Citrus Sinensis ID: 048199
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 495 | ||||||
| 224131692 | 672 | predicted protein [Populus trichocarpa] | 0.979 | 0.721 | 0.780 | 0.0 | |
| 15225760 | 675 | E3 ubiquitin-protein ligase COP1 [Arabid | 0.981 | 0.72 | 0.771 | 0.0 | |
| 297823085 | 675 | hypothetical protein ARALYDRAFT_902362 [ | 0.985 | 0.722 | 0.772 | 0.0 | |
| 402685 | 675 | regulatory protein [Arabidopsis thaliana | 0.981 | 0.72 | 0.769 | 0.0 | |
| 356554527 | 675 | PREDICTED: E3 ubiquitin-protein ligase C | 0.981 | 0.72 | 0.783 | 0.0 | |
| 255587080 | 677 | ubiquitin ligase protein cop1, putative | 0.989 | 0.723 | 0.774 | 0.0 | |
| 332656170 | 677 | constitutively photomorphogenic 1 [Brass | 0.981 | 0.717 | 0.756 | 0.0 | |
| 313667084 | 676 | COP1 protein [Brassica rapa var. purpura | 0.981 | 0.718 | 0.75 | 0.0 | |
| 302633366 | 677 | constitutively photomorphogenic 1 [Brass | 0.981 | 0.717 | 0.754 | 0.0 | |
| 356501265 | 669 | PREDICTED: E3 ubiquitin-protein ligase C | 0.969 | 0.717 | 0.765 | 0.0 |
| >gi|224131692|ref|XP_002321154.1| predicted protein [Populus trichocarpa] gi|222861927|gb|EEE99469.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 807 bits (2084), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 385/493 (78%), Positives = 432/493 (87%), Gaps = 8/493 (1%)
Query: 1 MDEVSTEPVVPAVKPDMKPSSTDTAPQETDAAAAYTAAASTSEVGVSELDKDMLCPICMQ 60
M+EVST +VPAVKP+ KPS++ T AA A +S +EL+KD LCPICMQ
Sbjct: 1 MEEVSTGAIVPAVKPEPKPSTS------TAAAVASPEPSSAPSAEEAELEKDFLCPICMQ 54
Query: 61 IIKEAFLTACGHSFCYMCIITHLRNKSDCPCCGHYLTNNQLYPNFLLDKLLKKTSARQIS 120
IIK+AFLT CGHSFCYMCI THLRNK+DCPCC HYLT NQL+PNFLL KLLKK SARQ S
Sbjct: 55 IIKDAFLTVCGHSFCYMCITTHLRNKNDCPCCSHYLTTNQLFPNFLLQKLLKKASARQTS 114
Query: 121 KTASPLENFRQALQQGCGVSVKEIDSLMSLLSEKKRKMEQEEAERNMQILLDFLHCLRKQ 180
K ASP+E+FRQ+LQQGC VS+K++D+LMSLL+E+KRKMEQEEAERNMQ+LLDFLH LRKQ
Sbjct: 115 KNASPIEHFRQSLQQGCEVSIKDLDTLMSLLAERKRKMEQEEAERNMQVLLDFLHYLRKQ 174
Query: 181 KVDELKEIQTDLHYIKEDINAVERHRIDLYRARDRYSVKLRMLGDDSNTRKSWLSSIDKN 240
KVDEL E++TDL YIKEDI+AVE+HRI+LYRARDRYS+KLRMLGDD RK W S+IDKN
Sbjct: 175 KVDELNEVRTDLRYIKEDIDAVEKHRIELYRARDRYSMKLRMLGDDLTVRKPWPSTIDKN 234
Query: 241 SSGIITSSLNARGGSSAGSLQNKKGDGKAQANSHGHQRKDSLTGSDSQCLNQSGLSVVRK 300
SG++TSSLNARG ++ G++ KK DGKAQ +SHG QRKD+ GSD Q N SGLS V+K
Sbjct: 235 HSGVVTSSLNARGLTT-GNIPIKKMDGKAQVSSHGLQRKDTSGGSDPQ-YNHSGLSAVKK 292
Query: 301 KRVHAQFNDLQECYLQKRRQMANQPHTKQESDKNIIHREGYNAGLADFQSVLTTFTRYSR 360
KRVHAQFNDLQ+CYLQKRRQ+AN PH + E DKN+IHREGYNAGLADFQSVL TFT+YSR
Sbjct: 293 KRVHAQFNDLQDCYLQKRRQLANHPHNQSERDKNVIHREGYNAGLADFQSVLGTFTQYSR 352
Query: 361 LRVIAELRHGDIFHSANIVSSIEFDRDDQLFATAGVSRRIKVFDFASVVNEPADVHCPVV 420
LRVIAELRHGDIFHSANIVSSIEFDRDD+ FATAGVSRRIKVFDF+SVVNEPADVHCPVV
Sbjct: 353 LRVIAELRHGDIFHSANIVSSIEFDRDDEFFATAGVSRRIKVFDFSSVVNEPADVHCPVV 412
Query: 421 EMPTRSKLSCLSWNKFSKNRIASSDYEGIVTVWDVTTQQSVMEYEEHEKRAWSVDFSRTE 480
EM TRSKLSCLSWNKF+KN+IASSDYEGIVTVWDVTT+QSVMEYEEHEKRAWSVDFSRTE
Sbjct: 413 EMSTRSKLSCLSWNKFTKNQIASSDYEGIVTVWDVTTRQSVMEYEEHEKRAWSVDFSRTE 472
Query: 481 PSMLVSGSDDCKV 493
PSMLVSGSDDCKV
Sbjct: 473 PSMLVSGSDDCKV 485
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|15225760|ref|NP_180854.1| E3 ubiquitin-protein ligase COP1 [Arabidopsis thaliana] gi|20141387|sp|P43254.2|COP1_ARATH RecName: Full=E3 ubiquitin-protein ligase COP1; AltName: Full=Constitutive photomorphogenesis protein 1 gi|2702280|gb|AAB91983.1| COP1 regulatory protein [Arabidopsis thaliana] gi|95147316|gb|ABF57293.1| At2g32950 [Arabidopsis thaliana] gi|330253672|gb|AEC08766.1| E3 ubiquitin-protein ligase COP1 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297823085|ref|XP_002879425.1| hypothetical protein ARALYDRAFT_902362 [Arabidopsis lyrata subsp. lyrata] gi|297325264|gb|EFH55684.1| hypothetical protein ARALYDRAFT_902362 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|402685|gb|AAA32772.1| regulatory protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|356554527|ref|XP_003545597.1| PREDICTED: E3 ubiquitin-protein ligase COP1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255587080|ref|XP_002534127.1| ubiquitin ligase protein cop1, putative [Ricinus communis] gi|223525812|gb|EEF28255.1| ubiquitin ligase protein cop1, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|332656170|gb|AEE81754.1| constitutively photomorphogenic 1 [Brassica rapa subsp. rapa] | Back alignment and taxonomy information |
|---|
| >gi|313667084|gb|ADR72985.1| COP1 protein [Brassica rapa var. purpuraria] gi|338224822|gb|AEI89703.1| COP1 protein [Brassica rapa subsp. chinensis] | Back alignment and taxonomy information |
|---|
| >gi|302633366|gb|ADL59932.1| constitutively photomorphogenic 1 [Brassica napus] | Back alignment and taxonomy information |
|---|
| >gi|356501265|ref|XP_003519446.1| PREDICTED: E3 ubiquitin-protein ligase COP1-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 495 | ||||||
| TAIR|locus:2059359 | 675 | COP1 "CONSTITUTIVE PHOTOMORPHO | 0.985 | 0.722 | 0.766 | 6.7e-207 | |
| DICTYBASE|DDB_G0288453 | 970 | DDB_G0288453 "E3 ubiquitin-pro | 0.343 | 0.175 | 0.520 | 3e-83 | |
| UNIPROTKB|H0Y339 | 566 | RFWD2 "E3 ubiquitin-protein li | 0.365 | 0.319 | 0.441 | 3.8e-60 | |
| ZFIN|ZDB-GENE-070410-134 | 694 | rfwd2 "ring finger and WD repe | 0.397 | 0.283 | 0.434 | 2e-44 | |
| TAIR|locus:2039139 | 1029 | SPA1 "SUPPRESSOR OF PHYA-105 1 | 0.286 | 0.137 | 0.507 | 6.8e-42 | |
| RGD|1304773 | 433 | Rfwd2 "ring finger and WD repe | 0.365 | 0.418 | 0.441 | 3.6e-41 | |
| UNIPROTKB|F1NQ64 | 717 | RFWD2 "Uncharacterized protein | 0.367 | 0.253 | 0.448 | 8.1e-41 | |
| UNIPROTKB|E2RRJ5 | 733 | RFWD2 "Uncharacterized protein | 0.365 | 0.246 | 0.441 | 1.5e-40 | |
| MGI|MGI:1347046 | 733 | Rfwd2 "ring finger and WD repe | 0.365 | 0.246 | 0.441 | 1.5e-40 | |
| UNIPROTKB|F1MHX1 | 735 | RFWD2 "Uncharacterized protein | 0.365 | 0.246 | 0.441 | 1.5e-40 |
| TAIR|locus:2059359 COP1 "CONSTITUTIVE PHOTOMORPHOGENIC 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 2001 (709.4 bits), Expect = 6.7e-207, P = 6.7e-207
Identities = 378/493 (76%), Positives = 431/493 (87%)
Query: 1 MDEVSTEPVVPAVKPDMKPSSXXXXXXXXXXXXXXXXXXXXXXVGVSELDKDMLCPICMQ 60
M+E+ST+PVVPAVKPD + SS +G +LDKD+LCPICMQ
Sbjct: 1 MEEISTDPVVPAVKPDPRTSSVGEGANRHENDDGGSGGSE---IGAPDLDKDLLCPICMQ 57
Query: 61 IIKEAFLTACGHSFCYMCIITHLRNKSDCPCCGHYLTNNQLYPNFLLDKLLKKTSARQIS 120
IIK+AFLTACGHSFCYMCIITHLRNKSDCPCC +LTNNQLYPNFLLDKLLKKTSAR +S
Sbjct: 58 IIKDAFLTACGHSFCYMCIITHLRNKSDCPCCSQHLTNNQLYPNFLLDKLLKKTSARHVS 117
Query: 121 KTASPLENFRQALQQGCGVSVKEIDSLMSLLSEKKRKMEQEEAERNMQILLDFLHCLRKQ 180
KTASPL+ FR+ALQ+GC VS+KE+D+L++LL+E+KRKMEQEEAERNMQILLDFLHCLRKQ
Sbjct: 118 KTASPLDQFREALQRGCDVSIKEVDNLLTLLAERKRKMEQEEAERNMQILLDFLHCLRKQ 177
Query: 181 KVDELKEIQTDLHYIKEDINAVERHRIDLYRARDRYSVKLRMLGDDSNTRKSWLSSIDKN 240
KVDEL E+QTDL YIKEDINAVERHRIDLYRARDRYSVKLRMLGDD +TR +W +KN
Sbjct: 178 KVDELNEVQTDLQYIKEDINAVERHRIDLYRARDRYSVKLRMLGDDPSTRNAWPH--EKN 235
Query: 241 SSGIITSSLNARGGSSAGSLQNKKGDGKAQANSHGHQRKDSLTGSDSQCLNQSGLSVVRK 300
G ++SL+ RGG+ G+ QNKK +GKAQ +SHG +KD+L+GSDSQ LNQS +S+ RK
Sbjct: 236 QIGFNSNSLSIRGGNFVGNYQNKKVEGKAQGSSHGLPKKDALSGSDSQSLNQSTVSMARK 295
Query: 301 KRVHAQFNDLQECYLQKRRQMANQPHTKQESDKNIIHREGYNAGLADFQSVLTTFTRYSR 360
KR+HAQFNDLQECYLQKRRQ+A+QP++KQE+DK+++ REGY+ GLADFQSVLTTFTRYSR
Sbjct: 296 KRIHAQFNDLQECYLQKRRQLADQPNSKQENDKSVVRREGYSNGLADFQSVLTTFTRYSR 355
Query: 361 LRVIAELRHGDIFHSANIVSSIEFDRDDQLFATAGVSRRIKVFDFASVVNEPADVHCPVV 420
LRVIAE+RHGDIFHSANIVSSIEFDRDD+LFATAGVSR IKVFDF+SVVNEPAD+ CP+V
Sbjct: 356 LRVIAEIRHGDIFHSANIVSSIEFDRDDELFATAGVSRCIKVFDFSSVVNEPADMQCPIV 415
Query: 421 EMPTRSKLSCLSWNKFSKNRIASSDYEGIVTVWDVTTQQSVMEYEEHEKRAWSVDFSRTE 480
EM TRSKLSCLSWNK KN IASSDYEGIVTVWDVTT+QS+MEYEEHEKRAWSVDFSRTE
Sbjct: 416 EMSTRSKLSCLSWNKHEKNHIASSDYEGIVTVWDVTTRQSLMEYEEHEKRAWSVDFSRTE 475
Query: 481 PSMLVSGSDDCKV 493
PSMLVSGSDDCKV
Sbjct: 476 PSMLVSGSDDCKV 488
|
|
| DICTYBASE|DDB_G0288453 DDB_G0288453 "E3 ubiquitin-protein ligase RFWD2" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H0Y339 RFWD2 "E3 ubiquitin-protein ligase RFWD2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-070410-134 rfwd2 "ring finger and WD repeat domain 2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2039139 SPA1 "SUPPRESSOR OF PHYA-105 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| RGD|1304773 Rfwd2 "ring finger and WD repeat domain 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NQ64 RFWD2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RRJ5 RFWD2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1347046 Rfwd2 "ring finger and WD repeat domain 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MHX1 RFWD2 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 495 | |||
| PLN00181 | 793 | PLN00181, PLN00181, protein SPA1-RELATED; Provisio | 2e-44 | |
| pfam13923 | 45 | pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI | 3e-11 | |
| cd00200 | 289 | cd00200, WD40, WD40 domain, found in a number of e | 5e-11 | |
| cd00200 | 289 | cd00200, WD40, WD40 domain, found in a number of e | 2e-09 | |
| cd00162 | 45 | cd00162, RING, RING-finger (Really Interesting New | 2e-09 | |
| pfam00097 | 40 | pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING | 4e-09 | |
| smart00184 | 40 | smart00184, RING, Ring finger | 5e-09 | |
| cd00200 | 289 | cd00200, WD40, WD40 domain, found in a number of e | 1e-08 | |
| pfam13639 | 46 | pfam13639, zf-RING_2, Ring finger domain | 1e-08 | |
| COG5432 | 391 | COG5432, RAD18, RING-finger-containing E3 ubiquiti | 2e-08 | |
| TIGR00599 | 397 | TIGR00599, rad18, DNA repair protein rad18 | 6e-08 | |
| pfam13920 | 49 | pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI | 1e-05 | |
| smart00504 | 63 | smart00504, Ubox, Modified RING finger domain | 1e-04 | |
| COG2319 | 466 | COG2319, COG2319, FOG: WD40 repeat [General functi | 2e-04 | |
| COG2319 | 466 | COG2319, COG2319, FOG: WD40 repeat [General functi | 2e-04 | |
| COG5152 | 259 | COG5152, COG5152, Uncharacterized conserved protei | 3e-04 | |
| PLN03208 | 193 | PLN03208, PLN03208, E3 ubiquitin-protein ligase RM | 4e-04 | |
| COG5574 | 271 | COG5574, PEX10, RING-finger-containing E3 ubiquiti | 9e-04 | |
| PHA02929 | 238 | PHA02929, PHA02929, N1R/p28-like protein; Provisio | 0.001 | |
| COG2319 | 466 | COG2319, COG2319, FOG: WD40 repeat [General functi | 0.002 | |
| COG2319 | 466 | COG2319, COG2319, FOG: WD40 repeat [General functi | 0.002 |
| >gnl|CDD|177776 PLN00181, PLN00181, protein SPA1-RELATED; Provisional | Back alignment and domain information |
|---|
Score = 166 bits (421), Expect = 2e-44
Identities = 99/341 (29%), Positives = 178/341 (52%), Gaps = 19/341 (5%)
Query: 151 LSEKKRKMEQEEAERNMQILLDFLHCLRKQKVDELKEIQTDLHYIKEDINAVERHRIDLY 210
L E++ ME + ++LL+FL ++++K + ++Q + + DI+ V + ++
Sbjct: 275 LEEREAAMELRDRIEEQELLLEFLFLIQQRKQEAADKLQDTISLLSSDIDQVVKRQL--- 331
Query: 211 RARDRYSVKLRMLGDDSNTRKSWLSSIDKNSSGIITSSLNARGGSSAGSLQNKKGDGKAQ 270
+L + +S+L+S + G T + ++ L + +
Sbjct: 332 -----------VLQQKGSDVRSFLASRKRIRQGAETLAAEEENDDNSSKLDDTLESTLLE 380
Query: 271 ANSHGHQRKDSLTGSDSQCLNQSGLSVVRKKRVHAQFNDLQECYLQKRRQMANQPHTKQE 330
++ K + + Q + +K + ++ L E + + P
Sbjct: 381 SSRLMRNLKKLESVYFATRYRQIKAAAAAEKPLARYYSALSENGRSSEKSSMSNP----A 436
Query: 331 SDKNIIHREGYNAGLAD-FQSVLTTFTRYSRLRVIAELRHGDIFHSANIVSSIEFDRDDQ 389
+ + G D F L + +S+LRV A+L+ GD+ +S+N+V +I FDRD +
Sbjct: 437 KPPDFYINDSRQGGWIDPFLEGLCKYLSFSKLRVKADLKQGDLLNSSNLVCAIGFDRDGE 496
Query: 390 LFATAGVSRRIKVFDFASVVNEPADVHCPVVEMPTRSKLSCLSWNKFSKNRIASSDYEGI 449
FATAGV+++IK+F+ S++ + D+H PVVE+ +RSKLS + WN + K+++ASS++EG+
Sbjct: 497 FFATAGVNKKIKIFECESIIKDGRDIHYPVVELASRSKLSGICWNSYIKSQVASSNFEGV 556
Query: 450 VTVWDVTTQQSVMEYEEHEKRAWSVDFSRTEPSMLVSGSDD 490
V VWDV Q V E +EHEKR WS+D+S +P++L SGSDD
Sbjct: 557 VQVWDVARSQLVTEMKEHEKRVWSIDYSSADPTLLASGSDD 597
|
Length = 793 |
| >gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment | Back alignment and domain information |
|---|
| >gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment | Back alignment and domain information |
|---|
| >gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|214546 smart00184, RING, Ring finger | Back alignment and domain information |
|---|
| >gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment | Back alignment and domain information |
|---|
| >gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain | Back alignment and domain information |
|---|
| >gnl|CDD|227719 COG5432, RAD18, RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|233043 TIGR00599, rad18, DNA repair protein rad18 | Back alignment and domain information |
|---|
| >gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|128780 smart00504, Ubox, Modified RING finger domain | Back alignment and domain information |
|---|
| >gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|227481 COG5152, COG5152, Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|178747 PLN03208, PLN03208, E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227861 COG5574, PEX10, RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|222944 PHA02929, PHA02929, N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 495 | |||
| KOG0289 | 506 | consensus mRNA splicing factor [General function p | 99.97 | |
| KOG0272 | 459 | consensus U4/U6 small nuclear ribonucleoprotein Pr | 99.91 | |
| KOG0271 | 480 | consensus Notchless-like WD40 repeat-containing pr | 99.88 | |
| KOG0263 | 707 | consensus Transcription initiation factor TFIID, s | 99.87 | |
| KOG0272 | 459 | consensus U4/U6 small nuclear ribonucleoprotein Pr | 99.87 | |
| KOG0271 | 480 | consensus Notchless-like WD40 repeat-containing pr | 99.86 | |
| KOG0263 | 707 | consensus Transcription initiation factor TFIID, s | 99.86 | |
| PLN00181 | 793 | protein SPA1-RELATED; Provisional | 99.85 | |
| KOG0286 | 343 | consensus G-protein beta subunit [General function | 99.83 | |
| KOG0279 | 315 | consensus G protein beta subunit-like protein [Sig | 99.83 | |
| KOG0284 | 464 | consensus Polyadenylation factor I complex, subuni | 99.82 | |
| KOG0286 | 343 | consensus G-protein beta subunit [General function | 99.81 | |
| KOG0276 | 794 | consensus Vesicle coat complex COPI, beta' subunit | 99.8 | |
| KOG0319 | 775 | consensus WD40-repeat-containing subunit of the 18 | 99.79 | |
| KOG0279 | 315 | consensus G protein beta subunit-like protein [Sig | 99.79 | |
| KOG0273 | 524 | consensus Beta-transducin family (WD-40 repeat) pr | 99.79 | |
| KOG0266 | 456 | consensus WD40 repeat-containing protein [General | 99.78 | |
| KOG0266 | 456 | consensus WD40 repeat-containing protein [General | 99.78 | |
| PTZ00421 | 493 | coronin; Provisional | 99.78 | |
| KOG0282 | 503 | consensus mRNA splicing factor [Function unknown] | 99.78 | |
| KOG0264 | 422 | consensus Nucleosome remodeling factor, subunit CA | 99.78 | |
| KOG0284 | 464 | consensus Polyadenylation factor I complex, subuni | 99.77 | |
| KOG0645 | 312 | consensus WD40 repeat protein [General function pr | 99.77 | |
| KOG0277 | 311 | consensus Peroxisomal targeting signal type 2 rece | 99.77 | |
| KOG0295 | 406 | consensus WD40 repeat-containing protein [Function | 99.77 | |
| KOG0313 | 423 | consensus Microtubule binding protein YTM1 (contai | 99.76 | |
| KOG0293 | 519 | consensus WD40 repeat-containing protein [Function | 99.76 | |
| KOG0285 | 460 | consensus Pleiotropic regulator 1 [RNA processing | 99.76 | |
| KOG0645 | 312 | consensus WD40 repeat protein [General function pr | 99.75 | |
| KOG0302 | 440 | consensus Ribosome Assembly protein [General funct | 99.75 | |
| KOG0291 | 893 | consensus WD40-repeat-containing subunit of the 18 | 99.74 | |
| KOG0319 | 775 | consensus WD40-repeat-containing subunit of the 18 | 99.74 | |
| KOG0275 | 508 | consensus Conserved WD40 repeat-containing protein | 99.73 | |
| KOG0315 | 311 | consensus G-protein beta subunit-like protein (con | 99.72 | |
| PTZ00420 | 568 | coronin; Provisional | 99.72 | |
| KOG0277 | 311 | consensus Peroxisomal targeting signal type 2 rece | 99.71 | |
| KOG0313 | 423 | consensus Microtubule binding protein YTM1 (contai | 99.71 | |
| KOG0276 | 794 | consensus Vesicle coat complex COPI, beta' subunit | 99.71 | |
| KOG0281 | 499 | consensus Beta-TrCP (transducin repeats containing | 99.71 | |
| KOG0318 | 603 | consensus WD40 repeat stress protein/actin interac | 99.71 | |
| KOG0310 | 487 | consensus Conserved WD40 repeat-containing protein | 99.7 | |
| PTZ00421 | 493 | coronin; Provisional | 99.7 | |
| KOG0265 | 338 | consensus U5 snRNP-specific protein-like factor an | 99.69 | |
| KOG0315 | 311 | consensus G-protein beta subunit-like protein (con | 99.69 | |
| KOG1645 | 463 | consensus RING-finger-containing E3 ubiquitin liga | 99.69 | |
| PTZ00420 | 568 | coronin; Provisional | 99.69 | |
| KOG0269 | 839 | consensus WD40 repeat-containing protein [Function | 99.68 | |
| KOG0295 | 406 | consensus WD40 repeat-containing protein [Function | 99.68 | |
| KOG0278 | 334 | consensus Serine/threonine kinase receptor-associa | 99.67 | |
| KOG0281 | 499 | consensus Beta-TrCP (transducin repeats containing | 99.67 | |
| KOG0282 | 503 | consensus mRNA splicing factor [Function unknown] | 99.67 | |
| KOG0292 | 1202 | consensus Vesicle coat complex COPI, alpha subunit | 99.67 | |
| KOG1407 | 313 | consensus WD40 repeat protein [Function unknown] | 99.66 | |
| KOG0292 | 1202 | consensus Vesicle coat complex COPI, alpha subunit | 99.66 | |
| KOG0273 | 524 | consensus Beta-transducin family (WD-40 repeat) pr | 99.66 | |
| KOG0283 | 712 | consensus WD40 repeat-containing protein [Function | 99.66 | |
| KOG0640 | 430 | consensus mRNA cleavage stimulating factor complex | 99.66 | |
| KOG0264 | 422 | consensus Nucleosome remodeling factor, subunit CA | 99.65 | |
| KOG0288 | 459 | consensus WD40 repeat protein TipD [General functi | 99.65 | |
| KOG0316 | 307 | consensus Conserved WD40 repeat-containing protein | 99.64 | |
| KOG0303 | 472 | consensus Actin-binding protein Coronin, contains | 99.64 | |
| KOG0265 | 338 | consensus U5 snRNP-specific protein-like factor an | 99.64 | |
| KOG0308 | 735 | consensus Conserved WD40 repeat-containing protein | 99.64 | |
| KOG0283 | 712 | consensus WD40 repeat-containing protein [Function | 99.64 | |
| KOG0275 | 508 | consensus Conserved WD40 repeat-containing protein | 99.63 | |
| KOG0291 | 893 | consensus WD40-repeat-containing subunit of the 18 | 99.63 | |
| KOG0772 | 641 | consensus Uncharacterized conserved protein, conta | 99.63 | |
| KOG0285 | 460 | consensus Pleiotropic regulator 1 [RNA processing | 99.63 | |
