Citrus Sinensis ID: 048199


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-----
MDEVSTEPVVPAVKPDMKPSSTDTAPQETDAAAAYTAAASTSEVGVSELDKDMLCPICMQIIKEAFLTACGHSFCYMCIITHLRNKSDCPCCGHYLTNNQLYPNFLLDKLLKKTSARQISKTASPLENFRQALQQGCGVSVKEIDSLMSLLSEKKRKMEQEEAERNMQILLDFLHCLRKQKVDELKEIQTDLHYIKEDINAVERHRIDLYRARDRYSVKLRMLGDDSNTRKSWLSSIDKNSSGIITSSLNARGGSSAGSLQNKKGDGKAQANSHGHQRKDSLTGSDSQCLNQSGLSVVRKKRVHAQFNDLQECYLQKRRQMANQPHTKQESDKNIIHREGYNAGLADFQSVLTTFTRYSRLRVIAELRHGDIFHSANIVSSIEFDRDDQLFATAGVSRRIKVFDFASVVNEPADVHCPVVEMPTRSKLSCLSWNKFSKNRIASSDYEGIVTVWDVTTQQSVMEYEEHEKRAWSVDFSRTEPSMLVSGSDDCKVLY
cccccccccccccccccccccccccccccHHHHHccccccccHHHHHccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHcccccccccHHHHHHHHHccccccHHHHHHHHHcccHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHcccccccccccccccHccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccEEcccEEEEEEEcccccccccccccEEEccccccEEEcccccEEEEEEcccccccccccccccEEccccccccccccccccccEEEEcccccEEEEEEcccccEEEEEcccccEEEEEEccccccccEEEcccccEEcc
***********************************************ELDKDMLCPICMQIIKEAFLTACGHSFCYMCIITHLRNKSDCPCCGHYLTNNQLYPNFLLDKLLKK*******************LQQGCGVSVKEIDSLMSLLSEKKRKM*QEEAERNMQILLDFLHCLRKQKVDELKEIQTDLHYIKEDINAVERHRIDLYRARDRYSVKLRML******************************************************************LNQSGLSVVRKKRVHAQFNDLQECYLQKRRQM********************NAGLADFQSVLTTFTRYSRLRVIAELRHGDIFHSANIVSSIEFDRDDQLFATAGVSRRIKVFDFASVVNEPADVHCPVVEMPTRSKLSCLSWNKFSKNRIASSDYEGIVTVWDVTTQQSVMEYEEHEKRAWSVDFSRTEPSMLVSGSDDCKVLY
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDEVSTEPVVPAVKPDMKPSSTDTAPQETDAAAAYTAAASTSEVGVSELDKDMLCPICMQIIKEAFLTACGHSFCYMCIITHLRNKSDCPCCGHYLTNNQLYPNFLLDKLLKKTSARQISKTASPLENFRQALQQGCGVSxxxxxxxxxxxxxxxxxxxxxxxxRNMQILLDFLHCLRKQKVDELKEIQTDLHYIKEDINAVERHRIDLYRARDRYSVKLRMLGDDSNTRKSWLSSIDKNSSGIITSSLNARGGSSAGSLQNKKGDGKAQANSHGHQRKDSLTGSDSQCLNQSGLSVVRKKRVHAQFNDLQECYLQKRRQMANQPHTKQESDKNIIHREGYNAGLADFQSVLTTFTRYSRLRVIAELRHGDIFHSANIVSSIEFDRDDQLFATAGVSRRIKVFDFASVVNEPADVHCPVVEMPTRSKLSCLSWNKFSKNRIASSDYEGIVTVWDVTTQQSVMEYEEHEKRAWSVDFSRTEPSMLVSGSDDCKVLY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
E3 ubiquitin-protein ligase COP1 E3 ubiquitin-protein ligase that acts as a repressor of photomorphogenesis and as an activator of etiolation in darkness. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Represses photomorphogenesis in darkness by mediating ubiquitination and subsequent proteasomal degradation of light-induced transcription factors such as HY5, HYH and LAF1. Down-regulates MYB21, probably via ubiquitination process. Light stimuli abrogate the repression of photomorphogenesis, possibly due to its localization to the cytoplasm. Could play a role in switching between skotomorphogenetic and photomorphogenetic pathways.probableP43254
E3 ubiquitin-protein ligase COP1 E3 ubiquitin-protein ligase that acts as a repressor of photomorphogenesis and as an activator of etiolation in darkness. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Represses photomorphogenesis in darkness by mediating ubiquitination and subsequent proteasomal degradation of light-induced transcription factors. Light stimuli abrogate the repression of photomorphogenesis, possibly due to its localization to the cytoplasm. Could play a role in switching between skotomorphogenetic and photomorphogenetic pathways.probableP93471

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3SFZ, chain A
Confidence level:very confident
Coverage over the Query: 339-495
View the alignment between query and template
View the model in PyMOL
Template: 4A11, chain B
Confidence level:very confident
Coverage over the Query: 325-495
View the alignment between query and template
View the model in PyMOL
Template: 3HCT, chain A
Confidence level:very confident
Coverage over the Query: 45-118
View the alignment between query and template
View the model in PyMOL
Template: 1GMJ, chain A
Confidence level:probable
Coverage over the Query: 172-211
View the alignment between query and template
View the model in PyMOL