protein YEAR; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Escherichia coli} SCOP: b.82.2.13 Back     alignment and structure
>1nxm_A DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; jelly roll-like structure, beta sheet, isomerase; 1.30A {Streptococcus suis} SCOP: b.82.1.1 PDB: 1nyw_A* 1nzc_A* 2ixl_A* Back     alignment and structure
>4diq_A Lysine-specific demethylase NO66; structural genomics, structural genomics consortium, SGC, HI demethylase, oxidoreductase; HET: PD2; 2.40A {Homo sapiens} Back     alignment and structure
>3eln_A Cysteine dioxygenase type 1; peroxysulfenate, non-heme dioxygenases, Fe2+ metalloenzyme, taurine, thioether, iron, metal- binding; 1.42A {Rattus norvegicus} SCOP: b.82.1.19 PDB: 2gh2_A 2b5h_A 2atf_A* 2q4s_A 2ic1_A Back     alignment and structure
>4gjz_A Lysine-specific demethylase 8; JMJC, beta barrel, Fe(II) and 2-oxoglutarate binding, oxidor; HET: AKG BME; 1.05A {Homo sapiens} PDB: 4gjy_A* 4aap_A* 3uyj_A* Back     alignment and structure
>1vrb_A Putative asparaginyl hydroxylase; 2636534, structural genomi center for structural genomics, JCSG, protein structure INI PSI, oxidoreductase; 2.60A {Bacillus subtilis} SCOP: b.82.2.11 Back     alignment and structure
>3al5_A HTYW5, JMJC domain-containing protein C2ORF60; tRNA modification enzyme, unknown function; 2.50A {Homo sapiens} PDB: 3al6_A* Back     alignment and structure
>3loi_A Putative uncharacterized protein; beta barrel, unknown function; 2.10A {Branchiostoma belcheri tsingtauense} SCOP: b.82.1.0 PDB: 3lzz_A* Back     alignment and structure
>2pa7_A DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysugar biosynthesis, S-layer biosynthesis, ketoisomerase; HET: TYD; 1.50A {Aneurinibacillus thermoaerophilus} SCOP: b.82.1.1 PDB: 2pae_A* 2pak_A* 2pam_A* Back     alignment and structure
>1oi6_A PCZA361.16; epimerase, vancomycin group antibiotic, EVAD, isomerase; HET: TMP; 1.4A {Amycolatopsis orientalis} SCOP: b.82.1.1 PDB: 1ofn_A* 1wa4_A Back     alignment and structure
>3k2o_A Bifunctional arginine demethylase and lysyl-hydro JMJD6; structural genomics consortium, SGC, chromatin regulator, developmental protein; 1.75A {Homo sapiens} PDB: 3ld8_A 3ldb_A* Back     alignment and structure
>3ryk_A DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pathway, STRU genomics, infectious diseases; HET: TYD; 1.63A {Bacillus anthracis str} Back     alignment and structure
>1dzr_A DTDP-4-dehydrorhamnose 3\,5-epimerase; isomerase, 3\,5-hexulose epimerase; 2.17A {Salmonella typhimurium} SCOP: b.82.1.1 PDB: 1dzt_A* Back     alignment and structure
>1ep0_A DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; racemase, DTDP-4-dehydrorhamnose epimerase, structural genomics, PSI; 1.50A {Methanothermobacterthermautotrophicus} SCOP: b.82.1.1 PDB: 1epz_A* Back     alignment and structure
>1wlt_A 176AA long hypothetical DTDP-4-dehydrorhamnose 3, 5-epimerase; jelly roll-like topology, flattened barrel, isomerase; 1.90A {Sulfolobus tokodaii} SCOP: b.82.1.1 PDB: 2b9u_A Back     alignment and structure
>1xe7_A YML079WP, hypothetical 22.5 kDa protein in TUB1-CPR3 intergenic region; jelly roll motif, cupin superfamily, structural genomics; HET: GUN; 1.75A {Saccharomyces cerevisiae} SCOP: b.82.1.16 PDB: 1xe8_A* Back     alignment and structure
>2ixk_A DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, lipopolysaccharide biosynthesis, epimerise, epimerize; HET: TDO; 1.7A {Pseudomonas aeruginosa} PDB: 2ixi_A* 2ixh_A* 1rtv_A* 2ixj_A* Back     alignment and structure
>3uss_A Putative uncharacterized protein; cupin, three histidine, non-heme iron, cysteine catabolism, oxidoreductase; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.19 Back     alignment and structure
>1upi_A DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pathway, PSI, protein structure initiative, TB structural genomics consortium, TB; HET: CME; 1.7A {Mycobacterium tuberculosis} SCOP: b.82.1.1 PDB: 2ixc_A* 1pm7_A* Back     alignment and structure
>4hn1_A Putative 3-epimerase in D-allose pathway; 3'-monoepimerase, natural product, deoxysugar, chalcomycin, mycinose, cupin fold; HET: TYD THM; 1.60A {Streptomyces bikiniensis} PDB: 4hmz_A* 4hn0_A Back     alignment and structure
>3d8c_A Hypoxia-inducible factor 1 alpha inhibitor; FIH, HIF, DSBH, oxygenase, transcription, inhibitor oxoglutarate, asparaginyl hydroxylase; HET: AKG; 2.10A {Homo sapiens} PDB: 2ilm_A* 2w0x_A* 1h2l_A* 1h2m_A* 1h2n_A* 1yci_A* 2cgn_A 2cgo_A* 1h2k_A* 2wa3_A* 2wa4_A* 3od4_A* 3p3n_A* 3p3p_A* 2yc0_A* 2y0i_A* 2yde_A* 1mze_A* 1mzf_A* 2xum_A* ... Back     alignment and structure