| KOG0270 | 463 | consensus WD40 repeat-containing protein [Function | 99.62 | |
| PLN00181 | 793 | protein SPA1-RELATED; Provisional | 99.62 | |
| KOG0267 | 825 | consensus Microtubule severing protein katanin p80 | 99.62 | |
| KOG0640 | 430 | consensus mRNA cleavage stimulating factor complex | 99.62 | |
| KOG0316 | 307 | consensus Conserved WD40 repeat-containing protein | 99.61 | |
| KOG0306 | 888 | consensus WD40-repeat-containing subunit of the 18 | 99.61 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 99.61 | |
| KOG0973 | 942 | consensus Histone transcription regulator HIRA, WD | 99.6 | |
| KOG0274 | 537 | consensus Cdc4 and related F-box and WD-40 protein | 99.59 | |
| KOG0296 | 399 | consensus Angio-associated migratory cell protein | 99.59 | |
| KOG0305 | 484 | consensus Anaphase promoting complex, Cdc20, Cdh1, | 99.59 | |
| KOG0306 | 888 | consensus WD40-repeat-containing subunit of the 18 | 99.58 | |
| KOG0647 | 347 | consensus mRNA export protein (contains WD40 repea | 99.58 | |
| KOG0643 | 327 | consensus Translation initiation factor 3, subunit | 99.57 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 99.57 | |
| KOG4283 | 397 | consensus Transcription-coupled repair protein CSA | 99.57 | |
| KOG0643 | 327 | consensus Translation initiation factor 3, subunit | 99.56 | |
| KOG0308 | 735 | consensus Conserved WD40 repeat-containing protein | 99.56 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 99.55 | |
| KOG0267 | 825 | consensus Microtubule severing protein katanin p80 | 99.55 | |
| KOG1332 | 299 | consensus Vesicle coat complex COPII, subunit SEC1 | 99.55 | |
| KOG0288 | 459 | consensus WD40 repeat protein TipD [General functi | 99.55 | |
| KOG1007 | 370 | consensus WD repeat protein TSSC1, WD repeat super | 99.53 | |
| KOG0294 | 362 | consensus WD40 repeat-containing protein [Function | 99.53 | |
| KOG0301 | 745 | consensus Phospholipase A2-activating protein (con | 99.53 | |
| cd00200 | 289 | WD40 WD40 domain, found in a number of eukaryotic | 99.52 | |
| KOG0269 | 839 | consensus WD40 repeat-containing protein [Function | 99.52 | |
| KOG0289 | 506 | consensus mRNA splicing factor [General function p | 99.52 | |
| KOG0647 | 347 | consensus mRNA export protein (contains WD40 repea | 99.51 | |
| KOG0641 | 350 | consensus WD40 repeat protein [General function pr | 99.51 | |
| KOG0274 | 537 | consensus Cdc4 and related F-box and WD-40 protein | 99.51 | |
| KOG0318 | 603 | consensus WD40 repeat stress protein/actin interac | 99.5 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 99.49 | |
| KOG1445 | 1012 | consensus Tumor-specific antigen (contains WD repe | 99.49 | |
| KOG1273 | 405 | consensus WD40 repeat protein [General function pr | 99.49 | |
| cd00200 | 289 | WD40 WD40 domain, found in a number of eukaryotic | 99.48 | |
| KOG1332 | 299 | consensus Vesicle coat complex COPII, subunit SEC1 | 99.48 | |
| KOG0310 | 487 | consensus Conserved WD40 repeat-containing protein | 99.47 | |
| KOG0294 | 362 | consensus WD40 repeat-containing protein [Function | 99.47 | |
| KOG0301 | 745 | consensus Phospholipase A2-activating protein (con | 99.46 | |
| KOG0287 | 442 | consensus Postreplication repair protein RAD18 [Re | 99.46 | |
| KOG0268 | 433 | consensus Sof1-like rRNA processing protein (conta | 99.46 | |
| KOG0293 | 519 | consensus WD40 repeat-containing protein [Function | 99.45 | |
| KOG1007 | 370 | consensus WD repeat protein TSSC1, WD repeat super | 99.45 | |
| KOG0772 | 641 | consensus Uncharacterized conserved protein, conta | 99.45 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 99.44 | |
| KOG4283 | 397 | consensus Transcription-coupled repair protein CSA | 99.44 | |
| KOG0302 | 440 | consensus Ribosome Assembly protein [General funct | 99.44 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 99.42 | |
| KOG0270 | 463 | consensus WD40 repeat-containing protein [Function | 99.42 | |
| KOG1009 | 434 | consensus Chromatin assembly complex 1 subunit B/C | 99.41 | |
| KOG0639 | 705 | consensus Transducin-like enhancer of split protei | 99.41 | |
| KOG0646 | 476 | consensus WD40 repeat protein [General function pr | 99.4 | |
| KOG0305 | 484 | consensus Anaphase promoting complex, Cdc20, Cdh1, | 99.4 | |
| KOG0973 | 942 | consensus Histone transcription regulator HIRA, WD | 99.4 | |
| KOG0300 | 481 | consensus WD40 repeat-containing protein [Function | 99.39 | |
| KOG0296 | 399 | consensus Angio-associated migratory cell protein | 99.39 | |
| KOG0303 | 472 | consensus Actin-binding protein Coronin, contains | 99.39 | |
| KOG0278 | 334 | consensus Serine/threonine kinase receptor-associa | 99.39 | |
| KOG0300 | 481 | consensus WD40 repeat-containing protein [Function | 99.39 | |
| KOG1274 | 933 | consensus WD40 repeat protein [General function pr | 99.39 | |
| KOG0642 | 577 | consensus Cell-cycle nuclear protein, contains WD- | 99.39 | |
| KOG0290 | 364 | consensus Conserved WD40 repeat-containing protein | 99.38 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 99.37 | |
| KOG1407 | 313 | consensus WD40 repeat protein [Function unknown] | 99.36 | |
| KOG4328 | 498 | consensus WD40 protein [Function unknown] | 99.36 | |
| KOG2096 | 420 | consensus WD40 repeat protein [General function pr | 99.35 | |
| KOG0320 | 187 | consensus Predicted E3 ubiquitin ligase [Posttrans | 99.35 | |
| KOG0639 | 705 | consensus Transducin-like enhancer of split protei | 99.35 | |
| KOG0641 | 350 | consensus WD40 repeat protein [General function pr | 99.34 | |
| KOG0268 | 433 | consensus Sof1-like rRNA processing protein (conta | 99.32 | |
| KOG1446 | 311 | consensus Histone H3 (Lys4) methyltransferase comp | 99.31 | |
| KOG0299 | 479 | consensus U3 snoRNP-associated protein (contains W | 99.3 | |
| KOG0823 | 230 | consensus Predicted E3 ubiquitin ligase [Posttrans | 99.3 | |
| KOG0642 | 577 | consensus Cell-cycle nuclear protein, contains WD- | 99.29 | |
| KOG0299 | 479 | consensus U3 snoRNP-associated protein (contains W | 99.28 | |
| KOG1408 | 1080 | consensus WD40 repeat protein [Function unknown] | 99.28 | |
| KOG1446 | 311 | consensus Histone H3 (Lys4) methyltransferase comp | 99.27 | |
| KOG1034 | 385 | consensus Transcriptional repressor EED/ESC/FIE, r | 99.27 | |
| KOG2445 | 361 | consensus Nuclear pore complex component (sc Seh1) | 99.26 | |
| KOG1188 | 376 | consensus WD40 repeat protein [General function pr | 99.25 | |
| KOG2394 | 636 | consensus WD40 protein DMR-N9 [General function pr | 99.25 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 99.25 | |
| KOG1036 | 323 | consensus Mitotic spindle checkpoint protein BUB3, | 99.24 | |
| KOG1445 | 1012 | consensus Tumor-specific antigen (contains WD repe | 99.24 | |
| KOG0322 | 323 | consensus G-protein beta subunit-like protein GNB1 | 99.23 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 99.23 | |
| KOG1063 | 764 | consensus RNA polymerase II elongator complex, sub | 99.22 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 99.21 | |
| KOG1310 | 758 | consensus WD40 repeat protein [General function pr | 99.21 | |
| KOG1310 | 758 | consensus WD40 repeat protein [General function pr | 99.2 | |
| KOG4378 | 673 | consensus Nuclear protein COP1 [Signal transductio | 99.19 | |
| KOG0317 | 293 | consensus Predicted E3 ubiquitin ligase, integral | 99.19 | |
| KOG0307 | 1049 | consensus Vesicle coat complex COPII, subunit SEC3 | 99.18 | |
| KOG2096 | 420 | consensus WD40 repeat protein [General function pr | 99.18 | |
| KOG1273 | 405 | consensus WD40 repeat protein [General function pr | 99.18 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 99.17 | |
| KOG0646 | 476 | consensus WD40 repeat protein [General function pr | 99.17 | |
| KOG2445 | 361 | consensus Nuclear pore complex component (sc Seh1) | 99.17 | |
| KOG0644 | 1113 | consensus Uncharacterized conserved protein, conta | 99.17 | |
| KOG1036 | 323 | consensus Mitotic spindle checkpoint protein BUB3, | 99.16 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 99.16 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 99.15 | |
| PF08662 | 194 | eIF2A: Eukaryotic translation initiation factor eI | 99.15 | |
| KOG2048 | 691 | consensus WD40 repeat protein [General function pr | 99.14 | |
| KOG2177 | 386 | consensus Predicted E3 ubiquitin ligase [Posttrans | 99.14 | |
| KOG0321 | 720 | consensus WD40 repeat-containing protein L2DTL [Fu | 99.13 | |
| KOG1539 | 910 | consensus WD repeat protein [General function pred | 99.12 | |
| KOG0771 | 398 | consensus Prolactin regulatory element-binding pro | 99.12 | |
| KOG0307 | 1049 | consensus Vesicle coat complex COPII, subunit SEC3 | 99.12 | |
| KOG1539 | 910 | consensus WD repeat protein [General function pred | 99.11 | |
| KOG2106 | 626 | consensus Uncharacterized conserved protein, conta | 99.11 | |
| KOG4378 | 673 | consensus Nuclear protein COP1 [Signal transductio | 99.11 | |
| KOG1274 | 933 | consensus WD40 repeat protein [General function pr | 99.09 | |
| KOG1408 | 1080 | consensus WD40 repeat protein [Function unknown] | 99.08 | |
| KOG1009 | 434 | consensus Chromatin assembly complex 1 subunit B/C | 99.06 | |
| KOG2110 | 391 | consensus Uncharacterized conserved protein, conta | 99.06 | |
| KOG1063 | 764 | consensus RNA polymerase II elongator complex, sub | 99.05 | |
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 99.05 | |
| KOG4328 | 498 | consensus WD40 protein [Function unknown] | 99.03 | |
| KOG0974 | 967 | consensus WD-repeat protein WDR6, WD repeat superf | 99.03 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 99.02 | |
| KOG2048 | 691 | consensus WD40 repeat protein [General function pr | 99.01 | |
| TIGR03866 | 300 | PQQ_ABC_repeats PQQ-dependent catabolism-associate | 99.0 | |
| KOG2919 | 406 | consensus Guanine nucleotide-binding protein [Gene | 98.99 | |
| KOG1034 | 385 | consensus Transcriptional repressor EED/ESC/FIE, r | 98.99 | |
| KOG0649 | 325 | consensus WD40 repeat protein [General function pr | 98.98 | |
| KOG4367 | 699 | consensus Predicted Zn-finger protein [Function un | 98.98 | |
| KOG1523 | 361 | consensus Actin-related protein Arp2/3 complex, su | 98.98 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 98.98 | |
| KOG2164 | 513 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.96 | |
| KOG2919 | 406 | consensus Guanine nucleotide-binding protein [Gene | 98.96 | |
| KOG4227 | 609 | consensus WD40 repeat protein [General function pr | 98.95 | |
| KOG1524 | 737 | consensus WD40 repeat-containing protein CHE-2 [Ge | 98.95 | |
| KOG3881 | 412 | consensus Uncharacterized conserved protein [Funct | 98.94 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 98.94 | |
| KOG1523 | 361 | consensus Actin-related protein Arp2/3 complex, su | 98.92 | |
| KOG2106 | 626 | consensus Uncharacterized conserved protein, conta | 98.92 | |
| KOG2111 | 346 | consensus Uncharacterized conserved protein, conta | 98.92 | |
| KOG0321 | 720 | consensus WD40 repeat-containing protein L2DTL [Fu | 98.9 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 98.87 | |
| KOG2394 | 636 | consensus WD40 protein DMR-N9 [General function pr | 98.87 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 98.84 | |
| KOG0771 | 398 | consensus Prolactin regulatory element-binding pro | 98.83 | |
| KOG1188 | 376 | consensus WD40 repeat protein [General function pr | 98.83 | |
| COG2319 | 466 | FOG: WD40 repeat [General function prediction only | 98.82 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 98.81 | |
| KOG4227 | 609 | consensus WD40 repeat protein [General function pr | 98.81 | |
| KOG2055 | 514 | consensus WD40 repeat protein [General function pr | 98.8 | |
| KOG0290 | 364 | consensus Conserved WD40 repeat-containing protein | 98.8 | |
| KOG1587 | 555 | consensus Cytoplasmic dynein intermediate chain [C | 98.79 | |
| KOG0644 | 1113 | consensus Uncharacterized conserved protein, conta | 98.78 | |
| KOG0650 | 733 | consensus WD40 repeat nucleolar protein Bop1, invo | 98.78 | |
| KOG1538 | 1081 | consensus Uncharacterized conserved protein WDR10, | 98.78 | |
| KOG0649 | 325 | consensus WD40 repeat protein [General function pr | 98.76 | |
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 98.76 | |
| KOG2055 | 514 | consensus WD40 repeat protein [General function pr | 98.73 | |
| KOG2110 | 391 | consensus Uncharacterized conserved protein, conta | 98.7 | |
| COG2319 | 466 | FOG: WD40 repeat [General function prediction only | 98.69 | |
| KOG1538 | 1081 | consensus Uncharacterized conserved protein WDR10, | 98.69 | |
| TIGR03866 | 300 | PQQ_ABC_repeats PQQ-dependent catabolism-associate | 98.68 | |
| KOG1517 | 1387 | consensus Guanine nucleotide binding protein MIP1 | 98.66 | |
| KOG0650 | 733 | consensus WD40 repeat nucleolar protein Bop1, invo | 98.66 | |
| KOG1524 | 737 | consensus WD40 repeat-containing protein CHE-2 [Ge | 98.65 | |
| KOG2660 | 331 | consensus Locus-specific chromosome binding protei | 98.64 | |
| KOG2139 | 445 | consensus WD40 repeat protein [General function pr | 98.62 | |
| KOG0311 | 381 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.62 | |
| KOG1517 | 1387 | consensus Guanine nucleotide binding protein MIP1 | 98.62 | |
| KOG0322 | 323 | consensus G-protein beta subunit-like protein GNB1 | 98.62 | |
| KOG1587 | 555 | consensus Cytoplasmic dynein intermediate chain [C | 98.61 | |
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 98.6 | |
| KOG2111 | 346 | consensus Uncharacterized conserved protein, conta | 98.57 | |
| KOG0280 | 339 | consensus Uncharacterized conserved protein [Amino | 98.55 | |
| KOG1354 | 433 | consensus Serine/threonine protein phosphatase 2A, | 98.54 | |
| PF08662 | 194 | eIF2A: Eukaryotic translation initiation factor eI | 98.54 | |
| KOG2139 | 445 | consensus WD40 repeat protein [General function pr | 98.51 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 98.51 | |
| PRK01742 | 429 | tolB translocation protein TolB; Provisional | 98.5 | |
| KOG4547 | 541 | consensus WD40 repeat-containing protein [General | 98.5 | |
| KOG0280 | 339 | consensus Uncharacterized conserved protein [Amino | 98.49 | |
| KOG4628 | 348 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.49 | |
| PF00400 | 39 | WD40: WD domain, G-beta repeat; InterPro: IPR01978 | 98.48 | |
| KOG1272 | 545 | consensus WD40-repeat-containing subunit of the 18 | 98.46 | |
| KOG1963 | 792 | consensus WD40 repeat protein [General function pr | 98.45 | |
| KOG1334 | 559 | consensus WD40 repeat protein [General function pr | 98.42 | |
| KOG1272 | 545 | consensus WD40-repeat-containing subunit of the 18 | 98.4 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 98.35 | |
| KOG2879 | 298 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.35 | |
| KOG0974 | 967 | consensus WD-repeat protein WDR6, WD repeat superf | 98.35 | |
| KOG0309 | 1081 | consensus Conserved WD40 repeat-containing protein | 98.32 | |
| KOG3914 | 390 | consensus WD repeat protein WDR4 [Function unknown | 98.31 | |
| COG5222 | 427 | Uncharacterized conserved protein, contains RING Z | 98.31 | |
| KOG2321 | 703 | consensus WD40 repeat protein [General function pr | 98.31 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 98.3 | |
| KOG4159 | 398 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.29 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 98.28 | |
| PRK11028 | 330 | 6-phosphogluconolactonase; Provisional | 98.28 | |
| KOG0824 | 324 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.28 | |
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 98.27 | |
| PRK11028 | 330 | 6-phosphogluconolactonase; Provisional | 98.25 | |
| KOG2695 | 425 | consensus WD40 repeat protein [General function pr | 98.23 | |
| PF00400 | 39 | WD40: WD domain, G-beta repeat; InterPro: IPR01978 | 98.23 | |
| PRK01742 | 429 | tolB translocation protein TolB; Provisional | 98.22 | |
| PRK05137 | 435 | tolB translocation protein TolB; Provisional | 98.2 | |
| KOG4714 | 319 | consensus Nucleoporin [Nuclear structure] | 98.16 | |
| KOG1240 | 1431 | consensus Protein kinase containing WD40 repeats [ | 98.15 | |
| KOG1334 | 559 | consensus WD40 repeat protein [General function pr | 98.14 | |
| PRK02889 | 427 | tolB translocation protein TolB; Provisional | 98.13 | |
| KOG4739 | 233 | consensus Uncharacterized protein involved in syna | 98.13 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 98.13 | |
| PRK04922 | 433 | tolB translocation protein TolB; Provisional | 98.1 | |
| KOG4185 | 296 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.1 | |
| KOG1813 | 313 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.09 | |
| KOG0297 | 391 | consensus TNF receptor-associated factor [Signal t | 98.08 | |
| KOG4714 | 319 | consensus Nucleoporin [Nuclear structure] | 98.06 | |
| PRK03629 | 429 | tolB translocation protein TolB; Provisional | 98.04 | |
| KOG0827 | 465 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.04 | |
| PF11768 | 545 | DUF3312: Protein of unknown function (DUF3312); In | 98.02 | |
| KOG4190 | 1034 | consensus Uncharacterized conserved protein [Funct | 98.02 | |
| KOG4172 | 62 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.99 | |
| KOG1963 | 792 | consensus WD40 repeat protein [General function pr | 97.97 | |
| PF02239 | 369 | Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO | 97.92 | |
| KOG4497 | 447 | consensus Uncharacterized conserved protein WDR8, | 97.9 | |
| TIGR02800 | 417 | propeller_TolB tol-pal system beta propeller repea | 97.9 | |
| COG5170 | 460 | CDC55 Serine/threonine protein phosphatase 2A, reg | 97.89 | |
| KOG3914 | 390 | consensus WD repeat protein WDR4 [Function unknown | 97.85 | |
| KOG2315 | 566 | consensus Predicted translation initiation factor | 97.84 | |
| KOG3039 | 303 | consensus Uncharacterized conserved protein [Funct | 97.84 | |
| KOG2321 | 703 | consensus WD40 repeat protein [General function pr | 97.83 | |
| KOG3881 | 412 | consensus Uncharacterized conserved protein [Funct | 97.79 | |
| KOG1064 | 2439 | consensus RAVE (regulator of V-ATPase assembly) co | 97.77 | |
| PRK04792 | 448 | tolB translocation protein TolB; Provisional | 97.76 | |
| PRK00178 | 430 | tolB translocation protein TolB; Provisional | 97.76 | |
| KOG1734 | 328 | consensus Predicted RING-containing E3 ubiquitin l | 97.72 | |
| PF11768 | 545 | DUF3312: Protein of unknown function (DUF3312); In | 97.71 | |
| KOG4190 | 1034 | consensus Uncharacterized conserved protein [Funct | 97.68 | |
