Citrus Sinensis ID: 048224

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220
MYGEGKWHQVPLRAGLNRCRKSCRLRWLNYLKPNIKRGEFVADEIDLMIRLHKLLGNRQEHMWSLIAARLPGRTSNDKLKPEAPKIAKHNVIKPRPRTFCKDLTWLRPKVTVLENVQVQLKDNISNKLPSPITVDQAALENDDIKRWETLLEEKVDDGGSTYCSTSGEHNISLGDGGSAYCSEHNTSLCAASEAGCYNAGEVGQCQWSDISFDADLWNIL
cccccccccHHHHHHHHHccccHHHHHccccccccccccccHHHHHHHHHHHHHHcccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccccccccccHHcccHccccccHEEHHHccccccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHccccccHHHHHHHHHHHcHHHHHHHHHHHccccccccccccHHHHccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccc
mygegkwhqvplraglnrcrKSCRLRWLNylkpnikrgefvADEIDLMIRLHKLLGNRQEHMWSLIAarlpgrtsndklkpeapkiakhnvikprprtfckdltwlrpkvTVLENVQVQLKDnisnklpspitvdqaaleNDDIKRWETLLEEKvddggstycstsgehnislgdggsaycsehntslcaaseagcynagevgqcqwsdisfDADLWNIL
mygegkwhqvplraglnrcrksCRLRWLnylkpnikrgefvaDEIDLMIRLHKLLGNRQEHMWSLIAArlpgrtsndklkpeapkiakhnvikprprtfckdltwlrpKVTVLENVQVQLkdnisnklpspitvdqaalenDDIKRWETLLEEKVDDGGSTYCSTSGEHNISLGDGGSAYCSEHNTSLCAASEAGCYNAGEVGQCQWSDISFDADLWNIL
MYGEGKWHQVPLRAGLNRCRKSCRLRWLNYLKPNIKRGEFVADEIDLMIRLHKLLGNRQEHMWSLIAARLPGRTSNDKLKPEAPKIAKHNVIKPRPRTFCKDLTWLRPKVTVLENVQVQLKDNISNKLPSPITVDQAALENDDIKRWETLLEEKVDDGGSTYCSTSGEHNISLGDGGSAYCSEHNTSLCAASEAGCYNAGEVGQCQWSDISFDADLWNIL
******WHQVPLRAGLNRCRKSCRLRWLNYLKPNIKRGEFVADEIDLMIRLHKLLGNRQEHMWSLIAARL******************HNVIKPRPRTFCKDLTWLRPKVTVLENVQVQLKDNISNKLPSPITVDQAALENDDIKRWETLLEEKVDDGGSTYCSTSGEHNISLGDGGSAYCSEHNTSLCAASEAGCYNAGEVGQCQWSDISFDADLWNI*
MYGEGKWHQVPLRAGLNRCRKSCRLRWLNYLKPNIKRGEFVADEIDLMIRLHKLLGNRQEHMWSLIAARLPGRTSNDKLKPEAPKIAKHN**********************************************************************************LGDGGSAYCSEHNTSLCAA******************ISFDADLWNIL
MYGEGKWHQVPLRAGLNRCRKSCRLRWLNYLKPNIKRGEFVADEIDLMIRLHKLLGNRQEHMWSLIAARLPGRTSNDKLKPEAPKIAKHNVIKPRPRTFCKDLTWLRPKVTVLENVQVQLKDNISNKLPSPITVDQAALENDDIKRWETLLEEKVDDGGSTYCSTSGEHNISLGDGGSAYCSEHNTSLCAASEAGCYNAGEVGQCQWSDISFDADLWNIL
****GKWHQVPLRAGLNRCRKSCRLRWLNYLKPNIKRGEFVADEIDLMIRLHKLLGNRQEHMWSLIAARLPGRTSNDKLKPEAPKIAKHNVIKPRPRTFCKDLTWLRPKVTV*E************************************************************************************************SFDADLWNIL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYGEGKWHQVPLRAGLNRCRKSCRLRWLNYLKPNIKRGEFVADEIDLMIRLHKLLGNRQEHMWSLIAARLPGRTSNDKLKPEAPKIAKHNVIKPRPRTFCKDLTWLRPKVTVLENVQVQLKDNISNKLPSPITVDQAALENDDIKRWETLLEEKVDDGGSTYCSTSGEHNISLGDGGSAYCSEHNTSLCAASEAGCYNAGEVGQCQWSDISFDADLWNIL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query220 2.2.26 [Sep-21-2011]
Q9FNV9246 Transcription factor MYB1 yes no 0.663 0.593 0.474 3e-32
Q9ZTC3249 Transcription factor MYB9 no no 0.763 0.674 0.430 3e-27
Q9FE25248 Transcription factor MYB7 no no 0.422 0.375 0.588 3e-27
Q9FNV8139 Transcription factor MYB1 no no 0.327 0.517 0.828 7e-26
P10290273 Anthocyanin regulatory C1 N/A no 0.327 0.263 0.697 2e-24
Q38850249 Transcription repressor M no no 0.322 0.285 0.64 1e-22
Q9FJA2258 Transcription factor TT2 no no 0.663 0.565 0.417 4e-22
P20025255 Myb-related protein Zm38 N/A no 0.327 0.282 0.644 5e-22
Q9SEI0203 Transcription factor WER no no 0.322 0.349 0.626 5e-22
Q96276219 Transcription factor MYB2 no no 0.322 0.324 0.613 2e-21
>sp|Q9FNV9|MY113_ARATH Transcription factor MYB113 OS=Arabidopsis thaliana GN=MYB113 PE=1 SV=1 Back     alignment and function desciption
 Score =  138 bits (347), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 92/194 (47%), Positives = 110/194 (56%), Gaps = 48/194 (24%)