>4diq_A Lysine-specific demethylase NO66; structural genomics, structural genomics consortium, SGC, HI demethylase, oxidoreductase; HET: PD2; 2.40A {Homo sapiens} Back     alignment and structure
>2c0z_A NOVW; isomerase, epimerase, antibiotic biosynthesis, RMLC-like cupin; 1.60A {Streptomyces sphaeroides} SCOP: b.82.1.1 Back     alignment and structure
>3al5_A HTYW5, JMJC domain-containing protein C2ORF60; tRNA modification enzyme, unknown function; 2.50A {Homo sapiens} PDB: 3al6_A* Back     alignment and structure
>2xdv_A MYC-induced nuclear antigen; ribosome biogenesis, nuclear protein; HET: OGA; 2.57A {Homo sapiens} Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Back     alignment and structure
>2yu1_A JMJC domain-containing histone demethylation PROT; JMJC-domain-containing histone demethylases, oxidoreductase; HET: AKG; 2.70A {Homo sapiens} PDB: 2yu2_A Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Back     alignment and structure
>3uss_A Putative uncharacterized protein; cupin, three histidine, non-heme iron, cysteine catabolism, oxidoreductase; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.19 Back     alignment and structure
>3k3o_A PHF8, PHD finger protein 8; histone demethylase, chromatin modification, methylated H3K9, mental retardation, metal-BI phosphoprotein, zinc-finger; HET: AKG; 2.10A {Homo sapiens} PDB: 3k3n_A* 4do0_A* 2wwu_A* Back     alignment and structure
>3rcq_A Aspartyl/asparaginyl beta-hydroxylase; structural genomics, structural genomics consortium, SGC, oxidoreductase, human; HET: OGA; 2.05A {Homo sapiens} Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Back     alignment and structure
>2vec_A YHAK, pirin-like protein YHAK; ROS, bicupin, sulfenic acid, reactive cysteine, cytosolic protein; 1.85A {Escherichia coli} Back     alignment and structure
>3k2o_A Bifunctional arginine demethylase and lysyl-hydro JMJD6; structural genomics consortium, SGC, chromatin regulator, developmental protein; 1.75A {Homo sapiens} PDB: 3ld8_A 3ldb_A* Back     alignment and structure
>1eyb_A Homogentisate 1,2-dioxygenase; jelly roll, beta sandwich, oxidoreductase; 1.90A {Homo sapiens} SCOP: b.82.1.4 PDB: 1ey2_A Back     alignment and structure
>3kv9_A JMJC domain-containing histone demethylation protein 1D; jumonji domain lysine demethylase, metal-binding, zinc, zinc-finger; 2.29A {Homo sapiens} PDB: 3kva_A* 3kvb_A* 3u78_A* Back     alignment and structure
>3m3i_A Putative uncharacterized protein; PFAM:PF06172, structural genomics, structural genomics of pathogenic protozoa consortium, SGPP; 2.35A {Leishmania major} Back     alignment and structure
>3kv9_A JMJC domain-containing histone demethylation protein 1D; jumonji domain lysine demethylase, metal-binding, zinc, zinc-finger; 2.29A {Homo sapiens} PDB: 3kva_A* 3kvb_A* 3u78_A* Back     alignment and structure
>2qdr_A Uncharacterized protein; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: MSE EPE; 2.60A {Nostoc punctiforme} Back     alignment and structure
>2yu1_A JMJC domain-containing histone demethylation PROT; JMJC-domain-containing histone demethylases, oxidoreductase; HET: AKG; 2.70A {Homo sapiens} PDB: 2yu2_A Back     alignment and structure
>3pua_A GRC5, PHD finger protein 2; alpha-ketoglutarate-Fe2+ dependent dioxygenases, histone TAI protein, protein binding; HET: OGA; 1.89A {Homo sapiens} PDB: 3pu3_A* 3ptr_B* 3pu8_B* 3pus_A* Back     alignment and structure
>3pua_A GRC5, PHD finger protein 2; alpha-ketoglutarate-Fe2+ dependent dioxygenases, histone TAI protein, protein binding; HET: OGA; 1.89A {Homo sapiens} PDB: 3pu3_A* 3ptr_B* 3pu8_B* 3pus_A* Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Back     alignment and structure
>3k3o_A PHF8, PHD finger protein 8; histone demethylase, chromatin modification, methylated H3K9, mental retardation, metal-BI phosphoprotein, zinc-finger; HET: AKG; 2.10A {Homo sapiens} PDB: 3k3n_A* 4do0_A* 2wwu_A* Back     alignment and structure
>1znp_A Hypothetical protein ATU3615; NESG, ATR55, Q8U9W0, structural genomics, PSI, protein struc initiative; 2.50A {Agrobacterium tumefaciens str} SCOP: b.82.1.16 Back     alignment and structure
>1pmi_A PMI, phosphomannose isomerase; aldose-ketose isomerase; 1.70A {Candida albicans} SCOP: b.82.1.3 Back     alignment and structure
>2p17_A Pirin-like protein; GK1651, structural genomics, south collaboratory for structural genomics, protein structure in secsg; 1.52A {Geobacillus kaustophilus} Back     alignment and structure
>2qjv_A Uncharacterized IOLB-like protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MLY MSE; 1.90A {Salmonella typhimurium LT2} Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 480
d1od5a1245 b.82.1.2 (A:7-251) Seed storage 7S protein {Soybea 1e-86