| KOG1002 | 791 | consensus Nucleotide excision repair protein RAD16 | 97.66 | |
| PRK03629 | 429 | tolB translocation protein TolB; Provisional | 97.65 | |
| KOG0826 | 357 | consensus Predicted E3 ubiquitin ligase involved i | 97.65 | |
| KOG1240 | 1431 | consensus Protein kinase containing WD40 repeats [ | 97.64 | |
| KOG1409 | 404 | consensus Uncharacterized conserved protein, conta | 97.64 | |
| PRK02889 | 427 | tolB translocation protein TolB; Provisional | 97.59 | |
| PRK05137 | 435 | tolB translocation protein TolB; Provisional | 97.56 | |
| KOG1354 | 433 | consensus Serine/threonine protein phosphatase 2A, | 97.53 | |
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 97.51 | |
| PRK04922 | 433 | tolB translocation protein TolB; Provisional | 97.48 | |
| KOG3800 | 300 | consensus Predicted E3 ubiquitin ligase containing | 97.44 | |
| KOG1039 | 344 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.44 | |
| COG5194 | 88 | APC11 Component of SCF ubiquitin ligase and anapha | 97.44 | |
| KOG4532 | 344 | consensus WD40-like repeat containing protein [Gen | 97.41 | |
| KOG1275 | 1118 | consensus PAB-dependent poly(A) ribonuclease, subu | 97.4 | |
| TIGR02800 | 417 | propeller_TolB tol-pal system beta propeller repea | 97.39 | |
| KOG4497 | 447 | consensus Uncharacterized conserved protein WDR8, | 97.39 | |
| KOG2695 | 425 | consensus WD40 repeat protein [General function pr | 97.35 | |
| KOG4692 | 489 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.34 | |
| smart00744 | 49 | RINGv The RING-variant domain is a C4HC3 zinc-fing | 97.34 | |
| PLN02919 | 1057 | haloacid dehalogenase-like hydrolase family protei | 97.34 | |
| KOG4547 | 541 | consensus WD40 repeat-containing protein [General | 97.3 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 97.3 | |
| PF02239 | 369 | Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO | 97.29 | |
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 97.27 | |
| KOG4532 | 344 | consensus WD40-like repeat containing protein [Gen | 97.26 | |
| KOG3617 | 1416 | consensus WD40 and TPR repeat-containing protein [ | 97.24 | |
| KOG2066 | 846 | consensus Vacuolar assembly/sorting protein VPS41 | 97.22 | |
| PF14447 | 55 | Prok-RING_4: Prokaryotic RING finger family 4 | 97.21 | |
| PF15492 | 282 | Nbas_N: Neuroblastoma-amplified sequence, N termin | 97.18 | |
| KOG1064 | 2439 | consensus RAVE (regulator of V-ATPase assembly) co | 97.16 | |
| PRK01029 | 428 | tolB translocation protein TolB; Provisional | 97.16 | |
| KOG0309 | 1081 | consensus Conserved WD40 repeat-containing protein | 97.16 | |
| KOG4265 | 349 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.16 | |
| KOG2041 | 1189 | consensus WD40 repeat protein [General function pr | 97.16 | |
| smart00320 | 40 | WD40 WD40 repeats. Note that these repeats are per | 97.14 | |
| KOG1493 | 84 | consensus Anaphase-promoting complex (APC), subuni | 97.09 | |
| PRK01029 | 428 | tolB translocation protein TolB; Provisional | 97.03 | |
| KOG1571 | 355 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.02 | |
| PRK00178 | 430 | tolB translocation protein TolB; Provisional | 97.01 | |
| KOG1785 | 563 | consensus Tyrosine kinase negative regulator CBL [ | 96.98 | |
| KOG0828 | 636 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.94 | |
| PRK04792 | 448 | tolB translocation protein TolB; Provisional | 96.94 | |
| KOG1645 | 463 | consensus RING-finger-containing E3 ubiquitin liga | 96.92 | |
| PF14570 | 48 | zf-RING_4: RING/Ubox like zinc-binding domain; PDB | 96.92 | |
| KOG4640 | 665 | consensus Anaphase-promoting complex (APC), subuni | 96.9 | |
| KOG3161 | 861 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.85 | |
| KOG4275 | 350 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.84 | |
| COG4946 | 668 | Uncharacterized protein related to the periplasmic | 96.82 | |
| KOG1001 | 674 | consensus Helicase-like transcription factor HLTF/ | 96.76 | |
| KOG1409 | 404 | consensus Uncharacterized conserved protein, conta | 96.76 | |
| KOG3621 | 726 | consensus WD40 repeat-containing protein [General | 96.74 | |
| PLN02919 | 1057 | haloacid dehalogenase-like hydrolase family protei | 96.71 | |
| KOG2930 | 114 | consensus SCF ubiquitin ligase, Rbx1 component [Po | 96.68 | |
| PF14783 | 111 | BBS2_Mid: Ciliary BBSome complex subunit 2, middle | 96.61 | |
| COG5170 | 460 | CDC55 Serine/threonine protein phosphatase 2A, reg | 96.54 | |
| smart00320 | 40 | WD40 WD40 repeats. Note that these repeats are per | 96.54 | |
| COG4946 | 668 | Uncharacterized protein related to the periplasmic | 96.51 | |
| KOG2066 | 846 | consensus Vacuolar assembly/sorting protein VPS41 | 96.49 | |
| KOG2314 | 698 | consensus Translation initiation factor 3, subunit | 96.49 | |
| KOG0882 | 558 | consensus Cyclophilin-related peptidyl-prolyl cis- | 96.45 | |
| PRK04043 | 419 | tolB translocation protein TolB; Provisional | 96.42 | |
| PF10282 | 345 | Lactonase: Lactonase, 7-bladed beta-propeller; Int | 96.33 | |
| KOG1912 | 1062 | consensus WD40 repeat protein [General function pr | 96.31 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 96.29 | |
| KOG3039 | 303 | consensus Uncharacterized conserved protein [Funct | 96.18 | |
| COG5220 | 314 | TFB3 Cdk activating kinase (CAK)/RNA polymerase II | 96.14 | |
| KOG1814 | 445 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.1 | |
| KOG3002 | 299 | consensus Zn finger protein [General function pred | 96.09 | |
| KOG1008 | 783 | consensus Uncharacterized conserved protein, conta | 96.07 | |
| KOG2079 | 1206 | consensus Vacuolar assembly/sorting protein VPS8 [ | 96.04 | |
| TIGR02658 | 352 | TTQ_MADH_Hv methylamine dehydrogenase heavy chain. | 95.99 | |
| PF05290 | 140 | Baculo_IE-1: Baculovirus immediate-early protein ( | 95.99 | |
| COG5219 | 1525 | Uncharacterized conserved protein, contains RING Z | 95.95 | |
| PF10282 | 345 | Lactonase: Lactonase, 7-bladed beta-propeller; Int | 95.91 | |
| PF08450 | 246 | SGL: SMP-30/Gluconolaconase/LRE-like region; Inter | 95.84 | |
| COG2706 | 346 | 3-carboxymuconate cyclase [Carbohydrate transport | 95.74 | |
| PF04762 | 928 | IKI3: IKI3 family; InterPro: IPR006849 Members of | 95.74 | |
| KOG2315 | 566 | consensus Predicted translation initiation factor | 95.66 | |
| COG5175 | 480 | MOT2 Transcriptional repressor [Transcription] | 95.58 | |
| KOG4362 | 684 | consensus Transcriptional regulator BRCA1 [Replica | 95.46 | |
| KOG2041 | 1189 | consensus WD40 repeat protein [General function pr | 95.42 | |
| COG2706 | 346 | 3-carboxymuconate cyclase [Carbohydrate transport | 95.4 | |
| KOG2817 | 394 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.39 | |
| KOG4640 | 665 | consensus Anaphase-promoting complex (APC), subuni | 95.27 | |
| COG5354 | 561 | Uncharacterized protein, contains Trp-Asp (WD) rep | 95.26 | |
| KOG3621 | 726 | consensus WD40 repeat-containing protein [General | 95.23 | |
| TIGR02658 | 352 | TTQ_MADH_Hv methylamine dehydrogenase heavy chain. | 95.02 | |
| PF12894 | 47 | Apc4_WD40: Anaphase-promoting complex subunit 4 WD | 94.99 | |
| PF08450 | 246 | SGL: SMP-30/Gluconolaconase/LRE-like region; Inter | 94.91 | |
| PF07800 | 162 | DUF1644: Protein of unknown function (DUF1644); In | 94.9 | |
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 94.9 | |
| COG5354 | 561 | Uncharacterized protein, contains Trp-Asp (WD) rep | 94.89 | |
| PF10367 | 109 | Vps39_2: Vacuolar sorting protein 39 domain 2; Int | 94.84 | |
| PF14783 | 111 | BBS2_Mid: Ciliary BBSome complex subunit 2, middle | 94.79 | |
| PRK04043 | 419 | tolB translocation protein TolB; Provisional | 94.78 | |
| KOG2114 | 933 | consensus Vacuolar assembly/sorting protein PEP5/V | 94.7 | |
| KOG2314 | 698 | consensus Translation initiation factor 3, subunit | 94.61 | |
| smart00502 | 127 | BBC B-Box C-terminal domain. Coiled coil region C- | 94.59 | |
| KOG4642 | 284 | consensus Chaperone-dependent E3 ubiquitin protein | 94.59 | |
| PF02891 | 50 | zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 | 94.49 | |
| KOG1008 | 783 | consensus Uncharacterized conserved protein, conta | 94.37 | |
| PF08553 | 794 | VID27: VID27 cytoplasmic protein; InterPro: IPR013 | 94.36 | |
| TIGR03300 | 377 | assembly_YfgL outer membrane assembly lipoprotein | 94.34 | |
| PF12894 | 47 | Apc4_WD40: Anaphase-promoting complex subunit 4 WD | 94.31 | |
| KOG0298 | 1394 | consensus DEAD box-containing helicase-like transc | 94.26 | |
| KOG1832 | 1516 | consensus HIV-1 Vpr-binding protein [Cell cycle co | 94.19 | |
| KOG2444 | 238 | consensus WD40 repeat protein [General function pr | 94.12 | |
| KOG3970 | 299 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.1 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 93.93 | |
| PF15492 | 282 | Nbas_N: Neuroblastoma-amplified sequence, N termin | 93.78 | |
| KOG1275 | 1118 | consensus PAB-dependent poly(A) ribonuclease, subu | 93.75 | |
| KOG2114 | 933 | consensus Vacuolar assembly/sorting protein PEP5/V | 93.57 | |
| PHA03096 | 284 | p28-like protein; Provisional | 93.54 | |
| KOG3617 | 1416 | consensus WD40 and TPR repeat-containing protein [ | 93.48 | |
| COG3386 | 307 | Gluconolactonase [Carbohydrate transport and metab | 93.44 | |
| KOG2079 | 1206 | consensus Vacuolar assembly/sorting protein VPS8 [ | 93.32 | |
| PF04762 | 928 | IKI3: IKI3 family; InterPro: IPR006849 Members of | 93.27 | |
| KOG1812 | 384 | consensus Predicted E3 ubiquitin ligase [Posttrans | 93.08 | |
| COG5109 | 396 | Uncharacterized conserved protein, contains RING Z | 93.04 | |
| PF10313 | 43 | DUF2415: Uncharacterised protein domain (DUF2415); | 92.85 | |
| KOG1832 | 1516 | consensus HIV-1 Vpr-binding protein [Cell cycle co | 92.8 | |
| PF14569 | 80 | zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A. | 92.79 | |
| KOG1940 | 276 | consensus Zn-finger protein [General function pred | 92.72 | |
| PHA02825 | 162 | LAP/PHD finger-like protein; Provisional | 92.7 | |
| PF02897 | 414 | Peptidase_S9_N: Prolyl oligopeptidase, N-terminal | 92.69 | |
| KOG4649 | 354 | consensus PQQ (pyrrolo-quinoline quinone) repeat p | 92.65 | |
| KOG3579 | 352 | consensus Predicted E3 ubiquitin ligase [Posttrans | 92.64 | |
| KOG1920 | 1265 | consensus IkappaB kinase complex, IKAP component [ | 92.59 | |
| PF05883 | 134 | Baculo_RING: Baculovirus U-box/Ring-like domain; I | 92.57 | |
| PRK13616 | 591 | lipoprotein LpqB; Provisional | 92.55 | |
| PF08746 | 43 | zf-RING-like: RING-like domain; InterPro: IPR01485 | 92.42 | |
| KOG1912 | 1062 | consensus WD40 repeat protein [General function pr | 92.29 | |
| PF07433 | 305 | DUF1513: Protein of unknown function (DUF1513); In | 92.24 | |
| KOG3268 | 234 | consensus Predicted E3 ubiquitin ligase [Posttrans | 92.13 | |
| KOG0882 | 558 | consensus Cyclophilin-related peptidyl-prolyl cis- | 92.06 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 92.02 | |
| KOG4445 | 368 | consensus Uncharacterized conserved protein, conta | 91.65 | |
| KOG2932 | 389 | consensus E3 ubiquitin ligase involved in ubiquiti | 91.6 | |
| PF07191 | 70 | zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 | 91.59 | |
| KOG3113 | 293 | consensus Uncharacterized conserved protein [Funct | 91.46 | |
| PF04053 | 443 | Coatomer_WDAD: Coatomer WD associated region ; Int | 91.45 | |
| PF06977 | 248 | SdiA-regulated: SdiA-regulated; InterPro: IPR00972 | 91.39 | |
| PHA02862 | 156 | 5L protein; Provisional | 91.28 | |
| PF03854 | 50 | zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc | 91.06 | |
| PF03178 | 321 | CPSF_A: CPSF A subunit region; InterPro: IPR004871 | 90.97 | |
| KOG2034 | 911 | consensus Vacuolar sorting protein PEP3/VPS18 [Int | 90.92 | |
| PF15390 | 671 | DUF4613: Domain of unknown function (DUF4613) | 90.86 | |
| KOG1920 | 1265 | consensus IkappaB kinase complex, IKAP component [ | 90.83 | |
| COG0823 | 425 | TolB Periplasmic component of the Tol biopolymer t | 90.79 | |
| PF10083 | 158 | DUF2321: Uncharacterized protein conserved in bact | 90.78 | |
| KOG4460 | 741 | consensus Nuclear pore complex, Nup88/rNup84 compo | 90.65 | |
| KOG4649 | 354 | consensus PQQ (pyrrolo-quinoline quinone) repeat p | 90.64 | |
| PF10313 | 43 | DUF2415: Uncharacterised protein domain (DUF2415); | 90.57 | |
| PF14870 | 302 | PSII_BNR: Photosynthesis system II assembly factor | 90.36 | |
| PRK02888 | 635 | nitrous-oxide reductase; Validated | 90.28 | |
| PF07433 | 305 | DUF1513: Protein of unknown function (DUF1513); In | 90.21 | |
| PRK02888 | 635 | nitrous-oxide reductase; Validated | 90.06 | |
| COG0823 | 425 | TolB Periplasmic component of the Tol biopolymer t | 89.55 | |
| TIGR03300 | 377 | assembly_YfgL outer membrane assembly lipoprotein | 89.16 | |
| PF12234 | 631 | Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 | 89.09 | |
| KOG2395 | 644 | consensus Protein involved in vacuole import and d | 88.48 | |
| PF15290 | 305 | Syntaphilin: Golgi-localised syntaxin-1-binding cl | 88.29 | |
| COG3813 | 84 | Uncharacterized protein conserved in bacteria [Fun | 88.25 | |
| COG3391 | 381 | Uncharacterized conserved protein [Function unknow | 87.98 | |
| KOG4499 | 310 | consensus Ca2+-binding protein Regucalcin/SMP30 [I | 87.96 | |
| PF00930 | 353 | DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin | 87.54 | |
| TIGR01562 | 305 | FdhE formate dehydrogenase accessory protein FdhE. | 87.19 | |
| PRK11138 | 394 | outer membrane biogenesis protein BamB; Provisiona | 86.96 | |
| KOG2979 | 262 | consensus Protein involved in DNA repair [General | 86.75 | |
| PF06977 | 248 | SdiA-regulated: SdiA-regulated; InterPro: IPR00972 | 86.73 | |
| PF08553 | 794 | VID27: VID27 cytoplasmic protein; InterPro: IPR013 | 86.54 | |
| KOG2042 | 943 | consensus Ubiquitin fusion degradation protein-2 [ | 86.36 | |
| PF13240 | 23 | zinc_ribbon_2: zinc-ribbon domain | 86.21 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 86.14 | |
| PF04216 | 290 | FdhE: Protein involved in formate dehydrogenase fo | 86.13 | |
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 86.06 | |
| PF07569 | 219 | Hira: TUP1-like enhancer of split; InterPro: IPR01 | 86.04 | |
| KOG1428 | 3738 | consensus Inhibitor of type V adenylyl cyclases/Ne | 85.91 | |
| PF12906 | 47 | RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. | 85.79 | |
| PF04053 | 443 | Coatomer_WDAD: Coatomer WD associated region ; Int | 85.49 | |
| PLN02638 | 1079 | cellulose synthase A (UDP-forming), catalytic subu | 85.47 | |
| PF05605 | 54 | zf-Di19: Drought induced 19 protein (Di19), zinc-b | 85.06 | |
| KOG1916 | 1283 | consensus Nuclear protein, contains WD40 repeats [ | 84.99 | |
| PF08606 | 70 | Prp19: Prp19/Pso4-like; InterPro: IPR013915 This r | 84.89 | |
| TIGR03606 | 454 | non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH | 84.78 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 84.67 | |
| KOG1815 | 444 | consensus Predicted E3 ubiquitin ligase [Posttrans | 84.31 | |
| KOG2444 | 238 | consensus WD40 repeat protein [General function pr | 84.23 | |
| PF10647 | 253 | Gmad1: Lipoprotein LpqB beta-propeller domain; Int | 83.82 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 83.75 | |
| PF08728 | 717 | CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans | 83.72 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 83.3 | |
| PF06906 | 57 | DUF1272: Protein of unknown function (DUF1272); In | 83.16 | |
| PF07995 | 331 | GSDH: Glucose / Sorbosone dehydrogenase; InterPro: | 83.11 | |
| KOG0827 | 465 | consensus Predicted E3 ubiquitin ligase [Posttrans | 83.07 |
| >KOG0289 consensus mRNA splicing factor [General function prediction only] | Back alignment and domain information |
|---|
Probab=99.97 E-value=5.2e-32 Score=250.70 Aligned_cols=381 Identities=16% Similarity=0.134 Sum_probs=240.6
Q ss_pred cccccccchhhhcccc-CCCCccchhhHHhhhcCCCCCCCCCCcCccCCCcchHHHHHHHHHHhHhhhccCCCchhhhhh
Q 048199 53 MLCPICMQIIKEAFLT-ACGHSFCYMCIITHLRNKSDCPCCGHYLTNNQLYPNFLLDKLLKKTSARQISKTASPLENFRQ 131 (495)
Q Consensus 53 l~C~IC~~~~~~Pv~l-~CGH~FC~~Ci~~~~~~~~~CP~Cr~~~~~~~l~~n~~l~~~v~~~~~~~~~~~~~~~~~~~~ 131 (495)
+.|.|.++++++||+. ..||+|.++.|++|+...++||+.+++++.++|++...-.. ..+.++++..++.+..
T Consensus 1 m~CaISgEvP~~PVvS~~Sg~vfEkrLIEqyI~e~G~DPIt~~pLs~eelV~Ik~~~~------v~pk~~satSIPalL~ 74 (506)
T KOG0289|consen 1 MVCAISGEVPEEPVVSPVSGHVFEKRLIEQYIAETGKDPITNEPLSIEELVEIKVPAQ------VRPKPPSATSIPALLK 74 (506)
T ss_pred CeecccCCCCCCccccccccchHHHHHHHHHHHHcCCCCCCCCcCCHHHeeecccccc------ccCCCCCccchHHHHH
Confidence 5799999999999966 59999999999999999999999999999998877654322 2455677888999999
Q ss_pred hhhhccCCcHHHHHHHHHHHHHHHHHHHHHH------------HHHHHHHHHHHHHHHHHHHHHH----------HHHHH
Q 048199 132 ALQQGCGVSVKEIDSLMSLLSEKKRKMEQEE------------AERNMQILLDFLHCLRKQKVDE----------LKEIQ 189 (495)
Q Consensus 132 ~~~~~~~~~~~~~~~~~~~l~~~~~~l~~~~------------~~~~~~~l~~~l~~~~~~~~~~----------l~~~~ 189 (495)
.+|.+|+..+.+-..+.+.|+..+++|.+.. ...+...-++.|.....+.-.. .....
T Consensus 75 ~lQdEWDavML~~F~LRqqL~ttrQELShaLYqhDAAcrViaRL~kE~~eareaLa~~~~qa~a~~peav~~~~~~s~~~ 154 (506)
T KOG0289|consen 75 TLQDEWDAVMLESFTLRQQLQTTRQELSHALYQHDAACRVIARLTKERDEAREALAKLSPQAGAIVPEAVPSLAQSSVVG 154 (506)
T ss_pred HHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHhhcCcccccccccccccccccchhh
Confidence 9999999999999999999999999998611 1122222233332222111100 00000
Q ss_pred HHHH-------HHHHHHHHHHHHHHHHHHHHhhhhHHHHhccCCCccccccccccCCCCCCcccccccCCCCCCCCcccc
Q 048199 190 TDLH-------YIKEDINAVERHRIDLYRARDRYSVKLRMLGDDSNTRKSWLSSIDKNSSGIITSSLNARGGSSAGSLQN 262 (495)
Q Consensus 190 ~~~~-------~l~~~i~~l~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 262 (495)
.+.. .-.+-+..++.+.+.|.+.+++..+.+....... +.+... -...++...++....+..+...
T Consensus 155 va~ge~~d~~g~s~~i~~~l~~~aq~ls~~rKkrg~k~p~~la~~---d~~~~~-~q~ash~gLH~t~~pgi~ald~--- 227 (506)
T KOG0289|consen 155 VAAGESEDQPGLSPEIIQKLEDKAQVLSQERKKRGKKLPEKLATT---DELSCL-LQVASHTGLHSTSTPGITALDI--- 227 (506)
T ss_pred hhcCCccccccCCHHHHHHHHHHHHHHHHHhhhccccCCcccccH---HHHHHH-HhcCCCcceeccCCCCeeEEee---
Confidence 0000 1123345555666666666665533321111000 000000 0000001111111111110000
Q ss_pred ccCCCccccccCCCCCCCCCCCCCCccccccchhhHhHhHHHHhHhHHHHHHHHHhhhhccCCCCccccc-cccccccCc
Q 048199 263 KKGDGKAQANSHGHQRKDSLTGSDSQCLNQSGLSVVRKKRVHAQFNDLQECYLQKRRQMANQPHTKQESD-KNIIHREGY 341 (495)
Q Consensus 263 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~r~~~~~~~~~~~~~~-~~~~~~~~~ 341 (495)
.........|....... +......+++. .+.++...+.. ....+....
T Consensus 228 ---~~s~~~ilTGG~d~~av------------~~d~~s~q~l~----------------~~~Gh~kki~~v~~~~~~~~v 276 (506)
T KOG0289|consen 228 ---IPSSSKILTGGEDKTAV------------LFDKPSNQILA----------------TLKGHTKKITSVKFHKDLDTV 276 (506)
T ss_pred ---cCCCCcceecCCCCceE------------EEecchhhhhh----------------hccCcceEEEEEEeccchhhe
Confidence 00000001111111100 01111122222 22333333332 223344556
Q ss_pred ccchhhHHhhhhhhhcccCceEEEEeeccccccCCCcEEEEEEccCCCEEEEEeCCCcEEEEEccccccCCCCcCCCeee
Q 048199 342 NAGLADFQSVLTTFTRYSRLRVIAELRHGDIFHSANIVSSIEFDRDDQLFATAGVSRRIKVFDFASVVNEPADVHCPVVE 421 (495)
Q Consensus 342 ~~g~~d~~~~lw~~~~~~~~~~~~~~~~~~~~~h~~~V~~l~~~p~~~~l~s~s~d~~i~vwd~~~~~~~~~~~~~~~~~ 421 (495)
.+++.|+.+++|.....+ ....+. .|.++|+.+..||.|.||++++.|+++.+.|++++ .....
T Consensus 277 ~~aSad~~i~vws~~~~s---~~~~~~-----~h~~~V~~ls~h~tgeYllsAs~d~~w~Fsd~~~g--------~~lt~ 340 (506)
T KOG0289|consen 277 ITASADEIIRVWSVPLSS---EPTSSR-----PHEEPVTGLSLHPTGEYLLSASNDGTWAFSDISSG--------SQLTV 340 (506)
T ss_pred eecCCcceEEeecccccc---Cccccc-----cccccceeeeeccCCcEEEEecCCceEEEEEccCC--------cEEEE
Confidence 789999999999875322 112222 68999999999999999999999999999999998 22232
Q ss_pred cCC---CCCeEEEEEcCCCCCEEEEecCCCcEEEEeCCCCcceeecccccCcEEEEEeecCCCCeEEEeeCCCcEeC
Q 048199 422 MPT---RSKLSCLSWNKFSKNRIASSDYEGIVTVWDVTTQQSVMEYEEHEKRAWSVDFSRTEPSMLVSGSDDCKVLY 495 (495)
Q Consensus 422 ~~~---~~~i~~~~~~p~~~~~l~sg~~dg~v~iwd~~~~~~~~~~~~h~~~v~~v~~~~~~g~~l~s~s~D~~v~l 495 (495)
..+ .-.+++.+|||| |.+|++|..||.|+|||+.++..+..|.+|+++|..++|+. ||++|+++++|+.|++
T Consensus 341 vs~~~s~v~~ts~~fHpD-gLifgtgt~d~~vkiwdlks~~~~a~Fpght~~vk~i~FsE-NGY~Lat~add~~V~l 415 (506)
T KOG0289|consen 341 VSDETSDVEYTSAAFHPD-GLIFGTGTPDGVVKIWDLKSQTNVAKFPGHTGPVKAISFSE-NGYWLATAADDGSVKL 415 (506)
T ss_pred EeeccccceeEEeeEcCC-ceEEeccCCCceEEEEEcCCccccccCCCCCCceeEEEecc-CceEEEEEecCCeEEE
Confidence 223 235899999999 99999999999999999999999999999999999999999 9999999999998874
|
|
| >KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] | Back alignment and domain information |
|---|
| >KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] | Back alignment and domain information |
|---|
| >PLN00181 protein SPA1-RELATED; Provisional | Back alignment and domain information |
|---|
| >KOG0286 consensus G-protein beta subunit [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0286 consensus G-protein beta subunit [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0266 consensus WD40 repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0266 consensus WD40 repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00421 coronin; Provisional | Back alignment and domain information |
|---|
| >KOG0282 consensus mRNA splicing factor [Function unknown] | Back alignment and domain information |
|---|
| >KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0645 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0295 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0293 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0645 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0302 consensus Ribosome Assembly protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00420 coronin; Provisional | Back alignment and domain information |
|---|
| >KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] | Back alignment and domain information |
|---|
| >KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >PTZ00421 coronin; Provisional | Back alignment and domain information |
|---|
| >KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00420 coronin; Provisional | Back alignment and domain information |
|---|
| >KOG0269 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0295 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] | Back alignment and domain information |
|---|
| >KOG0282 consensus mRNA splicing factor [Function unknown] | Back alignment and domain information |
|---|
| >KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1407 consensus WD40 repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0283 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0288 consensus WD40 repeat protein TipD [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0283 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] | Back alignment and domain information |
|---|
| >KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0270 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN00181 protein SPA1-RELATED; Provisional | Back alignment and domain information |
|---|
| >KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] | Back alignment and domain information |
|---|
| >KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] | Back alignment and domain information |
|---|
| >KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0288 consensus WD40 repeat protein TipD [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] | Back alignment and domain information |
|---|
| >KOG0294 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto | Back alignment and domain information |
|---|
| >KOG0269 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0289 consensus mRNA splicing factor [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0641 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1273 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto | Back alignment and domain information |
|---|
| >KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0294 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0293 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] | Back alignment and domain information |
|---|
| >KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0302 consensus Ribosome Assembly protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >KOG0270 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0646 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] | Back alignment and domain information |
|---|
| >KOG0300 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] | Back alignment and domain information |
|---|
| >KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0300 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1274 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >KOG1407 consensus WD40 repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4328 consensus WD40 protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2096 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0641 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1408 consensus WD40 repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] | Back alignment and domain information |
|---|
| >KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1188 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1310 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1310 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG2096 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1273 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >KOG0646 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins | Back alignment and domain information |
|---|
| >KOG2048 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] | Back alignment and domain information |
|---|
| >KOG1539 consensus WD repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1539 consensus WD repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] | Back alignment and domain information |
|---|
| >KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1274 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1408 consensus WD40 repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] | Back alignment and domain information |
|---|
| >KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >KOG4328 consensus WD40 protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >KOG2048 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein | Back alignment and domain information |
|---|
| >KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] | Back alignment and domain information |
|---|
| >KOG0649 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4367 consensus Predicted Zn-finger protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4227 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3881 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] | Back alignment and domain information |
|---|
| >KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] | Back alignment and domain information |
|---|
| >KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1188 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG2319 FOG: WD40 repeat [General function prediction only] | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG4227 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2055 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] | Back alignment and domain information |
|---|
| >KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0649 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2055 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] | Back alignment and domain information |
|---|
| >COG2319 FOG: WD40 repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein | Back alignment and domain information |
|---|
| >KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] | Back alignment and domain information |
|---|
| >KOG2139 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] | Back alignment and domain information |
|---|
| >KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins | Back alignment and domain information |
|---|
| >KOG2139 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK01742 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG4547 consensus WD40 repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide | Back alignment and domain information |
|---|
| >KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1963 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1334 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3914 consensus WD repeat protein WDR4 [Function unknown] | Back alignment and domain information |
|---|
| >COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2321 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >PRK11028 6-phosphogluconolactonase; Provisional | Back alignment and domain information |
|---|
| >KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11028 6-phosphogluconolactonase; Provisional | Back alignment and domain information |
|---|
| >KOG2695 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide | Back alignment and domain information |
|---|
| >PRK01742 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PRK05137 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG4714 consensus Nucleoporin [Nuclear structure] | Back alignment and domain information |
|---|
| >KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1334 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK02889 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK04922 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4714 consensus Nucleoporin [Nuclear structure] | Back alignment and domain information |
|---|
| >PRK03629 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats | Back alignment and domain information |
|---|
| >KOG4190 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1963 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A | Back alignment and domain information |
|---|
| >KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB | Back alignment and domain information |
|---|
| >COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3914 consensus WD repeat protein WDR4 [Function unknown] | Back alignment and domain information |
|---|
| >KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG3039 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2321 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3881 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PRK04792 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PRK00178 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats | Back alignment and domain information |
|---|
| >KOG4190 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK03629 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] | Back alignment and domain information |
|---|
| >PRK02889 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PRK05137 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >PRK04922 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG4532 consensus WD40-like repeat containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB | Back alignment and domain information |
|---|
| >KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2695 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins | Back alignment and domain information |
|---|
| >PLN02919 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >KOG4547 consensus WD40 repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A | Back alignment and domain information |
|---|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >KOG4532 consensus WD40-like repeat containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF14447 Prok-RING_4: Prokaryotic RING finger family 4 | Back alignment and domain information |
|---|
| >PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal | Back alignment and domain information |
|---|
| >KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PRK01029 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2041 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >smart00320 WD40 WD40 repeats | Back alignment and domain information |
|---|
| >KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK01029 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK00178 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK04792 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B | Back alignment and domain information |
|---|
| >KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] | Back alignment and domain information |
|---|
| >KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] | Back alignment and domain information |
|---|
| >KOG3621 consensus WD40 repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02919 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region | Back alignment and domain information |
|---|
| >COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00320 WD40 WD40 repeats | Back alignment and domain information |
|---|
| >COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] | Back alignment and domain information |
|---|
| >KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK04043 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 | Back alignment and domain information |
|---|
| >KOG1912 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG3039 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3002 consensus Zn finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] | Back alignment and domain information |
|---|
| >KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain | Back alignment and domain information |
|---|
| >PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 | Back alignment and domain information |
|---|
| >COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 | Back alignment and domain information |
|---|
| >PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species | Back alignment and domain information |
|---|
| >COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] | Back alignment and domain information |
|---|
| >KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG5175 MOT2 Transcriptional repressor [Transcription] | Back alignment and domain information |
|---|
| >KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] | Back alignment and domain information |
|---|
| >KOG2041 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3621 consensus WD40 repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain | Back alignment and domain information |
|---|
| >PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain | Back alignment and domain information |
|---|
| >PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species | Back alignment and domain information |
|---|
| >PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] | Back alignment and domain information |
|---|
| >PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 | Back alignment and domain information |
|---|
| >PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region | Back alignment and domain information |
|---|
| >PRK04043 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >smart00502 BBC B-Box C-terminal domain | Back alignment and domain information |
|---|
| >KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] | Back alignment and domain information |
|---|
| >PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins | Back alignment and domain information |
|---|
| >TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL | Back alignment and domain information |
|---|
| >PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain | Back alignment and domain information |
|---|
| >KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG2444 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal | Back alignment and domain information |
|---|
| >KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PHA03096 p28-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG3386 Gluconolactonase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] | Back alignment and domain information |
|---|
| >KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins | Back alignment and domain information |
|---|
| >KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF14569 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A | Back alignment and domain information |
|---|
| >KOG1940 consensus Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02825 LAP/PHD finger-like protein; Provisional | Back alignment and domain information |
|---|
| >PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >KOG3579 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] | Back alignment and domain information |
|---|
| >PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length | Back alignment and domain information |
|---|
| >PRK13616 lipoprotein LpqB; Provisional | Back alignment and domain information |
|---|
| >PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) | Back alignment and domain information |
|---|
| >KOG1912 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length | Back alignment and domain information |
|---|
| >KOG3113 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] | Back alignment and domain information |
|---|
| >PHA02862 5L protein; Provisional | Back alignment and domain information |
|---|
| >PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit | Back alignment and domain information |
|---|
| >KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF15390 DUF4613: Domain of unknown function (DUF4613) | Back alignment and domain information |
|---|
| >KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] | Back alignment and domain information |
|---|
| >COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF10083 DUF2321: Uncharacterized protein conserved in bacteria (DUF2321); InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454 | Back alignment and domain information |
|---|
| >KOG4460 consensus Nuclear pore complex, Nup88/rNup84 component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins | Back alignment and domain information |
|---|
| >PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A | Back alignment and domain information |
|---|
| >PRK02888 nitrous-oxide reductase; Validated | Back alignment and domain information |
|---|
| >PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >PRK02888 nitrous-oxide reductase; Validated | Back alignment and domain information |
|---|
| >COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL | Back alignment and domain information |
|---|
| >PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length | Back alignment and domain information |
|---|
| >KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp | Back alignment and domain information |
|---|
| >COG3813 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >COG3391 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >TIGR01562 FdhE formate dehydrogenase accessory protein FdhE | Back alignment and domain information |
|---|
| >PRK11138 outer membrane biogenesis protein BamB; Provisional | Back alignment and domain information |
|---|
| >KOG2979 consensus Protein involved in DNA repair [General function prediction only] | Back alignment and domain information |
|---|
| >PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] | Back alignment and domain information |
|---|
| >PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins | Back alignment and domain information |
|---|
| >KOG2042 consensus Ubiquitin fusion degradation protein-2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13240 zinc_ribbon_2: zinc-ribbon domain | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF04216 FdhE: Protein involved in formate dehydrogenase formation; InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex [] | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin | Back alignment and domain information |
|---|
| >KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A | Back alignment and domain information |
|---|
| >PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PLN02638 cellulose synthase A (UDP-forming), catalytic subunit | Back alignment and domain information |
|---|
| >PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins | Back alignment and domain information |
|---|
| >KOG1916 consensus Nuclear protein, contains WD40 repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PF08606 Prp19: Prp19/Pso4-like; InterPro: IPR013915 This region is found specifically in PRP19-like protein | Back alignment and domain information |
|---|
| >TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >KOG1815 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2444 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF06906 DUF1272: Protein of unknown function (DUF1272); InterPro: IPR010696 This family consists of several hypothetical bacterial proteins of around 80 residues in length | Back alignment and domain information |
|---|
| >PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases | Back alignment and domain information |
|---|
| >KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 495 | ||||
| 2jmd_A | 63 | Solution Structure Of The Ring Domain Of Human Traf | 6e-08 | ||
| 2eci_A | 86 | Solution Structure Of The Ring Domain Of The Human | 9e-08 | ||
| 3hct_A | 118 | Crystal Structure Of Traf6 In Complex With Ubc13 In | 1e-07 | ||
| 3hcs_A | 170 | Crystal Structure Of The N-Terminal Domain Of Traf6 | 6e-06 | ||
| 2ckl_B | 165 | Ring1b-Bmi1 E3 Catalytic Domain Structure Length = | 1e-05 | ||
| 1jm7_A | 112 | Solution Structure Of The Brca1/bard1 Ring-domain H | 1e-05 | ||
| 2egp_A | 79 | Solution Structure Of The Ring-Finger Domain From H | 2e-05 | ||
| 3rpg_C | 121 | Bmi1RING1B-Ubch5c Complex Structure Length = 121 | 4e-05 | ||
| 2ecw_A | 85 | Solution Structure Of The Zinc Finger, C3hc4 Type ( | 8e-05 | ||
| 2h0d_B | 100 | Structure Of A Bmi-1-Ring1b Polycomb Group Ubiquiti | 9e-05 | ||
| 3ng2_A | 71 | Crystal Structure Of The Rnf4 Ring Domain Dimer Len | 1e-04 | ||
| 2ysj_A | 63 | Solution Structure Of The Ring Domain (1-56) From T | 1e-04 | ||
| 2ysl_A | 73 | Solution Structure Of The Ring Domain (1-66) From T | 2e-04 | ||
| 4i79_A | 399 | Crystal Structure Of Human Nup43 Length = 399 | 3e-04 | ||
| 4ayc_B | 138 | Rnf8 Ring Domain Structure Length = 138 | 7e-04 | ||
| 4epo_C | 149 | Crystal Structure Of Rnf8 Bound To The Ubc13MMS2 HE | 8e-04 |
| >pdb|2JMD|A Chain A, Solution Structure Of The Ring Domain Of Human Traf6 Length = 63 | Back alignment and structure |
|
| >pdb|2ECI|A Chain A, Solution Structure Of The Ring Domain Of The Human Tnf Receptor-Associated Factor 6 Protein Length = 86 | Back alignment and structure |
| >pdb|3HCT|A Chain A, Crystal Structure Of Traf6 In Complex With Ubc13 In The P1 Space Group Length = 118 | Back alignment and structure |
| >pdb|3HCS|A Chain A, Crystal Structure Of The N-Terminal Domain Of Traf6 Length = 170 | Back alignment and structure |
| >pdb|2CKL|B Chain B, Ring1b-Bmi1 E3 Catalytic Domain Structure Length = 165 | Back alignment and structure |
| >pdb|1JM7|A Chain A, Solution Structure Of The Brca1/bard1 Ring-domain Heterodimer Length = 112 | Back alignment and structure |
| >pdb|2EGP|A Chain A, Solution Structure Of The Ring-Finger Domain From Human Tripartite Motif Protein 34 Length = 79 | Back alignment and structure |
| >pdb|3RPG|C Chain C, Bmi1RING1B-Ubch5c Complex Structure Length = 121 | Back alignment and structure |
| >pdb|2ECW|A Chain A, Solution Structure Of The Zinc Finger, C3hc4 Type (Ring Finger) Domain Tripartite Motif Protein 30 Length = 85 | Back alignment and structure |
| >pdb|2H0D|B Chain B, Structure Of A Bmi-1-Ring1b Polycomb Group Ubiquitin Ligase Complex Length = 100 | Back alignment and structure |
| >pdb|3NG2|A Chain A, Crystal Structure Of The Rnf4 Ring Domain Dimer Length = 71 | Back alignment and structure |
| >pdb|2YSJ|A Chain A, Solution Structure Of The Ring Domain (1-56) From Tripartite Motif-containing Protein 31 Length = 63 | Back alignment and structure |
| >pdb|2YSL|A Chain A, Solution Structure Of The Ring Domain (1-66) From Tripartite Motif-containing Protein 31 Length = 73 | Back alignment and structure |
| >pdb|4I79|A Chain A, Crystal Structure Of Human Nup43 Length = 399 | Back alignment and structure |
| >pdb|4AYC|B Chain B, Rnf8 Ring Domain Structure Length = 138 | Back alignment and structure |
| >pdb|4EPO|C Chain C, Crystal Structure Of Rnf8 Bound To The Ubc13MMS2 HETERODIMER Length = 149 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 495 | |||
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 6e-22 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 4e-19 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 5e-18 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 7e-18 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 8e-18 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 2e-17 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 2e-17 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 3e-17 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 3e-17 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 5e-17 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 1e-14 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 1e-14 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 6e-14 | |
| 4epo_C | 149 | E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 | 1e-13 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 2e-13 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 3e-13 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 4e-13 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 4e-13 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 5e-13 | |
| 2xyi_A | 430 | Probable histone-binding protein CAF1; transcripti | 7e-13 | |
| 2xyi_A | 430 | Probable histone-binding protein CAF1; transcripti | 2e-11 | |
| 2xyi_A | 430 | Probable histone-binding protein CAF1; transcripti | 1e-09 | |
| 2xyi_A | 430 | Probable histone-binding protein CAF1; transcripti | 6e-05 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 2e-12 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 2e-12 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 4e-12 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 4e-12 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 8e-12 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 2e-11 | |
| 2pm9_A | 416 | Protein WEB1, protein transport protein SEC31; bet | 3e-11 | |
| 2pm9_A | 416 | Protein WEB1, protein transport protein SEC31; bet | 8e-11 | |
| 2pm9_A | 416 | Protein WEB1, protein transport protein SEC31; bet | 1e-09 | |
| 2pm9_A | 416 | Protein WEB1, protein transport protein SEC31; bet | 2e-08 | |
| 1pgu_A | 615 | Actin interacting protein 1; WD repeat, seven-blad | 4e-11 | |
| 1pgu_A | 615 | Actin interacting protein 1; WD repeat, seven-blad | 4e-08 | |
| 1pgu_A | 615 | Actin interacting protein 1; WD repeat, seven-blad | 8e-08 | |
| 1pgu_A | 615 | Actin interacting protein 1; WD repeat, seven-blad | 1e-06 | |
| 1pgu_A | 615 | Actin interacting protein 1; WD repeat, seven-blad | 3e-06 | |
| 1pgu_A | 615 | Actin interacting protein 1; WD repeat, seven-blad | 2e-05 | |
| 1pgu_A | 615 | Actin interacting protein 1; WD repeat, seven-blad | 5e-05 | |
| 1pgu_A | 615 | Actin interacting protein 1; WD repeat, seven-blad | 6e-05 | |
| 1nr0_A | 611 | Actin interacting protein 1; beta propeller, WD40 | 4e-11 | |
| 1nr0_A | 611 | Actin interacting protein 1; beta propeller, WD40 | 4e-10 | |
| 1nr0_A | 611 | Actin interacting protein 1; beta propeller, WD40 | 2e-09 | |
| 1nr0_A | 611 | Actin interacting protein 1; beta propeller, WD40 | 1e-08 | |
| 1nr0_A | 611 | Actin interacting protein 1; beta propeller, WD40 | 6e-08 | |
| 1nr0_A | 611 | Actin interacting protein 1; beta propeller, WD40 | 1e-07 | |
| 1nr0_A | 611 | Actin interacting protein 1; beta propeller, WD40 | 3e-06 | |
| 1nr0_A | 611 | Actin interacting protein 1; beta propeller, WD40 | 7e-05 | |
| 1nr0_A | 611 | Actin interacting protein 1; beta propeller, WD40 | 1e-04 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 6e-11 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 9e-11 | |
| 1yfq_A | 342 | Cell cycle arrest protein BUB3; WD repeat WD40 rep | 2e-10 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 3e-10 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 3e-10 | |
| 4ery_A | 312 | WD repeat-containing protein 5; WD40, WIN motif, b | 4e-10 | |
| 4ery_A | 312 | WD repeat-containing protein 5; WD40, WIN motif, b | 2e-06 | |
| 4ery_A | 312 | WD repeat-containing protein 5; WD40, WIN motif, b | 5e-06 | |
| 4ery_A | 312 | WD repeat-containing protein 5; WD40, WIN motif, b | 2e-05 | |
| 4ery_A | 312 | WD repeat-containing protein 5; WD40, WIN motif, b | 7e-05 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 7e-10 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 9e-10 | |
| 3ei3_B | 383 | DNA damage-binding protein 2; UV-damage, DDB, nucl | 1e-09 | |
| 3ei3_B | 383 | DNA damage-binding protein 2; UV-damage, DDB, nucl | 2e-08 | |
| 3ei3_B | 383 | DNA damage-binding protein 2; UV-damage, DDB, nucl | 3e-07 | |
| 3ei3_B | 383 | DNA damage-binding protein 2; UV-damage, DDB, nucl | 3e-05 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 2e-09 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 5e-06 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 4e-09 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 4e-09 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 5e-09 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 9e-08 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 6e-06 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 1e-05 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 2e-05 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 5e-09 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 7e-09 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 1e-08 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 5e-08 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 5e-08 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 8e-08 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 4e-07 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 9e-07 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 1e-06 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 2e-06 | |
| 2aq5_A | 402 | Coronin-1A; WD40 repeat, 7-bladed beta-propeller, | 8e-09 | |
| 2aq5_A | 402 | Coronin-1A; WD40 repeat, 7-bladed beta-propeller, | 9e-06 | |
| 3i2n_A | 357 | WD repeat-containing protein 92; WD40 repeats, str | 1e-08 | |
| 3i2n_A | 357 | WD repeat-containing protein 92; WD40 repeats, str | 8e-07 | |
| 3i2n_A | 357 | WD repeat-containing protein 92; WD40 repeats, str | 4e-06 | |
| 3i2n_A | 357 | WD repeat-containing protein 92; WD40 repeats, str | 4e-06 | |
| 3i2n_A | 357 | WD repeat-containing protein 92; WD40 repeats, str | 3e-04 | |
| 1k8k_C | 372 | P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- | 1e-08 | |
| 1k8k_C | 372 | P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- | 6e-07 | |
| 1k8k_C | 372 | P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- | 3e-06 | |
| 3k26_A | 366 | Polycomb protein EED; WD40, structural genomics, N | 1e-08 | |
| 3k26_A | 366 | Polycomb protein EED; WD40, structural genomics, N | 2e-05 | |
| 3k26_A | 366 | Polycomb protein EED; WD40, structural genomics, N | 5e-05 | |
| 3k26_A | 366 | Polycomb protein EED; WD40, structural genomics, N | 2e-04 | |
| 3k26_A | 366 | Polycomb protein EED; WD40, structural genomics, N | 8e-04 | |
| 3fm0_A | 345 | Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r | 1e-08 | |
| 3fm0_A | 345 | Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r | 4e-05 | |
| 3fm0_A | 345 | Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r | 1e-04 | |
| 3vl1_A | 420 | 26S proteasome regulatory subunit RPN14; beta-prop | 1e-08 | |
| 3vl1_A | 420 | 26S proteasome regulatory subunit RPN14; beta-prop | 7e-07 | |
| 3vl1_A | 420 | 26S proteasome regulatory subunit RPN14; beta-prop | 2e-06 | |
| 3vl1_A | 420 | 26S proteasome regulatory subunit RPN14; beta-prop | 2e-06 | |
| 3vl1_A | 420 | 26S proteasome regulatory subunit RPN14; beta-prop | 7e-05 | |
| 3vl1_A | 420 | 26S proteasome regulatory subunit RPN14; beta-prop | 4e-04 | |
| 2j04_B | 524 | YDR362CP, TAU91; beta propeller, type 2 promoters, | 1e-08 | |
| 2j04_B | 524 | YDR362CP, TAU91; beta propeller, type 2 promoters, | 1e-04 | |
| 3gre_A | 437 | Serine/threonine-protein kinase VPS15; seven-blade | 2e-08 | |
| 3gre_A | 437 | Serine/threonine-protein kinase VPS15; seven-blade | 4e-08 | |
| 3gre_A | 437 | Serine/threonine-protein kinase VPS15; seven-blade | 3e-07 | |
| 3gre_A | 437 | Serine/threonine-protein kinase VPS15; seven-blade | 7e-05 | |
| 2pbi_B | 354 | Guanine nucleotide-binding protein subunit beta 5; | 2e-08 | |
| 2pbi_B | 354 | Guanine nucleotide-binding protein subunit beta 5; | 1e-07 | |
| 2pbi_B | 354 | Guanine nucleotide-binding protein subunit beta 5; | 3e-06 | |
| 2pbi_B | 354 | Guanine nucleotide-binding protein subunit beta 5; | 8e-06 | |
| 3zwl_B | 369 | Eukaryotic translation initiation factor 3 subuni; | 3e-08 | |
| 3zwl_B | 369 | Eukaryotic translation initiation factor 3 subuni; | 5e-07 | |
| 3zwl_B | 369 | Eukaryotic translation initiation factor 3 subuni; | 6e-07 | |
| 3zwl_B | 369 | Eukaryotic translation initiation factor 3 subuni; | 5e-04 | |
| 1gxr_A | 337 | ESG1, transducin-like enhancer protein 1; transcri | 3e-08 | |
| 1gxr_A | 337 | ESG1, transducin-like enhancer protein 1; transcri | 1e-05 | |
| 1got_B | 340 | GT-beta; complex (GTP-binding/transducer), G prote | 5e-08 | |
| 1got_B | 340 | GT-beta; complex (GTP-binding/transducer), G prote | 1e-07 | |
| 1got_B | 340 | GT-beta; complex (GTP-binding/transducer), G prote | 3e-06 | |
| 1got_B | 340 | GT-beta; complex (GTP-binding/transducer), G prote | 7e-06 | |
| 3odt_A | 313 | Protein DOA1; ubiquitin, nuclear protein; HET: MSE | 5e-08 | |
| 3odt_A | 313 | Protein DOA1; ubiquitin, nuclear protein; HET: MSE | 5e-05 | |
| 3odt_A | 313 | Protein DOA1; ubiquitin, nuclear protein; HET: MSE | 5e-05 | |
| 3odt_A | 313 | Protein DOA1; ubiquitin, nuclear protein; HET: MSE | 3e-04 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 7e-08 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 8e-08 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 9e-08 | |
| 3f3f_A | 351 | Nucleoporin SEH1; structural protein, protein comp | 9e-08 | |
| 3f3f_A | 351 | Nucleoporin SEH1; structural protein, protein comp | 3e-06 | |
| 3f3f_A | 351 | Nucleoporin SEH1; structural protein, protein comp | 4e-06 | |
| 3bg1_A | 316 | Protein SEC13 homolog; NPC, transport, WD repeat, | 1e-07 | |
| 3bg1_A | 316 | Protein SEC13 homolog; NPC, transport, WD repeat, | 8e-06 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 1e-07 | |
| 4e54_B | 435 | DNA damage-binding protein 2; beta barrel, double | 2e-07 | |
| 4e54_B | 435 | DNA damage-binding protein 2; beta barrel, double | 5e-06 | |
| 4e54_B | 435 | DNA damage-binding protein 2; beta barrel, double | 1e-04 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 2e-07 | |
| 2pm7_B | 297 | Protein transport protein SEC13, protein transport | 2e-07 | |
| 2pm7_B | 297 | Protein transport protein SEC13, protein transport | 6e-06 | |
| 2pm7_B | 297 | Protein transport protein SEC13, protein transport | 3e-04 | |
| 4aez_A | 401 | CDC20, WD repeat-containing protein SLP1; cell cyc | 2e-07 | |
| 4aez_A | 401 | CDC20, WD repeat-containing protein SLP1; cell cyc | 4e-06 | |
| 4aez_A | 401 | CDC20, WD repeat-containing protein SLP1; cell cyc | 9e-05 | |
| 4aez_A | 401 | CDC20, WD repeat-containing protein SLP1; cell cyc | 6e-04 | |
| 3jro_A | 753 | Fusion protein of protein transport protein SEC13 | 3e-07 | |
| 3jro_A | 753 | Fusion protein of protein transport protein SEC13 | 2e-05 | |
| 3jro_A | 753 | Fusion protein of protein transport protein SEC13 | 6e-04 | |
| 1r5m_A | 425 | SIR4-interacting protein SIF2; transcription corep | 3e-07 | |
| 1r5m_A | 425 | SIR4-interacting protein SIF2; transcription corep | 6e-06 | |
| 1r5m_A | 425 | SIR4-interacting protein SIF2; transcription corep | 2e-05 | |
| 1r5m_A | 425 | SIR4-interacting protein SIF2; transcription corep | 8e-05 | |
| 1r5m_A | 425 | SIR4-interacting protein SIF2; transcription corep | 1e-04 | |
| 3ow8_A | 321 | WD repeat-containing protein 61; structural genomi | 3e-07 | |
| 3ow8_A | 321 | WD repeat-containing protein 61; structural genomi | 1e-06 | |
| 3ow8_A | 321 | WD repeat-containing protein 61; structural genomi | 3e-06 | |
| 3ow8_A | 321 | WD repeat-containing protein 61; structural genomi | 6e-06 | |
| 3ow8_A | 321 | WD repeat-containing protein 61; structural genomi | 5e-05 | |
| 3ow8_A | 321 | WD repeat-containing protein 61; structural genomi | 7e-05 | |
| 4a11_B | 408 | DNA excision repair protein ERCC-8; DNA binding pr | 3e-07 | |
| 4a11_B | 408 | DNA excision repair protein ERCC-8; DNA binding pr | 1e-06 | |
| 4a11_B | 408 | DNA excision repair protein ERCC-8; DNA binding pr | 2e-06 | |
| 4a11_B | 408 | DNA excision repair protein ERCC-8; DNA binding pr | 3e-05 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 4e-07 | |
| 3dwl_C | 377 | Actin-related protein 2/3 complex subunit 1; prope | 4e-07 | |
| 3dwl_C | 377 | Actin-related protein 2/3 complex subunit 1; prope | 2e-06 | |
| 3dwl_C | 377 | Actin-related protein 2/3 complex subunit 1; prope | 4e-06 | |
| 3dwl_C | 377 | Actin-related protein 2/3 complex subunit 1; prope | 5e-05 | |
| 3dwl_C | 377 | Actin-related protein 2/3 complex subunit 1; prope | 7e-04 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 5e-07 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 1e-06 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 2e-06 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 5e-06 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 9e-06 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 1e-05 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 7e-05 | |
| 3iz6_A | 305 | 40S ribosomal protein SA (S2P); eukaryotic ribosom | 5e-07 | |
| 3iz6_A | 305 | 40S ribosomal protein SA (S2P); eukaryotic ribosom | 5e-06 | |
| 3iz6_A | 305 | 40S ribosomal protein SA (S2P); eukaryotic ribosom | 5e-06 | |
| 3iz6_A | 305 | 40S ribosomal protein SA (S2P); eukaryotic ribosom | 4e-05 | |
| 3iz6_A | 305 | 40S ribosomal protein SA (S2P); eukaryotic ribosom | 7e-04 | |
| 3jrp_A | 379 | Fusion protein of protein transport protein SEC13 | 6e-07 | |
| 3jrp_A | 379 | Fusion protein of protein transport protein SEC13 | 6e-06 | |
| 3jrp_A | 379 | Fusion protein of protein transport protein SEC13 | 1e-04 | |
| 3m62_A | 968 | Ubiquitin conjugation factor E4; armadillo-like re | 8e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 9e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 8e-06 | |
| 1vyh_C | 410 | Platelet-activating factor acetylhydrolase IB alph | 1e-06 | |
| 1vyh_C | 410 | Platelet-activating factor acetylhydrolase IB alph | 7e-06 | |
| 1vyh_C | 410 | Platelet-activating factor acetylhydrolase IB alph | 2e-05 | |
| 1vyh_C | 410 | Platelet-activating factor acetylhydrolase IB alph | 2e-04 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 1e-06 | |
| 1sq9_A | 397 | Antiviral protein SKI8; WD repeat, beta-transducin | 2e-06 | |
| 1sq9_A | 397 | Antiviral protein SKI8; WD repeat, beta-transducin | 1e-04 | |
| 4aow_A | 340 | Guanine nucleotide-binding protein subunit beta-2; | 2e-06 | |
| 4aow_A | 340 | Guanine nucleotide-binding protein subunit beta-2; | 3e-05 | |
| 4aow_A | 340 | Guanine nucleotide-binding protein subunit beta-2; | 7e-05 | |
| 4aow_A | 340 | Guanine nucleotide-binding protein subunit beta-2; | 8e-04 | |
| 1erj_A | 393 | Transcriptional repressor TUP1; beta-propeller, tr | 2e-06 | |
| 1erj_A | 393 | Transcriptional repressor TUP1; beta-propeller, tr | 3e-06 | |
| 1erj_A | 393 | Transcriptional repressor TUP1; beta-propeller, tr | 3e-05 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 3e-06 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 8e-06 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 2e-05 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 5e-05 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 6e-05 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 3e-06 | |
| 2vdu_B | 450 | TRNA (guanine-N(7)-)-methyltransferase- associated | 5e-06 | |
| 2vdu_B | 450 | TRNA (guanine-N(7)-)-methyltransferase- associated | 8e-06 | |
| 2oaj_A | 902 | Protein SNI1; WD40 repeat, beta propeller, endocyt | 5e-06 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 5e-06 | |
| 2oit_A | 434 | Nucleoporin 214KDA; NH2 terminal domain of NUP214/ | 6e-06 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 8e-06 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 3e-05 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 7e-05 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 8e-05 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 1e-04 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 6e-04 | |
| 3mmy_A | 368 | MRNA export factor; mRNA export, nuclear protein; | 8e-06 | |
| 3mmy_A | 368 | MRNA export factor; mRNA export, nuclear protein; | 4e-05 | |
| 3mmy_A | 368 | MRNA export factor; mRNA export, nuclear protein; | 5e-04 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 1e-05 | |
| 3lrv_A | 343 | PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu | 1e-05 | |
| 3frx_A | 319 | Guanine nucleotide-binding protein subunit beta- l | 1e-05 | |
| 3frx_A | 319 | Guanine nucleotide-binding protein subunit beta- l | 3e-05 | |
| 3dm0_A | 694 | Maltose-binding periplasmic protein fused with RAC | 1e-05 | |
| 3dm0_A | 694 | Maltose-binding periplasmic protein fused with RAC | 3e-05 | |
| 2hes_X | 330 | YDR267CP; beta-propeller, WD40 repeat, biosyntheti | 2e-05 | |
| 2hes_X | 330 | YDR267CP; beta-propeller, WD40 repeat, biosyntheti | 3e-05 | |
| 2hes_X | 330 | YDR267CP; beta-propeller, WD40 repeat, biosyntheti | 5e-05 | |
| 2xzm_R | 343 | RACK1; ribosome, translation; 3.93A {Tetrahymena t | 2e-05 | |
| 2xzm_R | 343 | RACK1; ribosome, translation; 3.93A {Tetrahymena t | 4e-05 | |
| 2xzm_R | 343 | RACK1; ribosome, translation; 3.93A {Tetrahymena t | 1e-04 | |
| 2xzm_R | 343 | RACK1; ribosome, translation; 3.93A {Tetrahymena t | 4e-04 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 3e-05 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 3e-05 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 5e-05 | |
| 3dw8_B | 447 | Serine/threonine-protein phosphatase 2A 55 kDa RE | 5e-05 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 5e-05 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 7e-05 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 1e-04 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 2e-04 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 3e-04 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 4e-04 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 8e-04 |
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
Score = 89.4 bits (222), Expect = 6e-22
Identities = 22/74 (29%), Positives = 35/74 (47%), Gaps = 1/74 (1%)
Query: 41 TSEVGVSELDKDMLCPICMQIIKEAF-LTACGHSFCYMCIITHLRNKSDCPCCGHYLTNN 99
+ +D + C IC + A + C H++C +CI L K+ CP C +T
Sbjct: 11 PGLAVMKTIDDLLRCGICFEYFNIAMIIPQCSHNYCSLCIRKFLSYKTQCPTCCVTVTEP 70
Query: 100 QLYPNFLLDKLLKK 113
L N +LD+L+K
Sbjct: 71 DLKNNRILDELVKS 84
|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 | Back alignment and structure |
|---|
| >4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Length = 430 | Back alignment and structure |
|---|
| >2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Length = 430 | Back alignment and structure |
|---|
| >2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Length = 430 | Back alignment and structure |
|---|
| >2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Length = 430 | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 | Back alignment and structure |
|---|
| >2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Length = 416 | Back alignment and structure |
|---|
| >2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Length = 416 | Back alignment and structure |
|---|
| >2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Length = 416 | Back alignment and structure |
|---|
| >2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Length = 416 | Back alignment and structure |
|---|
| >1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Length = 615 | Back alignment and structure |
|---|
| >1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Length = 615 | Back alignment and structure |
|---|
| >1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Length = 615 | Back alignment and structure |
|---|
| >1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Length = 615 | Back alignment and structure |
|---|
| >1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Length = 615 | Back alignment and structure |
|---|
| >1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Length = 615 | Back alignment and structure |
|---|
| >1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Length = 615 | Back alignment and structure |
|---|
| >1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Length = 615 | Back alignment and structure |
|---|
| >1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Length = 611 | Back alignment and structure |
|---|
| >1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Length = 611 | Back alignment and structure |
|---|
| >1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Length = 611 | Back alignment and structure |
|---|
| >1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Length = 611 | Back alignment and structure |
|---|
| >1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Length = 611 | Back alignment and structure |
|---|
| >1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Length = 611 | Back alignment and structure |
|---|
| >1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Length = 611 | Back alignment and structure |
|---|
| >1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Length = 611 | Back alignment and structure |
|---|
| >1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Length = 611 | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Length = 267 | Back alignment and structure |
|---|
| >1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Length = 342 | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
| >4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A 2h13_A 3p4f_A 4a7j_A* 2h9l_A ... Length = 312 | Back alignment and structure |
|---|
| >4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A 2h13_A 3p4f_A 4a7j_A* 2h9l_A ... Length = 312 | Back alignment and structure |
|---|
| >4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A 2h13_A 3p4f_A 4a7j_A* 2h9l_A ... Length = 312 | Back alignment and structure |
|---|
| >4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A 2h13_A 3p4f_A 4a7j_A* 2h9l_A ... Length = 312 | Back alignment and structure |
|---|
| >4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A 2h13_A 3p4f_A 4a7j_A* 2h9l_A ... Length = 312 | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 | Back alignment and structure |
|---|
| >3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Length = 383 | Back alignment and structure |
|---|
| >3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Length = 383 | Back alignment and structure |
|---|
| >3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Length = 383 | Back alignment and structure |
|---|
| >3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Length = 383 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Length = 61 | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Length = 814 | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Length = 814 | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Length = 814 | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Length = 814 | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Length = 814 | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 | Back alignment and structure |
|---|
| >2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Length = 402 | Back alignment and structure |
|---|
| >2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Length = 402 | Back alignment and structure |
|---|
| >3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Length = 357 | Back alignment and structure |
|---|
| >3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Length = 357 | Back alignment and structure |
|---|
| >3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Length = 357 | Back alignment and structure |
|---|
| >3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Length = 357 | Back alignment and structure |
|---|
| >3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Length = 357 | Back alignment and structure |
|---|
| >1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Length = 372 | Back alignment and structure |
|---|
| >1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Length = 372 | Back alignment and structure |
|---|
| >1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Length = 372 | Back alignment and structure |
|---|
| >3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Length = 366 | Back alignment and structure |
|---|
| >3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Length = 366 | Back alignment and structure |
|---|
| >3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Length = 366 | Back alignment and structure |
|---|
| >3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Length = 366 | Back alignment and structure |
|---|
| >3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Length = 366 | Back alignment and structure |
|---|
| >3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Length = 345 | Back alignment and structure |
|---|
| >3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Length = 345 | Back alignment and structure |
|---|
| >3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Length = 345 | Back alignment and structure |
|---|
| >3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Length = 420 | Back alignment and structure |
|---|
| >3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Length = 420 | Back alignment and structure |
|---|
| >3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Length = 420 | Back alignment and structure |
|---|
| >3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Length = 420 | Back alignment and structure |
|---|
| >3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Length = 420 | Back alignment and structure |
|---|
| >3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Length = 420 | Back alignment and structure |
|---|
| >2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Length = 524 | Back alignment and structure |
|---|
| >2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Length = 524 | Back alignment and structure |
|---|
| >3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Length = 437 | Back alignment and structure |
|---|
| >3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Length = 437 | Back alignment and structure |
|---|
| >3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Length = 437 | Back alignment and structure |
|---|
| >3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Length = 437 | Back alignment and structure |
|---|
| >2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Length = 354 | Back alignment and structure |
|---|
| >2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Length = 354 | Back alignment and structure |
|---|
| >2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Length = 354 | Back alignment and structure |
|---|
| >2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Length = 354 | Back alignment and structure |
|---|
| >3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Length = 369 | Back alignment and structure |
|---|
| >3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Length = 369 | Back alignment and structure |
|---|
| >3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Length = 369 | Back alignment and structure |
|---|
| >3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Length = 369 | Back alignment and structure |
|---|
| >1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Length = 337 | Back alignment and structure |
|---|
| >1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Length = 337 | Back alignment and structure |
|---|
| >1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Length = 340 | Back alignment and structure |
|---|
| >1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Length = 340 | Back alignment and structure |
|---|
| >1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Length = 340 | Back alignment and structure |
|---|
| >1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Length = 340 | Back alignment and structure |
|---|
| >3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Length = 313 | Back alignment and structure |
|---|
| >3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Length = 313 | Back alignment and structure |
|---|
| >3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Length = 313 | Back alignment and structure |
|---|
| >3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Length = 313 | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Length = 85 | Back alignment and structure |
|---|
| >3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Length = 351 | Back alignment and structure |
|---|
| >3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Length = 351 | Back alignment and structure |
|---|
| >3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Length = 351 | Back alignment and structure |
|---|
| >3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Length = 316 | Back alignment and structure |
|---|
| >3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Length = 316 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 | Back alignment and structure |
|---|
| >4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Length = 435 | Back alignment and structure |
|---|
| >4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Length = 435 | Back alignment and structure |
|---|
| >4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Length = 435 | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Length = 100 | Back alignment and structure |
|---|
| >2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Length = 297 | Back alignment and structure |
|---|
| >2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Length = 297 | Back alignment and structure |
|---|
| >2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Length = 297 | Back alignment and structure |
|---|
| >4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Length = 401 | Back alignment and structure |
|---|
| >4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Length = 401 | Back alignment and structure |
|---|
| >4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Length = 401 | Back alignment and structure |
|---|
| >4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Length = 401 | Back alignment and structure |
|---|
| >3jro_A Fusion protein of protein transport protein SEC13 and nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, ER-golgi transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Length = 753 | Back alignment and structure |
|---|
| >3jro_A Fusion protein of protein transport protein SEC13 and nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, ER-golgi transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Length = 753 | Back alignment and structure |
|---|
| >3jro_A Fusion protein of protein transport protein SEC13 and nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, ER-golgi transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Length = 753 | Back alignment and structure |
|---|
| >1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Length = 425 | Back alignment and structure |
|---|
| >1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Length = 425 | Back alignment and structure |
|---|
| >1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Length = 425 | Back alignment and structure |
|---|
| >1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Length = 425 | Back alignment and structure |
|---|
| >1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Length = 425 | Back alignment and structure |
|---|
| >3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Length = 321 | Back alignment and structure |
|---|
| >3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Length = 321 | Back alignment and structure |
|---|
| >3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Length = 321 | Back alignment and structure |
|---|
| >3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Length = 321 | Back alignment and structure |
|---|
| >3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Length = 321 | Back alignment and structure |
|---|
| >3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Length = 321 | Back alignment and structure |
|---|
| >4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Length = 408 | Back alignment and structure |
|---|
| >4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Length = 408 | Back alignment and structure |
|---|
| >4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Length = 408 | Back alignment and structure |
|---|
| >4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Length = 408 | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 | Back alignment and structure |
|---|
| >3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Length = 377 | Back alignment and structure |
|---|
| >3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Length = 377 | Back alignment and structure |
|---|
| >3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Length = 377 | Back alignment and structure |
|---|
| >3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Length = 377 | Back alignment and structure |
|---|
| >3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Length = 377 | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Length = 445 | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Length = 445 | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Length = 445 | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Length = 445 | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Length = 445 | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Length = 445 | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Length = 445 | Back alignment and structure |
|---|
| >3iz6_A 40S ribosomal protein SA (S2P); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Length = 305 | Back alignment and structure |
|---|
| >3iz6_A 40S ribosomal protein SA (S2P); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Length = 305 | Back alignment and structure |
|---|
| >3iz6_A 40S ribosomal protein SA (S2P); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Length = 305 | Back alignment and structure |
|---|
| >3iz6_A 40S ribosomal protein SA (S2P); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Length = 305 | Back alignment and structure |
|---|
| >3iz6_A 40S ribosomal protein SA (S2P); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Length = 305 | Back alignment and structure |
|---|
| >3jrp_A Fusion protein of protein transport protein SEC13 and nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Length = 379 | Back alignment and structure |
|---|
| >3jrp_A Fusion protein of protein transport protein SEC13 and nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Length = 379 | Back alignment and structure |
|---|
| >3jrp_A Fusion protein of protein transport protein SEC13 and nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Length = 379 | Back alignment and structure |
|---|
| >3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Length = 968 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Length = 410 | Back alignment and structure |
|---|
| >1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Length = 410 | Back alignment and structure |
|---|
| >1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Length = 410 | Back alignment and structure |
|---|
| >1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Length = 410 | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Length = 78 | Back alignment and structure |
|---|
| >1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Length = 397 | Back alignment and structure |
|---|
| >1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Length = 397 | Back alignment and structure |
|---|
| >4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Length = 340 | Back alignment and structure |
|---|
| >4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Length = 340 | Back alignment and structure |
|---|
| >4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Length = 340 | Back alignment and structure |
|---|
| >4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Length = 340 | Back alignment and structure |
|---|
| >1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Length = 393 | Back alignment and structure |
|---|
| >1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Length = 393 | Back alignment and structure |
|---|
| >1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Length = 393 | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Length = 464 | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Length = 464 | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Length = 464 | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Length = 464 | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Length = 464 | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 | Back alignment and structure |
|---|
| >2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Length = 450 | Back alignment and structure |
|---|
| >2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Length = 450 | Back alignment and structure |
|---|
| >2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Length = 902 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 | Back alignment and structure |
|---|
| >2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Length = 434 | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Length = 435 | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Length = 435 | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Length = 435 | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Length = 435 | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Length = 435 | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Length = 435 | Back alignment and structure |
|---|
| >3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Length = 368 | Back alignment and structure |
|---|
| >3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Length = 368 | Back alignment and structure |
|---|
| >3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Length = 368 | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65 | Back alignment and structure |
|---|
| >3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Length = 343 | Back alignment and structure |
|---|
| >3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Length = 319 | Back alignment and structure |
|---|
| >3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Length = 319 | Back alignment and structure |
|---|
| >3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Length = 694 | Back alignment and structure |
|---|
| >3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Length = 694 | Back alignment and structure |
|---|
| >2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Length = 330 | Back alignment and structure |
|---|
| >2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Length = 330 | Back alignment and structure |
|---|
| >2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Length = 330 | Back alignment and structure |
|---|
| >2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Length = 343 | Back alignment and structure |
|---|
| >2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Length = 343 | Back alignment and structure |
|---|
| >2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Length = 343 | Back alignment and structure |
|---|
| >2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Length = 343 | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Length = 447 | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Length = 98 | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 94 | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Length = 64 | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Length = 179 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 495 | |||
| 3ow8_A | 321 | WD repeat-containing protein 61; structural genomi | 99.85 | |
| 4gqb_B | 344 | Methylosome protein 50; TIM barrel, beta-propeller | 99.84 | |
| 1got_B | 340 | GT-beta; complex (GTP-binding/transducer), G prote | 99.84 | |
| 2ynn_A | 304 | Coatomer subunit beta'; protein transport, peptide | 99.83 | |
| 4gqb_B | 344 | Methylosome protein 50; TIM barrel, beta-propeller | 99.83 | |
| 1vyh_C | 410 | Platelet-activating factor acetylhydrolase IB alph | 99.82 | |
| 2hes_X | 330 | YDR267CP; beta-propeller, WD40 repeat, biosyntheti | 99.82 | |
| 2pbi_B | 354 | Guanine nucleotide-binding protein subunit beta 5; | 99.82 | |
| 2ynn_A | 304 | Coatomer subunit beta'; protein transport, peptide | 99.81 | |
| 3fm0_A | 345 | Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r | 99.81 | |
| 3ow8_A | 321 | WD repeat-containing protein 61; structural genomi | 99.81 | |
| 2hes_X | 330 | YDR267CP; beta-propeller, WD40 repeat, biosyntheti | 99.81 | |
| 3fm0_A | 345 | Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r | 99.81 | |
| 3iz6_a | 380 | 40S ribosomal protein RACK1 (RACK1); eukaryotic ri | 99.8 | |
| 3frx_A | 319 | Guanine nucleotide-binding protein subunit beta- l | 99.8 | |
| 1vyh_C | 410 | Platelet-activating factor acetylhydrolase IB alph | 99.8 | |
| 2pm7_B | 297 | Protein transport protein SEC13, protein transport | 99.8 | |
| 1got_B | 340 | GT-beta; complex (GTP-binding/transducer), G prote | 99.8 | |
| 4ery_A | 312 | WD repeat-containing protein 5; WD40, WIN motif, b | 99.79 | |
| 1erj_A | 393 | Transcriptional repressor TUP1; beta-propeller, tr | 99.79 | |
| 4g56_B | 357 | MGC81050 protein; protein arginine methyltransfera | 99.79 | |
| 2j04_B | 524 | YDR362CP, TAU91; beta propeller, type 2 promoters, | 99.79 | |
| 4g56_B | 357 | MGC81050 protein; protein arginine methyltransfera | 99.79 | |
| 1nr0_A | 611 | Actin interacting protein 1; beta propeller, WD40 | 99.78 | |
| 3frx_A | 319 | Guanine nucleotide-binding protein subunit beta- l | 99.78 | |
| 2pbi_B | 354 | Guanine nucleotide-binding protein subunit beta 5; | 99.78 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 99.78 | |
| 2xzm_R | 343 | RACK1; ribosome, translation; 3.93A {Tetrahymena t | 99.77 | |
| 4h5i_A | 365 | Guanine nucleotide-exchange factor SEC12; copii ve | 99.77 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 99.77 | |
| 2w18_A | 356 | PALB2, fancn, partner and localizer of BRCA2; fanc | 99.77 | |
| 2pm7_B | 297 | Protein transport protein SEC13, protein transport | 99.77 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 99.77 | |
| 3iz6_a | 380 | 40S ribosomal protein RACK1 (RACK1); eukaryotic ri | 99.76 | |
| 2ymu_A | 577 | WD-40 repeat protein; unknown function, two domain | 99.75 | |
| 2xzm_R | 343 | RACK1; ribosome, translation; 3.93A {Tetrahymena t | 99.75 | |
| 2aq5_A | 402 | Coronin-1A; WD40 repeat, 7-bladed beta-propeller, | 99.75 | |
| 4e54_B | 435 | DNA damage-binding protein 2; beta barrel, double | 99.74 | |
| 3lrv_A | 343 | PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu | 99.74 | |
| 1erj_A | 393 | Transcriptional repressor TUP1; beta-propeller, tr | 99.74 | |
| 3dwl_C | 377 | Actin-related protein 2/3 complex subunit 1; prope | 99.74 | |
| 1nr0_A | 611 | Actin interacting protein 1; beta propeller, WD40 | 99.74 | |
| 4ery_A | 312 | WD repeat-containing protein 5; WD40, WIN motif, b | 99.74 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 99.74 | |
| 3bg1_A | 316 | Protein SEC13 homolog; NPC, transport, WD repeat, | 99.74 | |
| 4e54_B | 435 | DNA damage-binding protein 2; beta barrel, double | 99.74 | |
| 3bg1_A | 316 | Protein SEC13 homolog; NPC, transport, WD repeat, | 99.73 | |
| 4gq1_A | 393 | NUP37; propeller, transport protein; 2.40A {Schizo | 99.73 | |
| 3dwl_C | 377 | Actin-related protein 2/3 complex subunit 1; prope | 99.73 | |
| 3dm0_A | 694 | Maltose-binding periplasmic protein fused with RAC | 99.73 | |
| 4aow_A | 340 | Guanine nucleotide-binding protein subunit beta-2; | 99.72 | |
| 3f3f_A | 351 | Nucleoporin SEH1; structural protein, protein comp | 99.72 | |
| 2j04_B | 524 | YDR362CP, TAU91; beta propeller, type 2 promoters, | 99.71 | |
| 3vl1_A | 420 | 26S proteasome regulatory subunit RPN14; beta-prop | 99.71 | |
| 2ymu_A | 577 | WD-40 repeat protein; unknown function, two domain | 99.7 | |
| 2oaj_A | 902 | Protein SNI1; WD40 repeat, beta propeller, endocyt | 99.7 | |
| 2aq5_A | 402 | Coronin-1A; WD40 repeat, 7-bladed beta-propeller, | 99.7 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 99.7 | |
| 3k26_A | 366 | Polycomb protein EED; WD40, structural genomics, N | 99.69 | |
| 4gga_A | 420 | P55CDC, cell division cycle protein 20 homolog; ce | 99.69 | |
| 1sq9_A | 397 | Antiviral protein SKI8; WD repeat, beta-transducin | 99.69 | |
| 3f3f_A | 351 | Nucleoporin SEH1; structural protein, protein comp | 99.69 | |
| 3jrp_A | 379 | Fusion protein of protein transport protein SEC13 | 99.69 | |
| 3ei3_B | 383 | DNA damage-binding protein 2; UV-damage, DDB, nucl | 99.69 | |
| 3dm0_A | 694 | Maltose-binding periplasmic protein fused with RAC | 99.69 | |
| 3lrv_A | 343 | PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu | 99.69 | |
| 2xyi_A | 430 | Probable histone-binding protein CAF1; transcripti | 99.69 | |
| 3zwl_B | 369 | Eukaryotic translation initiation factor 3 subuni; | 99.68 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 99.68 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 99.68 | |
| 4aow_A | 340 | Guanine nucleotide-binding protein subunit beta-2; | 99.68 | |
| 1gxr_A | 337 | ESG1, transducin-like enhancer protein 1; transcri | 99.68 | |
| 3mmy_A | 368 | MRNA export factor; mRNA export, nuclear protein; | 99.68 | |
| 3dw8_B | 447 | Serine/threonine-protein phosphatase 2A 55 kDa RE | 99.67 | |
| 2xyi_A | 430 | Probable histone-binding protein CAF1; transcripti | 99.67 | |
| 1k8k_C | 372 | P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- | 99.67 | |
| 3vl1_A | 420 | 26S proteasome regulatory subunit RPN14; beta-prop | 99.67 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 99.67 | |
| 4ggc_A | 318 | P55CDC, cell division cycle protein 20 homolog; ce | 99.66 | |
| 3jrp_A | 379 | Fusion protein of protein transport protein SEC13 | 99.66 | |
| 1k8k_C | 372 | P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- | 99.66 | |
| 1pgu_A | 615 | Actin interacting protein 1; WD repeat, seven-blad | 99.66 | |
| 3ei3_B | 383 | DNA damage-binding protein 2; UV-damage, DDB, nucl | 99.66 | |
| 3dw8_B | 447 | Serine/threonine-protein phosphatase 2A 55 kDa RE | 99.66 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 99.66 | |
| 3k26_A | 366 | Polycomb protein EED; WD40, structural genomics, N | 99.66 | |
| 4a11_B | 408 | DNA excision repair protein ERCC-8; DNA binding pr | 99.66 | |
| 1gxr_A | 337 | ESG1, transducin-like enhancer protein 1; transcri | 99.65 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 99.65 | |
| 2pm9_A | 416 | Protein WEB1, protein transport protein SEC31; bet | 99.65 | |
| 3vu4_A | 355 | KMHSV2; beta-propeller fold, protein transport; 2. | 99.65 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 99.65 | |
| 3i2n_A | 357 | WD repeat-containing protein 92; WD40 repeats, str | 99.65 | |
| 3gre_A | 437 | Serine/threonine-protein kinase VPS15; seven-blade | 99.65 | |
| 1r5m_A | 425 | SIR4-interacting protein SIF2; transcription corep | 99.65 | |
| 4aez_A | 401 | CDC20, WD repeat-containing protein SLP1; cell cyc | 99.65 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 99.64 | |
| 4aez_A | 401 | CDC20, WD repeat-containing protein SLP1; cell cyc | 99.64 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 99.64 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 99.64 | |
| 3vu4_A | 355 | KMHSV2; beta-propeller fold, protein transport; 2. | 99.64 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 99.64 | |
| 1r5m_A | 425 | SIR4-interacting protein SIF2; transcription corep | 99.64 | |
| 4gq1_A | 393 | NUP37; propeller, transport protein; 2.40A {Schizo | 99.64 | |
| 3jro_A | 753 | Fusion protein of protein transport protein SEC13 | 99.63 | |
| 2pm9_A | 416 | Protein WEB1, protein transport protein SEC31; bet | 99.63 | |
| 3odt_A | 313 | Protein DOA1; ubiquitin, nuclear protein; HET: MSE | 99.63 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 99.63 | |
| 3i2n_A | 357 | WD repeat-containing protein 92; WD40 repeats, str | 99.62 | |
| 4gga_A | 420 | P55CDC, cell division cycle protein 20 homolog; ce | 99.62 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 99.62 | |
| 2vdu_B | 450 | TRNA (guanine-N(7)-)-methyltransferase- associated | 99.62 | |
| 2oit_A | 434 | Nucleoporin 214KDA; NH2 terminal domain of NUP214/ | 99.62 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 99.62 | |
| 2oaj_A | 902 | Protein SNI1; WD40 repeat, beta propeller, endocyt | 99.62 | |
| 1sq9_A | 397 | Antiviral protein SKI8; WD repeat, beta-transducin | 99.62 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 99.62 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 99.61 | |
| 3odt_A | 313 | Protein DOA1; ubiquitin, nuclear protein; HET: MSE | 99.61 | |
| 3gre_A | 437 | Serine/threonine-protein kinase VPS15; seven-blade | 99.61 | |
| 3jro_A | 753 | Fusion protein of protein transport protein SEC13 | 99.61 | |
| 3zwl_B | 369 | Eukaryotic translation initiation factor 3 subuni; | 99.6 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 99.6 | |
| 1yfq_A | 342 | Cell cycle arrest protein BUB3; WD repeat WD40 rep | 99.6 | |
| 2j04_A | 588 | TAU60, YPL007P, hypothetical protein YPL007C; beta | 99.6 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 99.6 | |
| 3mmy_A | 368 | MRNA export factor; mRNA export, nuclear protein; | 99.6 | |
| 4a11_B | 408 | DNA excision repair protein ERCC-8; DNA binding pr | 99.59 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 99.59 | |
| 2j04_A | 588 | TAU60, YPL007P, hypothetical protein YPL007C; beta | 99.59 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 99.59 | |
| 1yfq_A | 342 | Cell cycle arrest protein BUB3; WD repeat WD40 rep | 99.59 | |
| 2vdu_B | 450 | TRNA (guanine-N(7)-)-methyltransferase- associated | 99.59 | |
| 4h5i_A | 365 | Guanine nucleotide-exchange factor SEC12; copii ve | 99.59 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 99.59 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 99.58 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 99.58 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 99.57 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 99.56 | |
| 4ggc_A | 318 | P55CDC, cell division cycle protein 20 homolog; ce | 99.56 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 99.56 | |
| 2oit_A | 434 | Nucleoporin 214KDA; NH2 terminal domain of NUP214/ | 99.56 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 99.56 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 99.55 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 99.55 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 99.55 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 99.55 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 99.54 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 99.53 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 99.53 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 99.53 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 99.53 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 99.52 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 99.52 | |
| 1pgu_A | 615 | Actin interacting protein 1; WD repeat, seven-blad | 99.52 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 99.5 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 99.5 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 99.5 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 99.49 | |
| 2w18_A | 356 | PALB2, fancn, partner and localizer of BRCA2; fanc | 99.49 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 99.48 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 99.47 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 99.47 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 99.46 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 99.46 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 99.43 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 99.43 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 99.42 | |
| 1l0q_A | 391 | Surface layer protein; SLP, S-layer, 7-bladed beta | 99.4 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 99.4 | |
| 3bws_A | 433 | Protein LP49; two-domain, immunoglobulin-like, 7-b | 99.37 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 99.36 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 99.36 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 99.35 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 99.35 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 99.34 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 99.33 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 99.33 | |
| 1l0q_A | 391 | Surface layer protein; SLP, S-layer, 7-bladed beta | 99.32 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 99.3 | |
| 3bws_A | 433 | Protein LP49; two-domain, immunoglobulin-like, 7-b | 99.3 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 99.29 | |
| 2hqs_A | 415 | Protein TOLB; TOLB, PAL, TOL, transport protein-li | 99.28 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 99.22 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 99.19 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 99.19 | |
| 1nir_A | 543 | Nitrite reductase; hemoprotein, denitrification, d | 99.19 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 99.16 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 99.14 | |
| 2hqs_A | 415 | Protein TOLB; TOLB, PAL, TOL, transport protein-li | 99.12 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 99.11 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 99.09 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 99.07 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 99.05 | |
| 1ri6_A | 343 | Putative isomerase YBHE; 7-bladed propeller, enzym | 99.02 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 99.0 | |
| 2ojh_A | 297 | Uncharacterized protein ATU1656/AGR_C_3050; TOLB, | 99.0 | |
| 2ojh_A | 297 | Uncharacterized protein ATU1656/AGR_C_3050; TOLB, | 98.97 | |
| 3o4h_A | 582 | Acylamino-acid-releasing enzyme; alpha/beta hydrol | 98.96 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 98.95 | |
| 1ri6_A | 343 | Putative isomerase YBHE; 7-bladed propeller, enzym | 98.92 | |
| 3u4y_A | 331 | Uncharacterized protein; structural genomics, PSI- | 98.91 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 98.91 | |
| 1xfd_A | 723 | DIP, dipeptidyl aminopeptidase-like protein 6, dip | 98.9 | |
| 3hfq_A | 347 | Uncharacterized protein LP_2219; Q88V64_lacpl, NES | 98.88 | |
| 2ecf_A | 741 | Dipeptidyl peptidase IV; prolyl oligopeptidase fam | 98.86 | |
| 1k32_A | 1045 | Tricorn protease; protein degradation, substrate g | 98.84 | |
| 3vgz_A | 353 | Uncharacterized protein YNCE; beta-propeller, prot | 98.83 | |
| 1pby_B | 337 | Quinohemoprotein amine dehydrogenase 40 kDa subuni | 98.81 | |
| 2ecf_A | 741 | Dipeptidyl peptidase IV; prolyl oligopeptidase fam | 98.79 | |
| 3scy_A | 361 | Hypothetical bacterial 6-phosphogluconolactonase; | 98.78 | |
| 1z68_A | 719 | Fibroblast activation protein, alpha subunit; sepr | 98.78 | |
| 1nir_A | 543 | Nitrite reductase; hemoprotein, denitrification, d | 98.77 | |
| 3hfq_A | 347 | Uncharacterized protein LP_2219; Q88V64_lacpl, NES | 98.76 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 98.76 | |
| 3u4y_A | 331 | Uncharacterized protein; structural genomics, PSI- | 98.7 | |
| 4a5s_A | 740 | Dipeptidyl peptidase 4 soluble form; hydrolase, ty | 98.7 | |
| 3vgz_A | 353 | Uncharacterized protein YNCE; beta-propeller, prot | 98.69 | |
| 1xfd_A | 723 | DIP, dipeptidyl aminopeptidase-like protein 6, dip | 98.68 | |
| 2z3z_A | 706 | Dipeptidyl aminopeptidase IV; peptidase family S9, | 98.68 | |
| 3scy_A | 361 | Hypothetical bacterial 6-phosphogluconolactonase; | 98.66 | |
| 1jmx_B | 349 | Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; | 98.64 | |
| 1pby_B | 337 | Quinohemoprotein amine dehydrogenase 40 kDa subuni | 98.64 | |
| 1k32_A | 1045 | Tricorn protease; protein degradation, substrate g | 98.62 | |
| 1q7f_A | 286 | NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL | 98.6 | |
| 3o4h_A | 582 | Acylamino-acid-releasing enzyme; alpha/beta hydrol | 98.59 | |
| 3azo_A | 662 | Aminopeptidase; POP family, hydrolase; 2.00A {Stre | 98.57 | |
| 1z68_A | 719 | Fibroblast activation protein, alpha subunit; sepr | 98.56 | |
| 1jmx_B | 349 | Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; | 98.56 | |
| 1xip_A | 388 | Nucleoporin NUP159; beta-propeller, transport prot | 98.51 | |
| 1jof_A | 365 | Carboxy-CIS,CIS-muconate cyclase; beta-propeller, | 98.49 | |
| 2bkl_A | 695 | Prolyl endopeptidase; mechanistic study, celiac sp | 98.46 | |
| 2z3z_A | 706 | Dipeptidyl aminopeptidase IV; peptidase family S9, | 98.46 | |
| 1xip_A | 388 | Nucleoporin NUP159; beta-propeller, transport prot | 98.43 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 98.39 | |
| 2xdw_A | 710 | Prolyl endopeptidase; alpha/beta-hydrolase, amnesi | 98.37 | |
| 4a5s_A | 740 | Dipeptidyl peptidase 4 soluble form; hydrolase, ty | 98.37 | |
| 3m62_A | 968 | Ubiquitin conjugation factor E4; armadillo-like re | 98.32 | |
| 1jof_A | 365 | Carboxy-CIS,CIS-muconate cyclase; beta-propeller, | 98.32 | |
| 3fvz_A | 329 | Peptidyl-glycine alpha-amidating monooxygenase; be | 98.3 | |
| 3fvz_A | 329 | Peptidyl-glycine alpha-amidating monooxygenase; be | 98.29 | |
| 2dg1_A | 333 | DRP35, lactonase; beta propeller, hydrolase; 1.72A | 98.26 | |
| 1q7f_A | 286 | NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL | 98.24 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 98.21 | |
| 3e5z_A | 296 | Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco | 98.17 | |
| 2oiz_A | 361 | Aromatic amine dehydrogenase, large subunit; oxido | 98.16 | |
| 1rwi_B | 270 | Serine/threonine-protein kinase PKND; beta propell | 98.14 | |
| 2gop_A | 347 | Trilobed protease; beta propeller, open velcro, hy | 98.13 | |
| 2oiz_A | 361 | Aromatic amine dehydrogenase, large subunit; oxido | 98.12 | |
| 3azo_A | 662 | Aminopeptidase; POP family, hydrolase; 2.00A {Stre | 98.1 | |
| 3no2_A | 276 | Uncharacterized protein; six-bladed beta-propeller | 98.1 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 98.1 | |
| 1qks_A | 567 | Cytochrome CD1 nitrite reductase; enzyme, oxidored | 98.05 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 98.02 | |
| 3e5z_A | 296 | Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco | 98.0 | |
| 3pe7_A | 388 | Oligogalacturonate lyase; seven-bladed beta-propel | 97.97 | |
| 2dg1_A | 333 | DRP35, lactonase; beta propeller, hydrolase; 1.72A | 97.94 | |
| 3pe7_A | 388 | Oligogalacturonate lyase; seven-bladed beta-propel | 97.93 | |
| 1rwi_B | 270 | Serine/threonine-protein kinase PKND; beta propell | 97.9 | |
| 1yr2_A | 741 | Prolyl oligopeptidase; prolyl endopeptidase, mecha | 97.89 | |
| 3c5m_A | 396 | Oligogalacturonate lyase; blade-shaped beta-propel | 97.74 | |
| 1qks_A | 567 | Cytochrome CD1 nitrite reductase; enzyme, oxidored | 97.71 | |
| 3g4e_A | 297 | Regucalcin; six bladed beta-propeller, gluconolcat | 97.7 | |
| 3dsm_A | 328 | Uncharacterized protein bacuni_02894; seven_blated | 97.68 | |
| 1pjx_A | 314 | Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries | 97.68 | |
| 3no2_A | 276 | Uncharacterized protein; six-bladed beta-propeller | 97.64 | |
| 3dsm_A | 328 | Uncharacterized protein bacuni_02894; seven_blated | 97.6 | |
| 2z2n_A | 299 | Virginiamycin B lyase; seven-bladed beta-propeller | 97.56 | |
| 2xdw_A | 710 | Prolyl endopeptidase; alpha/beta-hydrolase, amnesi | 97.54 | |
| 3c5m_A | 396 | Oligogalacturonate lyase; blade-shaped beta-propel | 97.54 | |
| 3iuj_A | 693 | Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas | 97.54 | |
| 2qe8_A | 343 | Uncharacterized protein; structural genomics, join | 97.5 | |
| 2gop_A | 347 | Trilobed protease; beta propeller, open velcro, hy | 97.47 | |
| 2z2n_A | 299 | Virginiamycin B lyase; seven-bladed beta-propeller | 97.42 | |
| 2bkl_A | 695 | Prolyl endopeptidase; mechanistic study, celiac sp | 97.42 | |
| 3hrp_A | 409 | Uncharacterized protein; NP_812590.1, structural g | 97.35 | |
| 2jun_A | 101 | Midline-1; B-BOX, TRIM, ring finger, alternative s | 97.34 | |
| 3hrp_A | 409 | Uncharacterized protein; NP_812590.1, structural g | 97.32 | |
| 2ghs_A | 326 | AGR_C_1268P; regucalcin, structural genomics, join | 97.29 | |
| 1pjx_A | 314 | Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries | 97.27 | |
| 3sjl_D | 386 | Methylamine dehydrogenase heavy chain; MAUG, C-hem | 97.25 | |
| 2mad_H | 373 | Methylamine dehydrogenase (heavy subunit); oxidore | 97.17 | |
| 2qc5_A | 300 | Streptogramin B lactonase; beta propeller, lyase; | 97.15 | |
| 3g4e_A | 297 | Regucalcin; six bladed beta-propeller, gluconolcat | 97.13 | |
| 3dr2_A | 305 | Exported gluconolactonase; gluconolactonase SMP-30 | 97.09 | |
| 2hz6_A | 369 | Endoplasmic reticulum to nucleus signalling 1 isof | 97.07 | |
| 2qc5_A | 300 | Streptogramin B lactonase; beta propeller, lyase; | 97.05 | |
| 2iwa_A | 266 | Glutamine cyclotransferase; pyroglutamate, acyltra | 96.99 | |
| 3sjl_D | 386 | Methylamine dehydrogenase heavy chain; MAUG, C-hem | 96.99 | |
| 2ghs_A | 326 | AGR_C_1268P; regucalcin, structural genomics, join | 96.96 | |
| 2qe8_A | 343 | Uncharacterized protein; structural genomics, join | 96.93 | |
| 2mad_H | 373 | Methylamine dehydrogenase (heavy subunit); oxidore | 96.84 | |
| 3dr2_A | 305 | Exported gluconolactonase; gluconolactonase SMP-30 | 96.83 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 96.72 | |
| 3nol_A | 262 | Glutamine cyclotransferase; beta-propeller, glutam | 96.67 | |
| 3nok_A | 268 | Glutaminyl cyclase; beta-propeller, cyclotransfera | 96.61 | |
| 3c75_H | 426 | MADH, methylamine dehydrogenase heavy chain; coppe | 96.61 | |
| 1yr2_A | 741 | Prolyl oligopeptidase; prolyl endopeptidase, mecha | 96.56 | |
| 3mbr_X | 243 | Glutamine cyclotransferase; beta-propeller; 1.44A | 96.53 | |
| 3pbp_A | 452 | Nucleoporin NUP82; beta-propeller, mRNA export, mR | 96.16 | |
| 3iuj_A | 693 | Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas | 96.13 | |
| 1mda_H | 368 | Methylamine dehydrogenase (heavy subunit); electro | 96.1 | |
| 1fwx_A | 595 | Nitrous oxide reductase; beta-propeller domain, cu | 95.93 | |
| 3c75_H | 426 | MADH, methylamine dehydrogenase heavy chain; coppe | 95.92 | |
| 1npe_A | 267 | Nidogen, entactin; glycoprotein, basement membrane | 95.92 | |
| 2hz6_A | 369 | Endoplasmic reticulum to nucleus signalling 1 isof | 95.78 | |
| 1mda_H | 368 | Methylamine dehydrogenase (heavy subunit); electro | 95.74 | |
| 1npe_A | 267 | Nidogen, entactin; glycoprotein, basement membrane | 95.55 | |
| 2xe4_A | 751 | Oligopeptidase B; hydrolase-inhibitor complex, hyd | 95.45 | |
| 2iwa_A | 266 | Glutamine cyclotransferase; pyroglutamate, acyltra | 95.27 | |
| 1yiq_A | 689 | Quinohemoprotein alcohol dehydrogenase; electron t | 95.15 | |
| 3i2d_A | 371 | E3 SUMO-protein ligase SIZ1; signal transduction, | 95.14 | |
| 2ece_A | 462 | 462AA long hypothetical selenium-binding protein; | 95.09 | |
| 3tc9_A | 430 | Hypothetical hydrolase; 6-bladed beta-propeller, i | 95.02 | |
| 3v64_C | 349 | Agrin; beta propeller, laminin-G, signaling, prote | 94.9 | |
| 1kb0_A | 677 | Quinohemoprotein alcohol dehydrogenase; beta-prope | 94.86 | |
| 3v64_C | 349 | Agrin; beta propeller, laminin-G, signaling, prote | 94.69 | |
| 1weo_A | 93 | Cellulose synthase, catalytic subunit (IRX3); stru | 94.69 | |
| 2p4o_A | 306 | Hypothetical protein; putative lactonase, structur | 94.68 | |
| 3nok_A | 268 | Glutaminyl cyclase; beta-propeller, cyclotransfera | 94.68 | |
| 4fo9_A | 360 | E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom | 94.55 | |
| 3mbr_X | 243 | Glutamine cyclotransferase; beta-propeller; 1.44A | 94.41 | |
| 2cs3_A | 93 | Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s | 94.19 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 94.01 | |
| 1ijq_A | 316 | LDL receptor, low-density lipoprotein receptor; be | 93.97 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 93.94 | |
| 2ece_A | 462 | 462AA long hypothetical selenium-binding protein; | 93.85 | |
| 1tl2_A | 236 | L10, protein (tachylectin-2); animal lectin, horse | 93.79 | |
| 3nol_A | 262 | Glutamine cyclotransferase; beta-propeller, glutam | 93.78 | |
| 1ijq_A | 316 | LDL receptor, low-density lipoprotein receptor; be | 93.54 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 93.41 | |
| 2xe4_A | 751 | Oligopeptidase B; hydrolase-inhibitor complex, hyd | 93.37 | |
| 2p9w_A | 334 | MAL S 1 allergenic protein; beta propeller; 1.35A | 93.27 | |
| 1fwx_A | 595 | Nitrous oxide reductase; beta-propeller domain, cu | 93.11 | |
| 1kb0_A | 677 | Quinohemoprotein alcohol dehydrogenase; beta-prope | 92.85 | |
| 3qqz_A | 255 | Putative uncharacterized protein YJIK; MCSG, PSI-2 | 92.84 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 92.82 | |
| 2p4o_A | 306 | Hypothetical protein; putative lactonase, structur | 92.59 | |
| 3q7m_A | 376 | Lipoprotein YFGL, BAMB; beta-propeller, BAM comple | 92.54 | |
| 3sov_A | 318 | LRP-6, low-density lipoprotein receptor-related pr | 92.54 | |
| 2fp8_A | 322 | Strictosidine synthase; six bladed beta propeller | 92.31 | |
| 2fp8_A | 322 | Strictosidine synthase; six bladed beta propeller | 92.3 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 92.23 | |
| 2ism_A | 352 | Putative oxidoreductase; BL41XU spring-8, bladed b | 92.14 | |
| 3hxj_A | 330 | Pyrrolo-quinoline quinone; all beta protein. incom | 92.07 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 91.96 | |
| 2ko5_A | 99 | Ring finger protein Z; lassa fever virus-Z, negati | 91.69 | |
| 3tc9_A | 430 | Hypothetical hydrolase; 6-bladed beta-propeller, i | 91.51 | |
| 4hw6_A | 433 | Hypothetical protein, IPT/TIG domain protein; puta | 91.33 | |
| 3qqz_A | 255 | Putative uncharacterized protein YJIK; MCSG, PSI-2 | 91.31 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 91.17 | |
| 1cru_A | 454 | Protein (soluble quinoprotein glucose dehydrogena; | 90.98 | |
| 4hw6_A | 433 | Hypothetical protein, IPT/TIG domain protein; puta | 90.69 | |
| 1yiq_A | 689 | Quinohemoprotein alcohol dehydrogenase; electron t | 90.65 | |
| 2p9w_A | 334 | MAL S 1 allergenic protein; beta propeller; 1.35A | 90.4 | |
| 3hxj_A | 330 | Pyrrolo-quinoline quinone; all beta protein. incom | 89.59 | |
| 3kya_A | 496 | Putative phosphatase; structural genomics, joint c | 89.43 | |
| 2g8s_A | 353 | Glucose/sorbosone dehydrogenases; bladed beta-prop | 89.34 | |
| 3sov_A | 318 | LRP-6, low-density lipoprotein receptor-related pr | 89.2 | |
| 2ad6_A | 571 | Methanol dehydrogenase subunit 1; PQQ configuratio | 89.16 | |
| 3a9g_A | 354 | Putative uncharacterized protein; PQQ dependent de | 89.02 | |
| 4a0p_A | 628 | LRP6, LRP-6, low-density lipoprotein receptor-rela | 88.55 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 88.46 | |
| 2xbg_A | 327 | YCF48-like protein; photosynthesis, photosystem II | 88.42 | |
| 1flg_A | 582 | Protein (quinoprotein ethanol dehydrogenase); supe | 87.85 | |
| 1wff_A | 85 | Riken cDNA 2810002D23 protein; ZF-AN1 domain, zinc | 87.8 | |
| 3das_A | 347 | Putative oxidoreductase; aldose sugar dehydrogenas | 87.13 | |
| 1k3i_A | 656 | Galactose oxidase precursor; blade beta propeller, | 87.09 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 87.07 | |
| 3nmd_A | 72 | CGMP dependent protein kinase; leucine zipper, coi | 86.98 | |
| 3q7m_A | 376 | Lipoprotein YFGL, BAMB; beta-propeller, BAM comple | 86.96 | |
| 4a2l_A | 795 | BT_4663, two-component system sensor histidine kin | 86.79 | |
| 3sre_A | 355 | PON1, serum paraoxonase; directed evolution, 6-bla | 86.77 | |
| 2gmg_A | 105 | Hypothetical protein PF0610; winged-helix like pro | 86.57 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 86.45 | |
| 4a2l_A | 795 | BT_4663, two-component system sensor histidine kin | 86.37 | |
| 1kv9_A | 668 | Type II quinohemoprotein alcohol dehydrogenase; el | 86.29 | |
| 3pbp_A | 452 | Nucleoporin NUP82; beta-propeller, mRNA export, mR | 86.13 | |
| 3s94_A | 619 | LRP-6, low-density lipoprotein receptor-related pr | 86.01 | |
| 3s94_A | 619 | LRP-6, low-density lipoprotein receptor-related pr | 85.28 | |
| 4a0p_A | 628 | LRP6, LRP-6, low-density lipoprotein receptor-rela | 85.15 | |
| 1gmj_A | 84 | ATPase inhibitor; coiled-coil structure, P depende | 85.08 | |
| 3mq7_A | 121 | Bone marrow stromal antigen 2; HIV, antiviral prot | 84.9 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 84.51 | |
| 2fiy_A | 309 | Protein FDHE homolog; FDHE protein, structural gen | 83.09 | |
| 2jrp_A | 81 | Putative cytoplasmic protein; two-zinc binding pro | 83.07 | |
| 2l5g_B | 42 | Putative uncharacterized protein NCOR2, G protein | 82.75 | |
| 2k5c_A | 95 | Uncharacterized protein PF0385; structural genomic | 82.53 | |
| 1weu_A | 91 | Inhibitor of growth family, member 4; structural g | 82.52 | |
| 3kya_A | 496 | Putative phosphatase; structural genomics, joint c | 82.52 | |
| 2jne_A | 101 | Hypothetical protein YFGJ; zinc fingers, two zinc, | 82.02 | |
| 3mjh_B | 34 | Early endosome antigen 1; protein-zinc finger comp | 81.54 | |
| 2ad6_A | 571 | Methanol dehydrogenase subunit 1; PQQ configuratio | 81.25 | |
| 2xbg_A | 327 | YCF48-like protein; photosynthesis, photosystem II | 80.72 | |
| 3v9f_A | 781 | Two-component system sensor histidine kinase/RESP | 80.16 |
| >3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.85 E-value=8.4e-21 Score=183.95 Aligned_cols=144 Identities=22% Similarity=0.283 Sum_probs=126.6
Q ss_pred cccccCcccchhhHHhhhhhhhcccCceEEEEeeccccccCCCcEEEEEEccCCCEEEEEeCCCcEEEEEccccccCCCC
Q 048199 335 IIHREGYNAGLADFQSVLTTFTRYSRLRVIAELRHGDIFHSANIVSSIEFDRDDQLFATAGVSRRIKVFDFASVVNEPAD 414 (495)
Q Consensus 335 ~~~~~~~~~g~~d~~~~lw~~~~~~~~~~~~~~~~~~~~~h~~~V~~l~~~p~~~~l~s~s~d~~i~vwd~~~~~~~~~~ 414 (495)
..++..+++|+.|+.+++|++. ....+..+. +|...|++++|+|++.+|++|+.|++|++||++.+
T Consensus 173 spdg~~lasg~~dg~i~iwd~~---~~~~~~~~~-----~h~~~v~~l~~spd~~~l~s~s~dg~i~iwd~~~~------ 238 (321)
T 3ow8_A 173 SPDGKYLASGAIDGIINIFDIA---TGKLLHTLE-----GHAMPIRSLTFSPDSQLLVTASDDGYIKIYDVQHA------ 238 (321)
T ss_dssp CTTSSEEEEEETTSCEEEEETT---TTEEEEEEC-----CCSSCCCEEEECTTSCEEEEECTTSCEEEEETTTC------
T ss_pred CCCCCEEEEEcCCCeEEEEECC---CCcEEEEEc-----ccCCceeEEEEcCCCCEEEEEcCCCeEEEEECCCc------
Confidence 3456678899999999999984 234455555 89999999999999999999999999999999876
Q ss_pred cCCCeeecCCCCCeEEEEEcCCCCCEEEEecCCCcEEEEeCCCCcceeecccccCcEEEEEeecCCCCeEEEeeCCCcEe
Q 048199 415 VHCPVVEMPTRSKLSCLSWNKFSKNRIASSDYEGIVTVWDVTTQQSVMEYEEHEKRAWSVDFSRTEPSMLVSGSDDCKVL 494 (495)
Q Consensus 415 ~~~~~~~~~~~~~i~~~~~~p~~~~~l~sg~~dg~v~iwd~~~~~~~~~~~~h~~~v~~v~~~~~~g~~l~s~s~D~~v~ 494 (495)
.......+|...|.+++|+|+ +.+|++|+.||+|+|||+.++.++..+.+|...|++++|+| ++.+|++++.|++|+
T Consensus 239 -~~~~~~~~h~~~v~~~~~sp~-~~~l~s~s~D~~v~iwd~~~~~~~~~~~~h~~~v~~v~~s~-~g~~l~s~~~d~~i~ 315 (321)
T 3ow8_A 239 -NLAGTLSGHASWVLNVAFCPD-DTHFVSSSSDKSVKVWDVGTRTCVHTFFDHQDQVWGVKYNG-NGSKIVSVGDDQEIH 315 (321)
T ss_dssp -CEEEEECCCSSCEEEEEECTT-SSEEEEEETTSCEEEEETTTTEEEEEECCCSSCEEEEEECT-TSSEEEEEETTCCEE
T ss_pred -ceeEEEcCCCCceEEEEECCC-CCEEEEEeCCCcEEEEeCCCCEEEEEEcCCCCcEEEEEECC-CCCEEEEEeCCCeEE
Confidence 222334468889999999999 89999999999999999999999999999999999999999 999999999999998
Q ss_pred C
Q 048199 495 Y 495 (495)
Q Consensus 495 l 495 (495)
|
T Consensus 316 v 316 (321)
T 3ow8_A 316 I 316 (321)
T ss_dssp E
T ss_pred E
Confidence 5
|
| >4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* | Back alignment and structure |
|---|
| >2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A | Back alignment and structure |
|---|
| >4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} | Back alignment and structure |
|---|
| >2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A | Back alignment and structure |
|---|
| >3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} | Back alignment and structure |
|---|
| >3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* | Back alignment and structure |
|---|
| >1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A | Back alignment and structure |
|---|
| >1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* | Back alignment and structure |
|---|
| >4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... | Back alignment and structure |
|---|
| >1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} | Back alignment and structure |
|---|
| >2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} | Back alignment and structure |
|---|
| >1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A | Back alignment and structure |
|---|
| >3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* | Back alignment and structure |
|---|
| >2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R | Back alignment and structure |
|---|
| >4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A | Back alignment and structure |
|---|
| >2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} | Back alignment and structure |
|---|
| >2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R | Back alignment and structure |
|---|
| >2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A | Back alignment and structure |
|---|
| >4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* | Back alignment and structure |
|---|
| >3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A | Back alignment and structure |
|---|
| >4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A | Back alignment and structure |
|---|
| >4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* | Back alignment and structure |
|---|
| >3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A | Back alignment and structure |
|---|
| >4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A | Back alignment and structure |
|---|
| >3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} | Back alignment and structure |
|---|
| >4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a | Back alignment and structure |
|---|
| >3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A | Back alignment and structure |
|---|
| >2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A | Back alignment and structure |
|---|
| >2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A | Back alignment and structure |
|---|
| >4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A | Back alignment and structure |
|---|
| >1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X | Back alignment and structure |
|---|
| >3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A | Back alignment and structure |
|---|
| >3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* | Back alignment and structure |
|---|
| >3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} | Back alignment and structure |
|---|
| >3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B | Back alignment and structure |
|---|
| >3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a | Back alignment and structure |
|---|
| >1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A | Back alignment and structure |
|---|
| >3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B | Back alignment and structure |
|---|
| >1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C | Back alignment and structure |
|---|
| >3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} | Back alignment and structure |
|---|
| >3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C | Back alignment and structure |
|---|
| >1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A | Back alignment and structure |
|---|
| >3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* | Back alignment and structure |
|---|
| >3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A | Back alignment and structure |
|---|
| >4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} | Back alignment and structure |
|---|
| >1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A | Back alignment and structure |
|---|
| >3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A | Back alignment and structure |
|---|
| >2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A | Back alignment and structure |
|---|
| >2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 | Back alignment and structure |
|---|
| >3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 | Back alignment and structure |
|---|
| >3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* | Back alignment and structure |
|---|
| >3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* | Back alignment and structure |
|---|
| >1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* | Back alignment and structure |
|---|
| >2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A | Back alignment and structure |
|---|
| >1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* | Back alignment and structure |
|---|
| >3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} | Back alignment and structure |
|---|
| >4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... | Back alignment and structure |
|---|
| >3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* | Back alignment and structure |
|---|
| >1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 | Back alignment and structure |
|---|
| >2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* | Back alignment and structure |
|---|
| >3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A | Back alignment and structure |
|---|
| >1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* | Back alignment and structure |
|---|
| >1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* | Back alignment and structure |
|---|
| >1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* | Back alignment and structure |
|---|
| >1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 | Back alignment and structure |
|---|
| >3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A | Back alignment and structure |
|---|
| >3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A | Back alignment and structure |
|---|
| >1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* | Back alignment and structure |
|---|
| >1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* | Back alignment and structure |
|---|
| >1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 | Back alignment and structure |
|---|
| >2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* | Back alignment and structure |
|---|
| >1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* | Back alignment and structure |
|---|
| >4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... | Back alignment and structure |
|---|
| >3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A | Back alignment and structure |
|---|
| >1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 | Back alignment and structure |
|---|
| >3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* | Back alignment and structure |
|---|
| >3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* | Back alignment and structure |
|---|
| >2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A | Back alignment and structure |
|---|
| >1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... | Back alignment and structure |
|---|
| >1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A | Back alignment and structure |
|---|
| >2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... | Back alignment and structure |
|---|
| >3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A | Back alignment and structure |
|---|
| >3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} | Back alignment and structure |
|---|
| >2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A | Back alignment and structure |
|---|
| >3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} | Back alignment and structure |
|---|
| >1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A | Back alignment and structure |
|---|
| >1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} | Back alignment and structure |
|---|
| >3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* | Back alignment and structure |
|---|
| >3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B | Back alignment and structure |
|---|
| >3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} | Back alignment and structure |
|---|
| >1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... | Back alignment and structure |
|---|
| >3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} | Back alignment and structure |
|---|
| >3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} | Back alignment and structure |
|---|
| >2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* | Back alignment and structure |
|---|
| >2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* | Back alignment and structure |
|---|
| >3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* | Back alignment and structure |
|---|
| >2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* | Back alignment and structure |
|---|
| >2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} | Back alignment and structure |
|---|
| >2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} | Back alignment and structure |
|---|
| >2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 | Back alignment and structure |
|---|
| >1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... | Back alignment and structure |
|---|
| >3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... | Back alignment and structure |
|---|
| >2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* | Back alignment and structure |
|---|
| >2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} | Back alignment and structure |
|---|
| >3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B | Back alignment and structure |
|---|
| >3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} | Back alignment and structure |
|---|
| >2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* | Back alignment and structure |
|---|
| >3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... | Back alignment and structure |
|---|
| >2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 | Back alignment and structure |
|---|
| >2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* | Back alignment and structure |
|---|
| >3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
| >3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A | Back alignment and structure |
|---|
| >3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} | Back alignment and structure |
|---|
| >1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} | Back alignment and structure |
|---|
| >3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A | Back alignment and structure |
|---|
| >3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* | Back alignment and structure |
|---|
| >1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 | Back alignment and structure |
|---|
| >1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A | Back alignment and structure |
|---|
| >3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} | Back alignment and structure |
|---|
| >1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 | Back alignment and structure |
|---|
| >2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 | Back alignment and structure |
|---|
| >1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 | Back alignment and structure |
|---|
| >2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} | Back alignment and structure |
|---|
| >2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* | Back alignment and structure |
|---|
| >1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 | Back alignment and structure |
|---|
| >3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 | Back alignment and structure |
|---|
| >3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B | Back alignment and structure |
|---|
| >3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* | Back alignment and structure |
|---|
| >3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A | Back alignment and structure |
|---|
| >1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} | Back alignment and structure |
|---|
| >2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} | Back alignment and structure |
|---|
| >1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A | Back alignment and structure |
|---|
| >1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 | Back alignment and structure |
|---|
| >3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 | Back alignment and structure |
|---|
| >3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A | Back alignment and structure |
|---|
| >3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B | Back alignment and structure |
|---|
| >2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* | Back alignment and structure |
|---|
| >2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* | Back alignment and structure |
|---|
| >1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A | Back alignment and structure |
|---|
| >4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} | Back alignment and structure |
|---|
| >2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} | Back alignment and structure |
|---|
| >3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} | Back alignment and structure |
|---|
| >3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B | Back alignment and structure |
|---|
| >2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* | Back alignment and structure |
|---|
| >3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* | Back alignment and structure |
|---|
| >4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} | Back alignment and structure |
|---|
| >1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 | Back alignment and structure |
|---|
| >1wff_A Riken cDNA 2810002D23 protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.80.1.1 | Back alignment and structure |
|---|
| >3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >3nmd_A CGMP dependent protein kinase; leucine zipper, coiled-coil, structural genomics, berkeley S genomics center, BSGC, dimerization; HET: MSE; 2.27A {Homo sapiens} | Back alignment and structure |
|---|
| >3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A | Back alignment and structure |
|---|
| >4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* | Back alignment and structure |
|---|
| >3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* | Back alignment and structure |
|---|
| >2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 | Back alignment and structure |
|---|
| >4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* | Back alignment and structure |
|---|
| >1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 | Back alignment and structure |
|---|
| >3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A | Back alignment and structure |
|---|
| >3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* | Back alignment and structure |
|---|
| >3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* | Back alignment and structure |
|---|
| >4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* | Back alignment and structure |
|---|
| >1gmj_A ATPase inhibitor; coiled-coil structure, P dependent oligomerization, ATP hydrolysis; 2.2A {Bos taurus} SCOP: h.4.8.1 PDB: 1ohh_H* 1hf9_A | Back alignment and structure |
|---|
| >3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A | Back alignment and structure |
|---|
| >2fiy_A Protein FDHE homolog; FDHE protein, structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pseudomonas aeruginosa} SCOP: e.59.1.1 | Back alignment and structure |
|---|
| >2jrp_A Putative cytoplasmic protein; two-zinc binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium LT2} | Back alignment and structure |
|---|
| >2l5g_B Putative uncharacterized protein NCOR2, G protein pathway suppressor 2; GPS2, SMRT, TBL1, CO-repressor, transcription regulator; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2jne_A Hypothetical protein YFGJ; zinc fingers, two zinc, structural genomics, PSI-2, protein structure initiative; NMR {Escherichia coli} SCOP: g.41.18.1 | Back alignment and structure |
|---|
| >3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} | Back alignment and structure |
|---|
| >2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* | Back alignment and structure |
|---|
| >2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} | Back alignment and structure |
|---|
| >3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 495 | ||||
| d1jm7a_ | 103 | g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie | 3e-15 | |
| d1t1ha_ | 78 | g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre | 2e-13 | |
| d1rmda2 | 86 | g.44.1.1 (A:1-86) V(D)J recombination activating p | 4e-12 | |
| d1erja_ | 388 | b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea | 4e-11 | |
| d1tbga_ | 340 | b.69.4.1 (A:) beta1-subunit of the signal-transduc | 6e-11 | |
| d1tbga_ | 340 | b.69.4.1 (A:) beta1-subunit of the signal-transduc | 7e-04 | |
| d1jm7b_ | 97 | g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie | 6e-11 | |
| d1fbva4 | 79 | g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta | 6e-10 | |
| d1chca_ | 68 | g.44.1.1 (A:) Immediate early protein, IEEHV {Equi | 7e-10 | |
| d1bora_ | 56 | g.44.1.1 (A:) Acute promyelocytic leukaemia proto- | 8e-10 | |
| d2baya1 | 56 | g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { | 9e-10 | |
| d2c2la2 | 80 | g.44.1.2 (A:225-304) STIP1 homology and U box-cont | 3e-09 | |
| d1iyma_ | 55 | g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati | 3e-09 | |
| d1vyhc1 | 317 | b.69.4.1 (C:92-408) Platelet-activating factor ace | 9e-08 | |
| d1vyhc1 | 317 | b.69.4.1 (C:92-408) Platelet-activating factor ace | 0.001 | |
| d1nexb2 | 355 | b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' | 6e-07 | |
| d1k8kc_ | 371 | b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 | 7e-07 | |
| d1k8kc_ | 371 | b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 | 5e-04 | |
| d1g25a_ | 65 | g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi | 1e-06 | |
| d1gxra_ | 337 | b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum | 9e-06 | |
| d1gxra_ | 337 | b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum | 3e-04 | |
| d2ovrb2 | 342 | b.69.4.1 (B:2365-2706) F-box/WD repeat-containing | 2e-05 | |
| d2ovrb2 | 342 | b.69.4.1 (B:2365-2706) F-box/WD repeat-containing | 3e-05 | |
| d2ovrb2 | 342 | b.69.4.1 (B:2365-2706) F-box/WD repeat-containing | 0.001 | |
| d1ur6b_ | 52 | g.44.1.1 (B:) Not-4 N-terminal RING finger domain | 2e-05 | |
| d1p22a2 | 293 | b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be | 5e-05 | |
| d1p22a2 | 293 | b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be | 0.001 | |
| d1pgua1 | 325 | b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba | 8e-05 | |
| d1pgua1 | 325 | b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba | 0.001 | |
| d1wgma_ | 98 | g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Hu | 9e-05 | |
| d1yfqa_ | 342 | b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake | 1e-04 | |
| d1yfqa_ | 342 | b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake | 0.002 | |
| d1vyxa_ | 60 | g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do | 0.001 | |
| d1sq9a_ | 393 | b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake | 0.001 | |
| d1nr0a1 | 311 | b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne | 0.002 | |
| d1nr0a1 | 311 | b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne | 0.004 | |
| d3dplr1 | 88 | g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S | 0.002 | |
| d1wima_ | 94 | g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 | 0.003 |
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: brca1 RING domain species: Human (Homo sapiens) [TaxId: 9606]
Score = 69.3 bits (169), Expect = 3e-15
Identities = 27/81 (33%), Positives = 44/81 (54%), Gaps = 7/81 (8%)
Query: 46 VSELDKDMLCPICMQIIKEAFLTACGHSFCYMCIITHL---RNKSDCPCCGHYLTNNQLY 102
++ + K + CPIC+++IKE T C H FC C++ L + S CP C + +T L
Sbjct: 15 INAMQKILECPICLELIKEPVSTKCDHIFCKFCMLKLLNQKKGPSQCPLCKNDITKRSLQ 74
Query: 103 PNF----LLDKLLKKTSARQI 119
+ L+++LLK A Q+
Sbjct: 75 ESTRFSQLVEELLKIICAFQL 95
|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
| >d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 | Back information, alignment and structure |
|---|
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 | Back information, alignment and structure |
|---|
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 | Back information, alignment and structure |
|---|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 | Back information, alignment and structure |
|---|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 | Back information, alignment and structure |
|---|
| >d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 | Back information, alignment and structure |
|---|
| >d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 | Back information, alignment and structure |
|---|
| >d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 | Back information, alignment and structure |
|---|
| >d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 | Back information, alignment and structure |
|---|
| >d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 | Back information, alignment and structure |
|---|
| >d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 | Back information, alignment and structure |
|---|
| >d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 | Back information, alignment and structure |
|---|
| >d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 | Back information, alignment and structure |
|---|
| >d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 | Back information, alignment and structure |
|---|
| >d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 | Back information, alignment and structure |
|---|
| >d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 | Back information, alignment and structure |
|---|
| >d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 | Back information, alignment and structure |
|---|
| >d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 | Back information, alignment and structure |
|---|
| >d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 | Back information, alignment and structure |
|---|
| >d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 495 | |||
| d1tbga_ | 340 | beta1-subunit of the signal-transducing G protein | 99.82 | |
| d1k8kc_ | 371 | Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur | 99.76 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 99.76 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 99.75 | |
| d1erja_ | 388 | Tup1, C-terminal domain {Baker's yeast (Saccharomy | 99.75 | |
| d1nr0a1 | 311 | Actin interacting protein 1 {Nematode (Caenorhabdi | 99.74 | |
| d1gxra_ | 337 | Groucho/tle1, C-terminal domain {Human (Homo sapie | 99.73 | |
| d1sq9a_ | 393 | Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac | 99.73 | |
| d1sq9a_ | 393 | Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac | 99.73 | |
| d1vyhc1 | 317 | Platelet-activating factor acetylhydrolase IB subu | 99.73 | |
| d1nr0a1 | 311 | Actin interacting protein 1 {Nematode (Caenorhabdi | 99.72 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.7 | |
| d1tbga_ | 340 | beta1-subunit of the signal-transducing G protein | 99.7 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 99.69 | |
| d1gxra_ | 337 | Groucho/tle1, C-terminal domain {Human (Homo sapie | 99.69 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 99.69 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.68 | |
| d1k8kc_ | 371 | Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur | 99.68 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 99.67 | |
| d1pgua2 | 287 | Actin interacting protein 1 {Baker's yeast (Saccha | 99.67 | |
| d1nr0a2 | 299 | Actin interacting protein 1 {Nematode (Caenorhabdi | 99.63 | |
| d1erja_ | 388 | Tup1, C-terminal domain {Baker's yeast (Saccharomy | 99.61 | |
| d1vyhc1 | 317 | Platelet-activating factor acetylhydrolase IB subu | 99.6 | |
| d2ovrb2 | 342 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 99.59 | |
| d1pgua1 | 325 | Actin interacting protein 1 {Baker's yeast (Saccha | 99.58 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 99.58 | |
| d1pgua1 | 325 | Actin interacting protein 1 {Baker's yeast (Saccha | 99.58 | |
| d1nr0a2 | 299 | Actin interacting protein 1 {Nematode (Caenorhabdi | 99.55 | |
| d1nexb2 | 355 | Cdc4 propeller domain {Baker's yeast (Saccharomyce | 99.54 | |
| d1nexb2 | 355 | Cdc4 propeller domain {Baker's yeast (Saccharomyce | 99.53 | |
| d1yfqa_ | 342 | Cell cycle arrest protein BUB3 {Baker's yeast (Sac | 99.51 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 99.49 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 99.45 | |
| d2ovrb2 | 342 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 99.44 | |
| d1p22a2 | 293 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 99.44 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 99.44 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 99.42 | |
| d1p22a2 | 293 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 99.4 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 99.38 | |
| d1pgua2 | 287 | Actin interacting protein 1 {Baker's yeast (Saccha | 99.38 | |
| d1yfqa_ | 342 | Cell cycle arrest protein BUB3 {Baker's yeast (Sac | 99.37 | |
| d1k32a3 | 360 | Tricorn protease domain 2 {Archaeon Thermoplasma a | 99.28 | |
| d1k32a3 | 360 | Tricorn protease domain 2 {Archaeon Thermoplasma a | 99.16 | |
| d1qksa2 | 432 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 99.14 | |
| d1hzua2 | 426 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 99.12 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 99.03 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 99.01 | |
| d1l0qa2 | 301 | Surface layer protein {Archaeon Methanosarcina maz | 98.98 | |
| d1hzua2 | 426 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 98.97 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 98.93 | |
| d1pbyb_ | 337 | Quinohemoprotein amine dehydrogenase B chain {Para | 98.9 | |
| d1ri6a_ | 333 | Putative isomerase YbhE {Escherichia coli [TaxId: | 98.89 | |
| d1qksa2 | 432 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 98.87 | |
| d1jmxb_ | 346 | Quinohemoprotein amine dehydrogenase B chain {Pseu | 98.72 | |
| d1pbyb_ | 337 | Quinohemoprotein amine dehydrogenase B chain {Para | 98.59 | |
| d1ri6a_ | 333 | Putative isomerase YbhE {Escherichia coli [TaxId: | 98.56 | |
| d1l0qa2 | 301 | Surface layer protein {Archaeon Methanosarcina maz | 98.55 | |
| d2bgra1 | 470 | Dipeptidyl peptidase IV/CD26, N-terminal domain {P | 98.54 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 98.41 | |
| d1jmxb_ | 346 | Quinohemoprotein amine dehydrogenase B chain {Pseu | 98.35 | |
| d2madh_ | 373 | Methylamine dehydrogenase, H-chain {Gram negative | 98.07 | |
| d2madh_ | 373 | Methylamine dehydrogenase, H-chain {Gram negative | 98.02 | |
| d2bbkh_ | 355 | Methylamine dehydrogenase, H-chain {Paracoccus den | 98.0 | |
| d2bgra1 | 470 | Dipeptidyl peptidase IV/CD26, N-terminal domain {P | 97.94 | |
| d2bbkh_ | 355 | Methylamine dehydrogenase, H-chain {Paracoccus den | 97.72 | |
| d1mdah_ | 368 | Methylamine dehydrogenase, H-chain {Paracoccus den | 97.54 | |
| d1qnia2 | 441 | Nitrous oxide reductase, N-terminal domain {Pseudo | 97.48 | |
| d2p4oa1 | 302 | Hypothetical protein All0351 homologue {Nostoc pun | 97.34 | |
| d1rwia_ | 260 | Serine/threonine-protein kinase PknD {Mycobacteriu | 97.18 | |
| d1q7fa_ | 279 | Brain tumor cg10719-pa {Fruit fly (Drosophila mela | 97.11 | |
| d1pjxa_ | 314 | Diisopropylfluorophosphatase (phosphotriesterase, | 97.01 | |
| d1mdah_ | 368 | Methylamine dehydrogenase, H-chain {Paracoccus den | 96.99 | |
| d1jofa_ | 365 | 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu | 96.78 | |
| d1rwia_ | 260 | Serine/threonine-protein kinase PknD {Mycobacteriu | 96.73 | |
| d1qnia2 | 441 | Nitrous oxide reductase, N-terminal domain {Pseudo | 96.69 | |
| d1jofa_ | 365 | 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu | 96.44 | |
| d2p4oa1 | 302 | Hypothetical protein All0351 homologue {Nostoc pun | 96.42 | |
| d1xfda1 | 465 | Dipeptidyl aminopeptidase-like protein 6, DPP6, N- | 96.14 | |
| d2dg1a1 | 319 | Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 | 96.12 | |
| d1q7fa_ | 279 | Brain tumor cg10719-pa {Fruit fly (Drosophila mela | 95.95 | |
| d2hqsa1 | 269 | TolB, C-terminal domain {Escherichia coli [TaxId: | 95.54 | |
| d1k32a2 | 281 | Tricorn protease N-terminal domain {Archaeon Therm | 95.23 | |
| d2ghsa1 | 295 | Regucalcin {Agrobacterium tumefaciens [TaxId: 358] | 94.77 | |
| d2cs3a1 | 80 | Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ | 94.69 | |
| d1weoa_ | 93 | Cellulose synthase A catalytic subunit 7, IRX3 {Th | 94.6 | |
| d2dg1a1 | 319 | Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 | 94.47 | |
| d2hqsa1 | 269 | TolB, C-terminal domain {Escherichia coli [TaxId: | 93.54 | |
| d1npea_ | 263 | Nidogen {Mouse (Mus musculus) [TaxId: 10090]} | 92.48 | |
| d1pjxa_ | 314 | Diisopropylfluorophosphatase (phosphotriesterase, | 92.43 | |
| d1xfda1 | 465 | Dipeptidyl aminopeptidase-like protein 6, DPP6, N- | 90.24 | |
| d1wila_ | 89 | Hypothetical protein KIAA1045 {Human (Homo sapiens | 89.72 | |
| d2ghsa1 | 295 | Regucalcin {Agrobacterium tumefaciens [TaxId: 358] | 88.62 | |
| d1crua_ | 450 | Soluble quinoprotein glucose dehydrogenase {Acinet | 88.14 | |
| d1ijqa1 | 266 | Low density lipoprotein (LDL) receptor {Human (Hom | 87.68 | |
| d2jnea1 | 71 | Hypothetical protein YfgJ {Escherichia coli [TaxId | 87.21 | |
| d1npea_ | 263 | Nidogen {Mouse (Mus musculus) [TaxId: 10090]} | 86.73 | |
| d1y02a2 | 51 | Rififylin (FYVE-RING finger protein Sakura) {Human | 83.58 | |
| d2fiya1 | 290 | FdhE homolog PA4809 {Pseudomonas aeruginosa [TaxId | 82.81 | |
| d1qfma1 | 430 | Prolyl oligopeptidase, N-terminal domain {Pig (Sus | 82.45 | |
| d1ijqa1 | 266 | Low density lipoprotein (LDL) receptor {Human (Hom | 82.34 | |
| d2epqa1 | 32 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 80.05 |
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: 7-bladed beta-propeller superfamily: WD40 repeat-like family: WD40-repeat domain: beta1-subunit of the signal-transducing G protein heterotrimer species: Cow (Bos taurus) [TaxId: 9913]
Probab=99.82 E-value=5.8e-20 Score=175.23 Aligned_cols=141 Identities=14% Similarity=0.152 Sum_probs=122.2
Q ss_pred cccCcccchhhHHhhhhhhhcccCceEEEEeeccccccCCCcEEEEEEccCCCEEEEEeCCCcEEEEEccccccCCCCcC
Q 048199 337 HREGYNAGLADFQSVLTTFTRYSRLRVIAELRHGDIFHSANIVSSIEFDRDDQLFATAGVSRRIKVFDFASVVNEPADVH 416 (495)
Q Consensus 337 ~~~~~~~g~~d~~~~lw~~~~~~~~~~~~~~~~~~~~~h~~~V~~l~~~p~~~~l~s~s~d~~i~vwd~~~~~~~~~~~~ 416 (495)
....+++|..|..+++|++. ....+..+. +|.+.|++++|+|++++|++|+.|++|++||+...
T Consensus 195 ~~~~~~~~~~d~~v~i~d~~---~~~~~~~~~-----~h~~~i~~v~~~p~~~~l~s~s~d~~i~~~~~~~~-------- 258 (340)
T d1tbga_ 195 DTRLFVSGACDASAKLWDVR---EGMCRQTFT-----GHESDINAICFFPNGNAFATGSDDATCRLFDLRAD-------- 258 (340)
T ss_dssp TSSEEEEEETTTEEEEEETT---TTEEEEEEC-----CCSSCEEEEEECTTSSEEEEEETTSCEEEEETTTT--------
T ss_pred ccceeEEeecCceEEEEECC---CCcEEEEEe-----CCCCCeEEEEECCCCCEEEEEeCCCeEEEEeeccc--------
Confidence 34456778889999999984 345555555 89999999999999999999999999999999876
Q ss_pred CCee---ecCCCCCeEEEEEcCCCCCEEEEecCCCcEEEEeCCCCcceeecccccCcEEEEEeecCCCCeEEEeeCCCcE
Q 048199 417 CPVV---EMPTRSKLSCLSWNKFSKNRIASSDYEGIVTVWDVTTQQSVMEYEEHEKRAWSVDFSRTEPSMLVSGSDDCKV 493 (495)
Q Consensus 417 ~~~~---~~~~~~~i~~~~~~p~~~~~l~sg~~dg~v~iwd~~~~~~~~~~~~h~~~v~~v~~~~~~g~~l~s~s~D~~v 493 (495)
.... ...+...+.+++|+|+ +.+|++|+.||.|+|||+.++..+..+.+|.++|++++|+| ++.+|+|||.||+|
T Consensus 259 ~~~~~~~~~~~~~~i~~~~~s~~-~~~l~~g~~dg~i~iwd~~~~~~~~~~~~H~~~V~~l~~s~-d~~~l~s~s~Dg~v 336 (340)
T d1tbga_ 259 QELMTYSHDNIICGITSVSFSKS-GRLLLAGYDDFNCNVWDALKADRAGVLAGHDNRVSCLGVTD-DGMAVATGSWDSFL 336 (340)
T ss_dssp EEEEEECCTTCCSCEEEEEECSS-SCEEEEEETTSCEEEEETTTCCEEEEECCCSSCEEEEEECT-TSSCEEEEETTSCE
T ss_pred ccccccccccccCceEEEEECCC-CCEEEEEECCCEEEEEECCCCcEEEEEcCCCCCEEEEEEeC-CCCEEEEEccCCEE
Confidence 2222 2245567999999999 89999999999999999999999999999999999999999 99999999999999
Q ss_pred eC
Q 048199 494 LY 495 (495)
Q Consensus 494 ~l 495 (495)
+|
T Consensus 337 ~i 338 (340)
T d1tbga_ 337 KI 338 (340)
T ss_dssp EE
T ss_pred EE
Confidence 85
|
| >d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} | Back information, alignment and structure |
|---|
| >d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} | Back information, alignment and structure |
|---|
| >d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} | Back information, alignment and structure |
|---|
| >d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} | Back information, alignment and structure |
|---|
| >d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} | Back information, alignment and structure |
|---|
| >d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} | Back information, alignment and structure |
|---|
| >d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} | Back information, alignment and structure |
|---|
| >d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} | Back information, alignment and structure |
|---|
| >d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} | Back information, alignment and structure |
|---|
| >d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} | Back information, alignment and structure |
|---|
| >d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} | Back information, alignment and structure |
|---|
| >d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} | Back information, alignment and structure |
|---|
| >d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} | Back information, alignment and structure |
|---|
| >d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jnea1 g.41.18.1 (A:1-71) Hypothetical protein YfgJ {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1y02a2 g.50.1.1 (A:20-70) Rififylin (FYVE-RING finger protein Sakura) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fiya1 e.59.1.1 (A:19-308) FdhE homolog PA4809 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|