Query: 2   YGEGKWHQVPLRAGLNRCRKSCRLRWLNYLKPNIKRGEFVADEIDLMIRLHKLLGNRQEH 61
           YGEGKWH+VPLR GLNRCRKSCRLRWLNYLKP+IKRG+  +DE+DL++RLHKLLGNR   
Sbjct: 28  YGEGKWHRVPLRTGLNRCRKSCRLRWLNYLKPSIKRGKLCSDEVDLVLRLHKLLGNR--- 84

Query: 62  MWSLIAARLPGRTSND------------------KLKPEAPKIAKH--------NVIKPR 95
            WSLIA RLPGRT+ND                  K K     I  H        +V+KPR
Sbjct: 85  -WSLIAGRLPGRTANDVKNYWNTHLSKKHDERCCKTKMINKNITSHPTSSAQKIDVLKPR 143

Query: 96  PRTF-----CKDLTWLRPKVTVLENVQVQLKDNISNKLPSPITVDQ---------AALEN 141
           PR+F     C D+  L PKV V   V + L  N +    S IT ++           L +
Sbjct: 144 PRSFSDKNSCNDVNIL-PKVDV---VPLHLGLNNNYVCESSITCNKDEQKDKLININLLD 199

Query: 142 DDIKRWETLLEEKV 155
            D   WE+LLE  V
Sbjct: 200 GDNMWWESLLEADV 213
Transcription activator, when associated with BHLH002/EGL3/MYC146, BHLH012/MYC1, or BHLH042/TT8.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9ZTC3|MYB90_ARATH Transcription factor MYB90 OS=Arabidopsis thaliana GN=MYB90 PE=1 SV=1 Back     alignment and function description
>sp|Q9FE25|MYB75_ARATH Transcription factor MYB75 OS=Arabidopsis thaliana GN=MYB75 PE=1 SV=1 Back     alignment and function description
>sp|Q9FNV8|MY114_ARATH Transcription factor MYB114 OS=Arabidopsis thaliana GN=MYB114 PE=1 SV=1 Back     alignment and function description
>sp|P10290|MYBC_MAIZE Anthocyanin regulatory C1 protein OS=Zea mays GN=C1 PE=2 SV=1 Back     alignment and function description
>sp|Q38850|MYB5_ARATH Transcription repressor MYB5 OS=Arabidopsis thaliana GN=MYB5 PE=1 SV=1 Back     alignment and function description
>sp|Q9FJA2|TT2_ARATH Transcription factor TT2 OS=Arabidopsis thaliana GN=TT2 PE=1 SV=1 Back     alignment and function description
>sp|P20025|MYB38_MAIZE Myb-related protein Zm38 OS=Zea mays PE=2 SV=1 Back     alignment and function description
>sp|Q9SEI0|WER_ARATH Transcription factor WER OS=Arabidopsis thaliana GN=WER PE=1 SV=1 Back     alignment and function description
>sp|Q96276|MYB23_ARATH Transcription factor MYB23 OS=Arabidopsis thaliana GN=MYB23 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query220
224069390271 predicted protein [Populus trichocarpa] 0.959 0.778 0.459 1e-46
224069398272 predicted protein [Populus trichocarpa] 0.927 0.75 0.461 2e-44
225453171240 PREDICTED: transcription factor MYB113 [ 0.904 0.829 0.478 9e-43
295486058247 MYB1 [Morella rubra] 0.904 0.805 0.451 2e-42
225453169243 PREDICTED: transcription factor MYB113 [ 0.9 0.814 0.453 5e-41
377655436262 Myb transcription factor [Citrus sinensi 0.945 0.793 0.418 1e-40
295486060247 MYB2 [Morella rubra] 0.7 0.623 0.508 3e-38
359474656 389 PREDICTED: transcription factor MYB113 [ 0.718 0.406 0.507 5e-37
221271543250 myb-related transcription factor [Vitis 0.877 0.772 0.447 5e-37
47232542250 myb-related transcription factor VvMYBA1 0.877 0.772 0.447 5e-37
>gi|224069390|ref|XP_002302971.1| predicted protein [Populus trichocarpa] gi|222844697|gb|EEE82244.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  192 bits (487), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 113/246 (45%), Positives = 144/246 (58%), Gaps = 35/246 (14%)

Query: 2   YGEGKWHQVPLRAGLNRCRKSCRLRWLNYLKPNIKRGEFVADEIDLMIRLHKLLGNRQEH 61
           YGEG+W Q+PL+AGLNRCRKSCR+RWLNYLKPN+ RG+F   E+DL+IRLHKLLGNRQ  
Sbjct: 27  YGEGRWCQIPLQAGLNRCRKSCRMRWLNYLKPNVNRGQFSVGEVDLIIRLHKLLGNRQVK 86

Query: 62  MWSLIAARLPGRTSND--------------------KLKPEAPKIAKHNVIKPRPRTFCK 101
           MWSLIA RLPGRT+ND                    + +PE   I K N+IKPRPR F K
Sbjct: 87  MWSLIAGRLPGRTANDVKNYWNTNLRKKVVSSTREAQTEPEPKAITKDNIIKPRPRNF-K 145

Query: 102 DLTWLRP-KVTVLENVQVQLKDNISNKLPSPITVDQAALENDDIKR--WETLLEEKVDDG 158
           +L WLR  K T   NV  Q  D++        T+     + D+++R  WE+LL    DD 
Sbjct: 146 NLCWLRAGKGTPFINVGSQYGDDLCKPYS---TIAFPPSDTDEVERMWWESLL----DDK 198

Query: 159 GSTYCSTSGEHNISLGDGGSAYCSEHNTSLCAASEAGCYNAGEV----GQCQWSDISFDA 214
                + +   N  LG G +A     N+    A+  G    G+V    GQ +W DISFDA
Sbjct: 199 EINLTNRNSCQNSCLGSGSTANQEPINSLFVEANPPGGIMIGDVFSDQGQNRWGDISFDA 258