d1fxza1239 b.82.1.2 (A:10-248) Seed storage 7S protein {Soybe 1e-85
d1od5a2173 b.82.1.2 (A:321-493) Seed storage 7S protein {Soyb 2e-63
d1od5a2173 b.82.1.2 (A:321-493) Seed storage 7S protein {Soyb 4e-08
d1fxza2174 b.82.1.2 (A:297-470) Seed storage 7S protein {Soyb 3e-63
d1fxza2174 b.82.1.2 (A:297-470) Seed storage 7S protein {Soyb 4e-10
d2et1a1201 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare 1e-43
d2et1a1201 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare 9e-13
g1dgw.1168 b.82.1.2 (X:,Y:) Seed storage 7S protein {Jack bea 3e-42
g1dgw.1168 b.82.1.2 (X:,Y:) Seed storage 7S protein {Jack bea 2e-12
d1uika2185 b.82.1.2 (A:351-535) Seed storage 7S protein {Soyb 4e-39
d1uika2185 b.82.1.2 (A:351-535) Seed storage 7S protein {Soyb 7e-25
d1j58a_372 b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {B 5e-36
d1j58a_ 372 b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {B 3e-33
d2phla1200 b.82.1.2 (A:11-210) Seed storage 7S protein {Frenc 4e-32
d2phla1200 b.82.1.2 (A:11-210) Seed storage 7S protein {Frenc 3e-24
d1uika1203 b.82.1.2 (A:148-350) Seed storage 7S protein {Soyb 1e-30
d1uika1203 b.82.1.2 (A:148-350) Seed storage 7S protein {Soyb 2e-21
d1dgwa_178 b.82.1.2 (A:) Seed storage 7S protein {Jack bean ( 1e-30
d1dgwa_178 b.82.1.2 (A:) Seed storage 7S protein {Jack bean ( 9e-27
d2phla2162 b.82.1.2 (A:220-381) Seed storage 7S protein {Fren 2e-30
d2phla2162 b.82.1.2 (A:220-381) Seed storage 7S protein {Fren 4e-16
d1uija1170 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybea 2e-28
d1uija1170 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybea 4e-27
>d1od5a1 b.82.1.2 (A:7-251) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Length = 245 Back     information, alignment and structure

class: All beta proteins
fold: Double-stranded beta-helix
superfamily: RmlC-like cupins
family: Germin/Seed storage 7S protein
domain: Seed storage 7S protein
species: Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]

 Score =  264 bits (675), Expect = 1e-86
 Identities = 102/243 (41%), Positives = 145/243 (59%), Gaps = 6/243 (2%)

Query: 44  QCNIQDLNALEPQQRVESEAGVTEFWDQNDEQLQCANVAVFRHRIQQRGLVVPSYTNTPE 103
           +C + +LNALEP  RVESE G+ E W+    +LQCA V V +  + + GL +PSY+  P+
Sbjct: 2   ECQLNNLNALEPDHRVESEGGLIETWNSQHPELQCAGVTVSKRTLNRNGLHLPSYSPYPQ 61

Query: 104 LFYVVQGRGIHGAVFPGCPETYQESQQRSS----ESQSRSQDQHQKVRQIREGDLVALPT 159
           +  VVQG+G  G  FPGCPET+++ QQ+SS     SQ + QD HQK+R   EGD++ +P 
Sbjct: 62  MIIVVQGKGAIGFAFPGCPETFEKPQQQSSRRGSRSQQQLQDSHQKIRHFNEGDVLVIPP 121

Query: 160 GSANWIYNDGPSELVVVALVDVGNSDNQLDQFLRKFYLGGNPQPQLQGYSQSQGSRYQ-- 217
           G   W YN G   +V ++L+D  N +NQLDQ  R FYL GNP  +     Q Q  +    
Sbjct: 122 GVPYWTYNTGDEPVVAISLLDTSNFNNQLDQNPRVFYLAGNPDIEHPETMQQQQQQKSHG 181

Query: 218 GSQGGEGGDRSRRGGNLFRGFDERLLAEAFNVNPDLISKLQRPQMQKGIIVRVEEELRVL 277
           G + G+   +   GG++  GF +  LA++FN N D   KL+ P  ++  IV VE  L V+
Sbjct: 182 GRKQGQHQQQEEEGGSVLSGFSKHFLAQSFNTNEDTAEKLRSPDDERKQIVTVEGGLSVI 241

Query: 278 SPQ 280
           SP+
Sbjct: 242 SPK 244
>d1fxza1 b.82.1.2 (A:10-248) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} Length = 239 Back     information, alignment and structure
>d1od5a2 b.82.1.2 (A:321-493) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Length = 173 Back     information, alignment and structure
>d1od5a2 b.82.1.2 (A:321-493) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Length = 173 Back     information, alignment and structure
>d1fxza2 b.82.1.2 (A:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} Length = 174 Back     information, alignment and structure
>d1fxza2 b.82.1.2 (A:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} Length = 174 Back     information, alignment and structure
>d2et1a1 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare) [TaxId: 4513]} Length = 201 Back     information, alignment and structure
>d2et1a1 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare) [TaxId: 4513]} Length = 201 Back     information, alignment and structure
>d1uika2 b.82.1.2 (A:351-535) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Length = 185 Back     information, alignment and structure
>d1uika2 b.82.1.2 (A:351-535) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Length = 185 Back     information, alignment and structure
>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Length = 372 Back     information, alignment and structure
>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Length = 372 Back     information, alignment and structure
>d2phla1 b.82.1.2 (A:11-210) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Length = 200 Back     information, alignment and structure
>d2phla1 b.82.1.2 (A:11-210) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Length = 200 Back     information, alignment and structure
>d1uika1 b.82.1.2 (A:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Length = 203 Back     information, alignment and structure
>d1uika1 b.82.1.2 (A:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Length = 203 Back     information, alignment and structure
>d1dgwa_ b.82.1.2 (A:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]} Length = 178 Back     information, alignment and structure
>d1dgwa_ b.82.1.2 (A:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]} Length = 178 Back     information, alignment and structure
>d2phla2 b.82.1.2 (A:220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Length = 162 Back     information, alignment and structure
>d2phla2 b.82.1.2 (A:220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Length = 162 Back     information, alignment and structure
>d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} Length = 170 Back     information, alignment and structure
>d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} Length = 170 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query480
d1od5a1245 Seed storage 7S protein {Soybean (Glycine max), gl 100.0
d1fxza1239 Seed storage 7S protein {Soybean (Glycine max), pr 100.0
d1j58a_372 Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil 100.0
d1fxza2174 Seed storage 7S protein {Soybean (Glycine max), pr 100.0
d1od5a2173 Seed storage 7S protein {Soybean (Glycine max), gl 100.0
d2phla1200 Seed storage 7S protein {French bean (Phaseolus vu 100.0
d1uika2185 Seed storage 7S protein {Soybean (Glycine max), be 100.0
g1dgw.1168 Seed storage 7S protein {Jack bean (Canavalia ensi 100.0
d1uika2185 Seed storage 7S protein {Soybean (Glycine max), be 100.0
d1dgwa_178 Seed storage 7S protein {Jack bean (Canavalia ensi 100.0
d1uika1203 Seed storage 7S protein {Soybean (Glycine max), be 100.0
d1uija1170 Seed storage 7S protein {Soybean (Glycine max), be 100.0
d2et1a1201 Germin {Barley (Hordeum vulgare) [TaxId: 4513]} 99.98
d2phla2162 Seed storage 7S protein {French bean (Phaseolus vu 99.98
d1fxza2174 Seed storage 7S protein {Soybean (Glycine max), pr 99.97
g1dgw.1168 Seed storage 7S protein {Jack bean (Canavalia ensi 99.97
d1od5a2173 Seed storage 7S protein {Soybean (Glycine max), gl 99.96
d2phla2162 Seed storage 7S protein {French bean (Phaseolus vu 99.95
d1dgwa_178 Seed storage 7S protein {Jack bean (Canavalia ensi 99.95
d2phla1200 Seed storage 7S protein {French bean (Phaseolus vu 99.95
d1j58a_ 372 Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil 99.94
d1uija1170 Seed storage 7S protein {Soybean (Glycine max), be 99.94
d1uika1203 Seed storage 7S protein {Soybean (Glycine max), be 99.93
d2et1a1201 Germin {Barley (Hordeum vulgare) [TaxId: 4513]} 99.92
d1od5a1245 Seed storage 7S protein {Soybean (Glycine max), gl 99.9
d1fxza1239 Seed storage 7S protein {Soybean (Glycine max), pr 99.89
d1juha_348 Quercetin 2,3-dioxygenase {Aspergillus japonicus [ 99.85
d2d40a1308 Gentisate 1,2-dioxygenase {Escherichia coli [TaxId 99.77
d2phda1351 Gentisate 1,2-dioxygenase {Pseudaminobacter salicy 99.74
d1y3ta1330 Hypothetical protein YxaG {Bacillus subtilis [TaxI 99.73
d3bu7a1355 Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [ 99.69
d1sefa_250 Hypothetical protein EF2996 {Enterococcus faecalis 99.62
d1sq4a_273 Glyoxylate-induced protein PA1140 {Pseudomonas aer 99.61
d1sfna_245 Hypothetical protein DR1152 {Deinococcus radiodura 99.57
d1rc6a_253 Hypothetical protein YlbA {Escherichia coli [TaxId 99.5
d1o4ta_115 Hypothetical protein TM1287 {Thermotoga maritima [ 99.27
d2b8ma1108 Hypothetical protein MJ0764 {Archaeon Methanococcu 99.25
d1lr5a_160 Auxin binding protein {Maize (Zea mays) [TaxId: 45 99.19
d1vj2a_114 Hypothetical protein TM1459 {Thermotoga maritima [ 99.17
d1o4ta_115 Hypothetical protein TM1287 {Thermotoga maritima [ 99.08
d1v70a_105 Hypothetical protein TTHA0104 {Thermus thermophilu 99.05
d1x82a_190 Glucose-6-phosphate isomerase, GPI {Archaeon Pyroc 99.02
d2f4pa1134 Hypothetical protein TM1010 {Thermotoga maritima [ 99.02
d1y9qa299 Probable transcriptional regulator VC1968, C-termi 99.02
d1v70a_105 Hypothetical protein TTHA0104 {Thermus thermophilu 98.98
d1sfna_245 Hypothetical protein DR1152 {Deinococcus radiodura 98.97
d1lr5a_160 Auxin binding protein {Maize (Zea mays) [TaxId: 45 98.97
d2b8ma1108 Hypothetical protein MJ0764 {Archaeon Methanococcu 98.97
d1sq4a_273 Glyoxylate-induced protein PA1140 {Pseudomonas aer 98.84
d1vj2a_114 Hypothetical protein TM1459 {Thermotoga maritima [ 98.82
d1x82a_190 Glucose-6-phosphate isomerase, GPI {Archaeon Pyroc 98.81
d1sefa_250 Hypothetical protein EF2996 {Enterococcus faecalis 98.77
d2f4pa1134 Hypothetical protein TM1010 {Thermotoga maritima [ 98.76
d1yhfa1112 Hypothetical protein SPy1581 {Streptococcus pyogen 98.76
d1juha_ 348 Quercetin 2,3-dioxygenase {Aspergillus japonicus [ 98.74
d1rc6a_253 Hypothetical protein YlbA {Escherichia coli [TaxId 98.73
d1y9qa299 Probable transcriptional regulator VC1968, C-termi 98.6
d2bnma2122 Hydroxypropylphosphonic acid epoxidase Fom4, C-ter 98.54
d2d40a1 308 Gentisate 1,2-dioxygenase {Escherichia coli [TaxId 98.53
d3bu7a1355 Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [ 98.52
d2phda1 351 Gentisate 1,2-dioxygenase {Pseudaminobacter salicy 98.46
d2pyta1128 Ethanolamine utilization protein EutQ {Salmonella 98.46
d1yhfa1112 Hypothetical protein SPy1581 {Streptococcus pyogen 98.45
d1y3ta1 330 Hypothetical protein YxaG {Bacillus subtilis [TaxI 98.43
d2pyta1128 Ethanolamine utilization protein EutQ {Salmonella 98.37
d1zrra1179 Acireductone dioxygenase {Klebsiella pneumoniae [T 98.1
d2bnma2122 Hydroxypropylphosphonic acid epoxidase Fom4, C-ter 98.05
d1vr3a1179 Acireductone dioxygenase {Mouse (Mus musculus) [Ta 97.84
d1zrra1179 Acireductone dioxygenase {Klebsiella pneumoniae [T 97.79
d2pa7a1135 dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Ane 97.71
d1vr3a1179 Acireductone dioxygenase {Mouse (Mus musculus) [Ta 97.64
d1o5ua_88 Hypothetical protein TM1112 {Thermotoga maritima [ 97.19
d2o1qa1144 Putative acetyl/propionyl-CoA carboxylase subunit 97.17
d2arca_161 Regulatory protein AraC {Escherichia coli [TaxId: 97.14
d2pa7a1135 dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Ane 96.85
d1o5ua_88 Hypothetical protein TM1112 {Thermotoga maritima [ 96.68
d2o1qa1144 Putative acetyl/propionyl-CoA carboxylase subunit 96.65
d2arca_161 Regulatory protein AraC {Escherichia coli [TaxId: 96.22
d1dzra_183 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Salmone 96.14
d1vrba1319 Putative asparaginyl hydroxylase YxbC {Bacillus su 96.11
d2ixca1198 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Mycobac 96.07
d1pmia_440 Phosphomannose isomerase {Yeast (Candida albicans) 96.03
d1oi6a_202 dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD {Amyc 95.97
d1wlta1176 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeo 95.96
d2c0za1190 Novobiocin biosynthesis protein NovW {Streptomyces 95.78
d2ixha1184 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Pseudom 95.71
d1ep0a_183 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeo 95.58
d1yfua1174 3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia m 95.53
d1nxma_194 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Strepto 95.42
d1vrba1319 Putative asparaginyl hydroxylase YxbC {Bacillus su 95.16
d1qwra_315 Mannose-6-phosphate isomerase ManA {Bacillus subti 94.73
d1wlta1176 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeo 94.26
d1dzra_183 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Salmone 94.21
d1zvfa1175 3-hydroxyanthranilate-3,4-dioxygenase {Baker's yea 94.18
d1yfua1174 3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia m 94.12
d1oi6a_202 dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD {Amyc 93.96
d2ixca1198 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Mycobac 93.87
d1eyba_439 Homogentisate dioxygenase {Human (Homo sapiens) [T 93.72
d1zvfa1175 3-hydroxyanthranilate-3,4-dioxygenase {Baker's yea 93.71
d1h2ka_335 Hypoxia-inducible factor HIF ihhibitor (FIH1) {Hum 93.63
d2c0za1190 Novobiocin biosynthesis protein NovW {Streptomyces 92.84
d1pmia_440 Phosphomannose isomerase {Yeast (Candida albicans) 92.81
d1yuda1158 Hypothetical protein SO0799 {Shewanella oneidensis 92.26
d2ixha1184 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Pseudom 91.79
d1ep0a_183 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeo 90.39
d1nxma_194 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Strepto 89.93
d1h2ka_335 Hypoxia-inducible factor HIF ihhibitor (FIH1) {Hum 89.39
d1eyba_ 439 Homogentisate dioxygenase {Human (Homo sapiens) [T 89.2
d1znpa1140 Hypothetical protein Atu3615 {Agrobacterium tumefa 88.93
d1e5ra_290 Type II Proline 3-hydroxylase (proline oxidase) {S 88.69
d2gm6a1192 Cysteine dioxygenase type I {Ralstonia eutropha [T 85.9
d3elna1186 Cysteine dioxygenase type I {Rattus norvegicus [Ta 85.0
d3bb6a1109 Uncharacterized protein YeaR {Escherichia coli [Ta 84.76
d2zcwa2112 Transcriptional regulator TTHA1359, N-terminal dom 83.45
d1qwra_315 Mannose-6-phosphate isomerase ManA {Bacillus subti 83.03
d1i5za2132 Catabolite gene activator protein, N-terminal doma 80.25
>d1od5a1 b.82.1.2 (A:7-251) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Back     information, alignment and structure
class: All beta proteins
fold: Double-stranded beta-helix
superfamily: RmlC-like cupins
family: Germin/Seed storage 7S protein
domain: Seed storage 7S protein
species: Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]

Probab=100.00  E-value=5.3e-68  Score=515.54  Aligned_cols=238  Identities=43%  Similarity=0.783  Sum_probs=199.2

Q ss_pred             CcccccccCCCCCCcceecCCceEEEeCCCChhccccCeeEEEEEEcCCeeecCcccCCCeEEEEEeceEEEEEEcCCCc
Q 048197           43 TQCNIQDLNALEPQQRVESEAGVTEFWDQNDEQLQCANVAVFRHRIQQRGLVVPSYTNTPELFYVVQGRGIHGAVFPGCP  122 (480)
Q Consensus        43 ~~C~~~~L~a~eP~~~~~se~G~~e~~~~~~~~l~~~gvs~~r~~i~p~gl~lPh~~~a~el~yV~~G~g~~g~v~pg~~  122 (480)
                      |+|+|++|+|+||+++++||||+||+||+++++|+|+||++.|++|+|+||+||||++|+.|+||++|+|++|+|+|||+
T Consensus         1 ~~C~~~~L~a~eP~~r~~sE~G~~E~wd~~~~qlqcagV~~~r~~I~p~gL~lP~ys~a~~i~yV~qG~G~~giv~Pgc~   80 (245)
T d1od5a1           1 NECQLNNLNALEPDHRVESEGGLIETWNSQHPELQCAGVTVSKRTLNRNGLHLPSYSPYPQMIIVVQGKGAIGFAFPGCP   80 (245)
T ss_dssp             CTTCCSCCCCBCCCEEEEETTEEEEECCTTSHHHHHHTCEEEEEEECTTEEEEEEECSSCEEEEEEECEEEEEECCTTCC
T ss_pred             CcccccccccCCCchhhcccCCeEEeCCCCCHHHhhcCceeEEEEEcCCccccccccCCCeEEEEEeCEEEEEEEeCCCh
Confidence            68999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cchhhhhhccc----ccccccccccceeEeecCCcEEEeCCCCEEEEEcCCCCcEEEEEEeeCCCCCccccccceeeeec
Q 048197          123 ETYQESQQRSS----ESQSRSQDQHQKVRQIREGDLVALPTGSANWIYNDGPSELVVVALVDVGNSDNQLDQFLRKFYLG  198 (480)
Q Consensus       123 etf~~~~~~~~----~~~~~~~d~~qk~~~l~~GDV~~iPaG~~h~~~N~G~~~l~~v~~~d~~n~~nqld~~~~~F~La  198 (480)
                      +||++++++.+    ++++++.|.|||+++|++||||+||||++||+||+||++|++|+++|++|+.||||++++.||||
T Consensus        81 et~~~~~~~~~~~~~~~~~~~~d~~qk~~rl~~GDVi~iPAG~~~w~yNdgn~~Lv~v~~~d~~N~~NQLd~~~r~F~la  160 (245)
T d1od5a1          81 ETFEKPQQQSSRRGSRSQQQLQDSHQKIRHFNEGDVLVIPPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQNPRVFYLA  160 (245)
T ss_dssp             CCEEECC---------------EEESCEEEEETTEEEEECTTCCEEEEECSSSCEEEEEEECTTCTTCCSCSSCCCEESS
T ss_pred             hhhcchhhcccccccccccccccceeeeecccCCCEEEECCCceEEEEeCCCCcEEEEEEEcccCcccccCCcceeEEec
Confidence            99987766432    23456789999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCcCccccccccCcc--ccCCCCCCCCCcccccCcccccCCHHHHHhhcCCCHHHHHHhccccccceeEEEeccceec
Q 048197          199 GNPQPQLQGYSQSQGSR--YQGSQGGEGGDRSRRGGNLFRGFDERLLAEAFNVNPDLISKLQRPQMQKGIIVRVEEELRV  276 (480)
Q Consensus       199 G~~~~~~~~~~~~~~~~--~~g~~~~~~~~~~~~~~ni~~gf~~~~La~af~v~~~~~~kl~~~~~~rg~Iv~v~~~l~~  276 (480)
                      |+++.++...++.++++  ..+++++++++++..++|||+||++++||+||||+.++|+||++++|+||.||||+++|++
T Consensus       161 G~~~~~~~~~~~~q~~~~~~~~~~~~~~~~~~~~~~nif~gF~~~~La~Af~v~~e~~~klq~~~~~rG~IVrv~~~l~~  240 (245)
T d1od5a1         161 GNPDIEHPETMQQQQQQKSHGGRKQGQHQQQEEEGGSVLSGFSKHFLAQSFNTNEDTAEKLRSPDDERKQIVTVEGGLSV  240 (245)
T ss_dssp             SCCCCSCTTTTC---------------------CCCCTTTTSCHHHHHHHTTCCHHHHHHTTCTTCCSCSEEECSSCCCC
T ss_pred             CCcccccchhcccchhhhhcccccccccccccccCCCeeecCCHHHHHHHHCCCHHHHHHHhCcccCCCcEEEEcCCccc
Confidence            99876554332222222  1233333444566677999999999999999999999999999999999999999999999


Q ss_pred             cCCc
Q 048197          277 LSPQ  280 (480)
Q Consensus       277 ~~P~  280 (480)
                      ++|.
T Consensus       241 ~~P~  244 (245)
T d1od5a1         241 ISPK  244 (245)
T ss_dssp             CCSC
T ss_pred             cCCC
Confidence            9985
>d1fxza1 b.82.1.2 (A:10-248) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} Back     information, alignment and structure
>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1fxza2 b.82.1.2 (A:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} Back     information, alignment and structure
>d1od5a2 b.82.1.2 (A:321-493) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Back     information, alignment and structure
>d2phla1 b.82.1.2 (A:11-210) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Back     information, alignment and structure
>d1uika2 b.82.1.2 (A:351-535) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Back     information, alignment and structure
>d1uika2 b.82.1.2 (A:351-535) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Back     information, alignment and structure
>d1dgwa_ b.82.1.2 (A:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]} Back     information, alignment and structure
>d1uika1 b.82.1.2 (A:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Back     information, alignment and structure
>d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} Back     information, alignment and structure
>d2et1a1 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare) [TaxId: 4513]} Back     information, alignment and structure
>d2phla2 b.82.1.2 (A:220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Back     information, alignment and structure
>d1fxza2 b.82.1.2 (A:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} Back     information, alignment and structure
>d1od5a2 b.82.1.2 (A:321-493) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Back     information, alignment and structure
>d2phla2 b.82.1.2 (A:220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Back     information, alignment and structure
>d1dgwa_ b.82.1.2 (A:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]} Back     information, alignment and structure
>d2phla1 b.82.1.2 (A:11-210) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Back     information, alignment and structure
>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} Back     information, alignment and structure
>d1uika1 b.82.1.2 (A:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Back     information, alignment and structure
>d2et1a1 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare) [TaxId: 4513]} Back     information, alignment and structure
>d1od5a1 b.82.1.2 (A:7-251) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Back     information, alignment and structure
>d1fxza1 b.82.1.2 (A:10-248) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} Back     information, alignment and structure
>d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} Back     information, alignment and structure
>d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} Back     information, alignment and structure
>d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} Back     information, alignment and structure
>d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o4ta_ b.82.1.9 (A:) Hypothetical protein TM1287 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b8ma1 b.82.1.18 (A:1-108) Hypothetical protein MJ0764 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1lr5a_ b.82.1.2 (A:) Auxin binding protein {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1vj2a_ b.82.1.10 (A:) Hypothetical protein TM1459 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1o4ta_ b.82.1.9 (A:) Hypothetical protein TM1287 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v70a_ b.82.1.9 (A:) Hypothetical protein TTHA0104 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1x82a_ b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2f4pa1 b.82.1.9 (A:2-135) Hypothetical protein TM1010 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y9qa2 b.82.1.15 (A:83-181) Probable transcriptional regulator VC1968, C-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1v70a_ b.82.1.9 (A:) Hypothetical protein TTHA0104 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1lr5a_ b.82.1.2 (A:) Auxin binding protein {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2b8ma1 b.82.1.18 (A:1-108) Hypothetical protein MJ0764 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vj2a_ b.82.1.10 (A:) Hypothetical protein TM1459 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1x82a_ b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2f4pa1 b.82.1.9 (A:2-135) Hypothetical protein TM1010 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} Back     information, alignment and structure
>d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y9qa2 b.82.1.15 (A:83-181) Probable transcriptional regulator VC1968, C-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2bnma2 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]} Back     information, alignment and structure
>d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} Back     information, alignment and structure
>d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} Back     information, alignment and structure
>d2pyta1 b.82.1.24 (A:100-227) Ethanolamine utilization protein EutQ {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2pyta1 b.82.1.24 (A:100-227) Ethanolamine utilization protein EutQ {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1zrra1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2bnma2 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]} Back     information, alignment and structure
>d1vr3a1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zrra1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2pa7a1 b.82.1.1 (A:2-136) dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Aneurinibacillus thermoaerophilus [TaxId: 143495]} Back     information, alignment and structure
>d1vr3a1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o5ua_ b.82.1.8 (A:) Hypothetical protein TM1112 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2o1qa1 b.82.1.21 (A:1-144) Putative acetyl/propionyl-CoA carboxylase subunit alpha Mpe_A3659 {Rubrivivax gelatinosus [TaxId: 28068]} Back     information, alignment and structure
>d2arca_ b.82.4.1 (A:) Regulatory protein AraC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pa7a1 b.82.1.1 (A:2-136) dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Aneurinibacillus thermoaerophilus [TaxId: 143495]} Back     information, alignment and structure
>d1o5ua_ b.82.1.8 (A:) Hypothetical protein TM1112 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2o1qa1 b.82.1.21 (A:1-144) Putative acetyl/propionyl-CoA carboxylase subunit alpha Mpe_A3659 {Rubrivivax gelatinosus [TaxId: 28068]} Back     information, alignment and structure
>d2arca_ b.82.4.1 (A:) Regulatory protein AraC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dzra_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vrba1 b.82.2.11 (A:8-326) Putative asparaginyl hydroxylase YxbC {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ixca1 b.82.1.1 (A:1-198) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pmia_ b.82.1.3 (A:) Phosphomannose isomerase {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d1oi6a_ b.82.1.1 (A:) dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1wlta1 b.82.1.1 (A:1-176) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2c0za1 b.82.1.1 (A:1-190) Novobiocin biosynthesis protein NovW {Streptomyces caeruleus [TaxId: 195949]} Back     information, alignment and structure
>d2ixha1 b.82.1.1 (A:1-184) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ep0a_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1yfua1 b.82.1.20 (A:1-174) 3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia metallidurans [TaxId: 119219]} Back     information, alignment and structure
>d1nxma_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Streptococcus suis [TaxId: 1307]} Back     information, alignment and structure
>d1vrba1 b.82.2.11 (A:8-326) Putative asparaginyl hydroxylase YxbC {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qwra_ b.82.1.3 (A:) Mannose-6-phosphate isomerase ManA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wlta1 b.82.1.1 (A:1-176) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1dzra_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1zvfa1 b.82.1.20 (A:1-175) 3-hydroxyanthranilate-3,4-dioxygenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfua1 b.82.1.20 (A:1-174) 3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia metallidurans [TaxId: 119219]} Back     information, alignment and structure
>d1oi6a_ b.82.1.1 (A:) dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d2ixca1 b.82.1.1 (A:1-198) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1eyba_ b.82.1.4 (A:) Homogentisate dioxygenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zvfa1 b.82.1.20 (A:1-175) 3-hydroxyanthranilate-3,4-dioxygenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1h2ka_ b.82.2.6 (A:) Hypoxia-inducible factor HIF ihhibitor (FIH1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c0za1 b.82.1.1 (A:1-190) Novobiocin biosynthesis protein NovW {Streptomyces caeruleus [TaxId: 195949]} Back     information, alignment and structure
>d1pmia_ b.82.1.3 (A:) Phosphomannose isomerase {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d1yuda1 b.82.1.16 (A:1-158) Hypothetical protein SO0799 {Shewanella oneidensis [TaxId: 70863]} Back     information, alignment and structure
>d2ixha1 b.82.1.1 (A:1-184) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ep0a_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1nxma_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Streptococcus suis [TaxId: 1307]} Back     information, alignment and structure
>d1h2ka_ b.82.2.6 (A:) Hypoxia-inducible factor HIF ihhibitor (FIH1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eyba_ b.82.1.4 (A:) Homogentisate dioxygenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znpa1 b.82.1.16 (A:4-143) Hypothetical protein Atu3615 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1e5ra_ b.82.2.4 (A:) Type II Proline 3-hydroxylase (proline oxidase) {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d2gm6a1 b.82.1.19 (A:11-202) Cysteine dioxygenase type I {Ralstonia eutropha [TaxId: 106590]} Back     information, alignment and structure
>d3elna1 b.82.1.19 (A:5-190) Cysteine dioxygenase type I {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d3bb6a1 b.82.2.13 (A:1-109) Uncharacterized protein YeaR {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qwra_ b.82.1.3 (A:) Mannose-6-phosphate isomerase ManA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure