Citrus Sinensis ID: 048242

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430

MEPQNDIDDLPKNPANFTALTPLWFLERAATVHPTRKSVVYESKHYTWQQTYQRCRRLASALSQLSIGPGTAVSVLSPNVPAMYEVHFGVPMTGAVLNCINFRLNPLNVAIILGHAEAALVFVDQQYFALAEEALKIMEGKSEGLFKPPVLIVIGDETCDRAPLEYALSKGVTEYEKLLETGDPEFAWKPPRDEWQSIALGYTSGTTANPKGVLVSHRAAYLMSLNVVLTWGMKEGAVYLWTLPIFHGNGWCFTWSLAALCGTSVMLRQASAKAIYKAIAEHGVTNFCAAPIVLNSIVNAPPEDTILPLPHVVNVNTGGSPPPPPILLAMSQKGFRVTHVYGLSEINGPATVCAWNPNWDSLPFEAQARLNARQGVKCMCLEGLDVLDTKTNQPIPADGKTIGEVVMRGNMVMKGYLKNPKANEEAFANG

cccccccccccccccccccccHHHHHHHHHHHccccCEEEEccEEEEHHHHHHHHHHHHHHHHHcccccccEEEEEccccHHHHHHHHHcccccccHHcccccccHHHHHHHHHcccccEEEEccccHHHHHHHHHHHcccccccccccEEEEEcccccccccccHccccccccHHHHHcccccccccccccccccHHHcccccccccccccEEEccHHHHHHHHHHHHHcccccccEEEEcccccccccccHHHHHHHHcccccccccccHHHHHHHHHHcccccccccHHHHHHHHccccccccccccccEEEEECcccccHHHHHHHHHcccEEEEEEccccccccccccccccccccccHHHHHHHHHccccccccccCEEEEccccccccccccccccEEEEEccHHccHccccccccHHHHccc

**********PKNPANFTALTPLWFLERAATVHPTRKSVVYESKHYTWQQTYQRCRRLASALSQLSIGPGTAVSVLSPNVPAMYEVHFGVPMTGAVLNCINFRLNPLNVAIILGHAEAALVFVDQQYFALAEEALKIMEGKSEGLFKPPVLIVIGDETCDRAPLEYALSKGVTEYEKLLETGDPEFAWKPPRDEWQSIALGYTSGTTANPKGVLVSHRAAYLMSLNVVLTWGMKEGAVYLWTLPIFHGNGWCFTWSLAALCGTSVMLRQASAKAIYKAIAEHGVTNFCAAPIVLNSIVNAPPEDTILPLPHVVNVNTGGSPPPPPILLAMSQKGFRVTHVYGLSEINGPATVCAWNPNWDSLPFEAQARLNARQGVKCMCLEGLDVLDTKTNQPIPADGKTIGEVVMRGNMVMKGYLKNPKAN***FANG

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Acetate/butyrate--CoA ligase AAE7, peroxisomal	Peroxisomal acetate/butyrate--CoA ligase that is probably involved in the activation of exogenous acetate for entry into the glyoxylate cycle. May play a role to prevent carbon loss from peroxisomes during lipid mobilization. In vitro, is active with both acetate and butyrate.	probable	Q8VZF1

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3R44, chain A
Confidence level:very confident
Coverage over the Query: 16-156,172-430
View the alignment between query and template
View the model in PyMOL

Template: 3RIX, chain A
Confidence level:very confident
Coverage over the Query: 3-357,369-430
View the alignment between query and template
View the model in PyMOL

Template: 1ULT, chain A
Confidence level:confident
Coverage over the Query: 23-427
View the alignment between query and template
View the model in PyMOL