Query: 215 DLWNIL 220
           DLW+++
Sbjct: 259 DLWSLI 264

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224069398|ref|XP_002302972.1| predicted protein [Populus trichocarpa] gi|222844698|gb|EEE82245.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225453171|ref|XP_002275022.1| PREDICTED: transcription factor MYB113 [Vitis vinifera] gi|209922138|gb|ACI96116.1| R2R3 MYB transcription factor [Vitis vinifera] gi|296087150|emb|CBI33524.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|295486058|gb|ADG21957.1| MYB1 [Morella rubra] Back     alignment and taxonomy information
>gi|225453169|ref|XP_002274992.1| PREDICTED: transcription factor MYB113 [Vitis vinifera] gi|220979400|gb|ACL97979.1| R2R3 MYB transcription factor splice variant 1 [Vitis vinifera] gi|296087151|emb|CBI33525.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|377655436|gb|AFB73909.1| Myb transcription factor [Citrus sinensis] gi|377655438|gb|AFB73910.1| Myb transcription factor [Citrus sinensis] gi|377655445|gb|AFB73913.1| Myb transcription factor [Citrus sinensis] gi|377655447|gb|AFB73914.1| Myb transcription factor [Citrus sinensis] Back     alignment and taxonomy information
>gi|295486060|gb|ADG21958.1| MYB2 [Morella rubra] Back     alignment and taxonomy information
>gi|359474656|ref|XP_003631504.1| PREDICTED: transcription factor MYB113 [Vitis vinifera] Back     alignment and taxonomy information
>gi|221271543|dbj|BAH15078.1| myb-related transcription factor [Vitis vinifera] Back     alignment and taxonomy information
>gi|47232542|dbj|BAD18977.1| myb-related transcription factor VvMYBA1 [Vitis vinifera] gi|47232552|dbj|BAD18987.1| myb-related transcription factor [Vitis vinifera] gi|47232554|dbj|BAD18980.1| myb-related transcription factor [Vitis vinifera] gi|82623180|gb|ABB87018.1| transcription factor MybA [Vitis vinifera] gi|109659802|dbj|BAE96747.1| myb-related transcription factor [Vitis vinifera] gi|109659806|dbj|BAE96750.1| myb-related transcription factor [Vitis vinifera] gi|118772089|gb|ABL14064.1| R2R3 MYB transcription factor [Vitis vinifera] gi|296088406|emb|CBI37397.3| unnamed protein product [Vitis vinifera] gi|408905249|gb|AFU97146.1| myb-related transcription factor [Vitis vinifera] gi|408905251|gb|AFU97147.1| myb-related transcription factor [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query220
TAIR|locus:2201532249 MYB90 "myb domain protein 90" 0.327 0.289 0.815 7.2e-36
TAIR|locus:2201507246 MYB113 "myb domain protein 113 0.327 0.292 0.789 3.9e-35
TAIR|locus:2201517139 MYB114 "myb domain protein 114 0.504 0.798 0.598 3.7e-32
TAIR|locus:2027523248 PAP1 "production of anthocyani 0.554 0.491 0.537 8.8e-31
TAIR|locus:2115708324 MYB74 "myb domain protein 74" 0.331 0.225 0.558 6.2e-24
TAIR|locus:2169538258 TT2 "TRANSPARENT TESTA 2" [Ara 0.677 0.577 0.418 1.4e-23
TAIR|locus:2062040 371 MYB12 "myb domain protein 12" 0.322 0.191 0.56 1.4e-23
TAIR|locus:2023951 365 MYB93 "myb domain protein 93" 0.327 0.197 0.539 1.7e-23
TAIR|locus:2086233285 MYB15 "myb domain protein 15" 0.327 0.252 0.592 2.1e-23
TAIR|locus:2092820249 MYB5 "myb domain protein 5" [A 0.322 0.285 0.64 2.3e-23
TAIR|locus:2201532 MYB90 "myb domain protein 90" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 337 (123.7 bits), Expect = 7.2e-36, Sum P(2) = 7.2e-36
 Identities = 62/76 (81%), Positives = 67/76 (88%)

Query:     2 YGEGKWHQVPLRAGLNRCRKSCRLRWLNYLKPNIKRGEFVADEIDLMIRLHKLLGNRQEH 61
             YGEGKWHQVPLRAGLNRCRKSCRLRWLNYLKP+IKRG    DE+DL++RLHKLLGNR   
Sbjct:    28 YGEGKWHQVPLRAGLNRCRKSCRLRWLNYLKPSIKRGRLSNDEVDLLLRLHKLLGNR--- 84

Query:    62 MWSLIAARLPGRTSND 77
              WSLIA RLPGRT+ND
Sbjct:    85 -WSLIAGRLPGRTAND 99
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
GO:0005515 "protein binding" evidence=IPI
GO:0080167 "response to karrikin" evidence=IEP
GO:0001708 "cell fate specification" evidence=RCA
GO:0009686 "gibberellin biosynthetic process" evidence=RCA
GO:0009740 "gibberellic acid mediated signaling pathway" evidence=RCA
GO:0009913 "epidermal cell differentiation" evidence=RCA
TAIR|locus:2201507 MYB113 "myb domain protein 113" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201517 MYB114 "myb domain protein 114" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2027523 PAP1 "production of anthocyanin pigment 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2115708 MYB74 "myb domain protein 74" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2169538 TT2 "TRANSPARENT TESTA 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2062040 MYB12 "myb domain protein 12" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2023951 MYB93 "myb domain protein 93" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086233 MYB15 "myb domain protein 15" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2092820 MYB5 "myb domain protein 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query220
PLN03212249 PLN03212, PLN03212, Transcription repressor MYB5; 1e-28
PLN03091 459 PLN03091, PLN03091, hypothetical protein; Provisio 1e-26
COG5147 512 COG5147, REB1, Myb superfamily proteins, including 1e-06
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 4e-06
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 8e-05
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 3e-04
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 0.001
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 0.003
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 0.003
>gnl|CDD|178751 PLN03212, PLN03212, Transcription repressor MYB5; Provisional Back     alignment and domain information 
 Score =  107 bits (269), Expect = 1e-28
 Identities = 48/75 (64%), Positives = 60/75 (80%), Gaps = 4/75 (5%)

Query: 3   GEGKWHQVPLRAGLNRCRKSCRLRWLNYLKPNIKRGEFVADEIDLMIRLHKLLGNRQEHM 62
           GEG+W  +P RAGL RC KSCRLRW+NYL+P++KRG   +DE DL++RLH+LLGNR    
Sbjct: 44  GEGRWRSLPKRAGLLRCGKSCRLRWMNYLRPSVKRGGITSDEEDLILRLHRLLGNR---- 99

Query: 63  WSLIAARLPGRTSND 77
           WSLIA R+PGRT N+
Sbjct: 100 WSLIAGRIPGRTDNE 114

Length = 249
>gnl|CDD|215570 PLN03091, PLN03091, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227476 COG5147, REB1, Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 220
KOG0048238 consensus Transcription factor, Myb superfamily [T 99.95
PLN03212249 Transcription repressor MYB5; Provisional 99.92
PLN03091 459 hypothetical protein; Provisional 99.9
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.37
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.26
COG5147 512 REB1 Myb superfamily proteins, including transcrip 99.2
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 99.14
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.1
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.03
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 98.83
PLN03212249 Transcription repressor MYB5; Provisional 98.82
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 98.8
KOG0048238 consensus Transcription factor, Myb superfamily [T 98.63
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 98.62
KOG0051607 consensus RNA polymerase I termination factor, Myb 98.58
PLN03091 459 hypothetical protein; Provisional 98.58
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 98.38
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 97.78
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 97.68
COG5147512 REB1 Myb superfamily proteins, including transcrip 97.33
KOG0051607 consensus RNA polymerase I termination factor, Myb 97.25
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 95.53
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 94.9
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 93.31
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 93.2
KOG1279506 consensus Chromatin remodeling factor subunit and 93.12
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 92.09
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 90.84
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 90.38
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 90.24
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 87.52
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 83.85
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 81.05
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 80.66
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information 
Probab=99.95  E-value=2e-28  Score=214.12  Aligned_cols=81  Identities=57%  Similarity=1.020  Sum_probs=76.2

Q ss_pred             CCCCCccccHhhhcCCCCCHHHHHHHHHhccCCCCCCCCCCHHHHHHHHHHHHHhCCCCchhhHHHhccCCCCCCCCccc
Q 048224            1 MYGEGKWHQVPLRAGLNRCRKSCRLRWLNYLKPNIKRGEFVADEIDLMIRLHKLLGNRQEHMWSLIAARLPGRTSNDKLK   80 (220)
Q Consensus         1 kyG~~~W~~Ia~~~~l~R~~kqCr~RW~n~L~P~i~rg~WT~eED~~Ll~lv~~~G~~~~~~Ws~IA~~lpgRT~n~~~k   80 (220)
                      +||+++|..||+.++++||+||||+||.|||+|+|+||.||+|||.+|++||.+||++    |++||++|||||||++ |
T Consensus        26 ~~G~~~W~~i~k~~gl~R~GKSCRlRW~NyLrP~ikrg~fT~eEe~~Ii~lH~~~GNr----Ws~IA~~LPGRTDNeI-K  100 (238)
T KOG0048|consen   26 SFGKHNGTALPKLAGLRRCGKSCRLRWTNYLRPDLKRGNFSDEEEDLIIKLHALLGNR----WSLIAGRLPGRTDNEV-K  100 (238)
T ss_pred             HhCCCCcchhhhhcCCCccchHHHHHhhcccCCCccCCCCCHHHHHHHHHHHHHHCcH----HHHHHhhCCCcCHHHH-H
Confidence            5999999999999999999999999999999999999999999999999999999999    9999999999999987 4


Q ss_pred             chhhhh
Q 048224           81 PEAPKI   86 (220)
Q Consensus        81 ~~~~~~   86 (220)
                      ++|...
T Consensus       101 N~Wnt~  106 (238)
T KOG0048|consen  101 NHWNTH  106 (238)
T ss_pred             HHHHHH
Confidence            444443

>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query220
1a5j_A110 Chicken B-Myb Dna Binding Domain, Repeat 2 And Repe 5e-08
1h8a_C128 Crystal Structure Of Ternary Protein-Dna Complex3 L 1e-07
1h88_C159 Crystal Structure Of Ternary Protein-Dna Complex1 L 1e-07
1gv2_A105 Crystal Structure Of C-Myb R2r3 Length = 105 2e-07
1mse_C105 Solution Structure Of A Specific Dna Complex Of The 2e-07
3zqc_A131 Structure Of The Trichomonas Vaginalis Myb3 Dna-Bin 9e-06
3osf_A126 The Structure Of Protozoan Parasite Trichomonas Vag 7e-05
>pdb|1A5J|A Chain A, Chicken B-Myb Dna Binding Domain, Repeat 2 And Repeat3, Nmr, 32 Structures Length = 110 Back     alignment and structure 
Iteration: 1

 Score = 54.3 bits (129), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 41/75 (54%), Gaps = 5/75 (6%)
Query: 2  YGEGKWHQVPLRAGLNRCRKSCRLRWLNYLKPNIKRGEFVADEIDLMIRLHKLLGNRQEH 61
          YG  +W  +  +    R  K CR RW N+L P +K+  +  +E  ++   HK+LGNR   
Sbjct: 25 YGTKQWTLIA-KHLKGRLGKQCRERWHNHLNPEVKKSSWTEEEDRIIFEAHKVLGNR--- 80
Query: 62 MWSLIAARLPGRTSN 76
           W+ IA  LPGRT N
Sbjct: 81 -WAEIAKLLPGRTDN 94
>pdb|1H8A|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex3 Length = 128 Back     alignment and structure
>pdb|1H88|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex1 Length = 159 Back     alignment and structure
>pdb|1GV2|A Chain A, Crystal Structure Of C-Myb R2r3 Length = 105 Back     alignment and structure
>pdb|1MSE|C Chain C, Solution Structure Of A Specific Dna Complex Of The Myb Dna- Binding Domain With Cooperative Recognition Helices Length = 105 Back     alignment and structure
>pdb|3ZQC|A Chain A, Structure Of The Trichomonas Vaginalis Myb3 Dna-Binding Domain Bound To A Promoter Sequence Reveals A Unique C- Terminal Beta-Hairpin Conformation Length = 131 Back     alignment and structure
>pdb|3OSF|A Chain A, The Structure Of Protozoan Parasite Trichomonas Vaginalis Myb2 In Complex With Mre-2f-13 Dna Length = 126 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query220
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 8e-30
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 4e-29
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 4e-28
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 1e-13
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 1e-24
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 3e-24
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 1e-22
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 6e-16
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 5e-11
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 3e-09
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 3e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 2e-04
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Length = 131 Back     alignment and structure
 Score =  106 bits (267), Expect = 8e-30
 Identities = 25/76 (32%), Positives = 39/76 (51%), Gaps = 5/76 (6%)

Query: 2  YGEGKWHQVPLRAGLNRCRKSCRLRWLNYLKPNIKRGEFVADEIDLMIRLHKLLGNRQEH 61
           G   W ++      NR  K CR RW N+L P + +  +  +E + + R +  LG++   
Sbjct: 20 NGPQNWPRITSFLP-NRSPKQCRERWFNHLDPAVVKHAWTPEEDETIFRNYLKLGSK--- 75

Query: 62 MWSLIAARLPGRTSND 77
           WS+IA  +PGRT N 
Sbjct: 76 -WSVIAKLIPGRTDNA 90
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Length = 105 Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Length = 107 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Length = 126 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Length = 52 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query220
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.93
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.92
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.92
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.91
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.91
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.88
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.87
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.81
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.63
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.59
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.52
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.49
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.42
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.39
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.38
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.37
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.35
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.34
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 99.01
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.31
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.29
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.27
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.27
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.24
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.24
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.19
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.13
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.09
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.08
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.08
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.06
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.02
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.02
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 98.98
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 98.96
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 98.95
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 98.93
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 98.91
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 98.9
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 98.9
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 98.89
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 98.88
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 98.81
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 98.81
2cjj_A93 Radialis; plant development, DNA-binding protein, 98.79
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 98.78
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 98.75
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 98.73
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 98.67
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 98.63
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 98.63
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 98.57
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 98.55
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 98.39
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.35
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 98.15
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.01
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 97.22
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 97.95
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 97.89
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 97.65
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 97.5
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 97.46
2cjj_A93 Radialis; plant development, DNA-binding protein, 97.42
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 96.44
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 97.31
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 97.29
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 97.05
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 96.69
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 96.61
2crg_A70 Metastasis associated protein MTA3; transcription 96.41
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 95.45
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 95.22
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 95.12
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 95.12
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 93.46
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 92.72
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 92.42
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 92.38
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 91.6
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 88.26
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 85.62
2xag_B 482 REST corepressor 1; amine oxidase, chromatin regul 82.74
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 80.17
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
Probab=99.93  E-value=7.5e-27  Score=180.02  Aligned_cols=84  Identities=23%  Similarity=0.425  Sum_probs=77.4

Q ss_pred             CCCCCccccHhhhcCCCCCHHHHHHHHHhccCCCCCCCCCCHHHHHHHHHHHHHhCCCCchhhHHHhccCCCCCCCCccc
Q 048224            1 MYGEGKWHQVPLRAGLNRCRKSCRLRWLNYLKPNIKRGEFVADEIDLMIRLHKLLGNRQEHMWSLIAARLPGRTSNDKLK   80 (220)
Q Consensus         1 kyG~~~W~~Ia~~~~l~R~~kqCr~RW~n~L~P~i~rg~WT~eED~~Ll~lv~~~G~~~~~~Ws~IA~~lpgRT~n~~~k   80 (220)
                      +||.++|..||..|+ +|+++|||+||.+||+|.+++++||+|||.+|+++|.+||++    |+.||++|||||++++++
T Consensus        18 ~~g~~~W~~Ia~~~~-~Rt~~qcr~Rw~~~L~p~i~~~~WT~eEd~~L~~~~~~~G~~----W~~Ia~~l~gRt~~~~k~   92 (107)
T 2k9n_A           18 RYGAKDWIRISQLMI-TRNPRQCRERWNNYINPALRTDPWSPEEDMLLDQKYAEYGPK----WNKISKFLKNRSDNNIRN   92 (107)
T ss_dssp             HHCSSCHHHHHHHTT-TSCHHHHHHHHHHHSSSCCTTCCCCHHHHHHHHHHHHHTCSC----HHHHHHHHSSSCHHHHHH
T ss_pred             HHCCCCHHHHhhhcC-CCCHHHHHHHHHHHHcccccccccCHHHHHHHHHHHHHhCcC----HHHHHHHCCCCCHHHHHH
Confidence            489899999999999 999999999999999999999999999999999999999998    999999999999998876


Q ss_pred             chhhhhhhc
Q 048224           81 PEAPKIAKH   89 (220)
Q Consensus        81 ~~~~~~~k~   89 (220)
                      ++...+.+.
T Consensus        93 rw~~l~r~~  101 (107)
T 2k9n_A           93 RWMMIARHR  101 (107)
T ss_dssp             HHHHHHHHH
T ss_pred             HHHHHHhhH
Confidence            666555443
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 220
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 3e-07
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 2e-06
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 0.003
d2ckxa183 a.4.1.3 (A:578-660) Telomere binding protein TBP1 2e-06
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 3e-06
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 2e-05
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 4e-05
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 4e-04
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 4e-05
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 4e-05
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 0.003
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: c-Myb, DNA-binding domain
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 44.0 bits (104), Expect = 3e-07
 Identities = 9/32 (28%), Positives = 11/32 (34%), Gaps = 1/32 (3%)

Query: 2  YGEGKWHQVPLRAGLNRCRKSCRLRWLNYLKP 33
           G   W  +      NR    C+ RW   L P
Sbjct: 19 NGTDDWKVIANYLP-NRTDVQCQHRWQKVLNP 49
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 83 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query220
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.49
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.44
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.4
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.3
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.18
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.16
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.16
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.15
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.14
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.12
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.11
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.1
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.05
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.01
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 98.78
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 98.77
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 98.76
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 98.74
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 98.73
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 98.69
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 98.38
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 98.31
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 98.24
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 98.06
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 97.87
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 97.44
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 97.42
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 97.27
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 97.23
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 96.05
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 95.42
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 95.4
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 90.73
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 90.66
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 88.61
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: c-Myb, DNA-binding domain
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.49  E-value=4.8e-15  Score=97.66  Aligned_cols=46  Identities=35%  Similarity=0.567  Sum_probs=41.6

Q ss_pred             CCCCCHHHHHHHHHHHHHhCCCCchhhHHHhccCCCCCCCCcccchhhhh
Q 048224           37 RGEFVADEIDLMIRLHKLLGNRQEHMWSLIAARLPGRTSNDKLKPEAPKI   86 (220)
Q Consensus        37 rg~WT~eED~~Ll~lv~~~G~~~~~~Ws~IA~~lpgRT~n~~~k~~~~~~   86 (220)
                      |++||+|||++|+++|++||++    |+.||++|||||++++++++...+
T Consensus         1 K~~WT~eED~~L~~~v~~~G~~----W~~Ia~~~~gRt~~~~knr~~~~l   46 (47)
T d1gv2a2           1 KTSWTEEEDRIIYQAHKRLGNR----WAEIAKLLPGRTDNAIKNHWNSTM   46 (47)
T ss_dssp             CCCCCHHHHHHHHHHHHHHSSC----HHHHHTTCTTCCHHHHHHHHHHHT
T ss_pred             CCCCCHHHHHHHHHHHHHHhhH----HHHHHhHcCCCCHHHHHHHHHHHc
Confidence            5799999999999999999999    999999999999998877666543
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure