Citrus Sinensis ID: 048276

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-----

MAFTNICQYFCLVSLLVMYFWAIHALCRPIGEKLIMLKMHEQWMAQHGLVYADEAEKAETAYDFRRQYRGYKLAVNKFADLTNDEFRSMYAGYDWQNQNSPVISTSDPDASSPMDANSTVTDVPSSMDSRENGAVTPVKDQGDCNCCWAFSSVAAVEGITKIETGKLMSLSEQELVDCDTGSFDRGCTVGRMDTAFEFIKNNNGLTTEADYPFVGNDYGACKTTKDENDAAAATISGFKFVPANNEQALMQVVADQPVSVSIDSSGYMFQFYSSGIIKSEECGTDIDHGVTAIGYGASSDGTKYWLVKNSWGTGWGEGGYVRIQREVGAQEGACGIAMMASYPTV

ccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccEEccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccHHHccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccEECccEEEcccccHHHHHHHHHccccEEEECccccccccccccccccccccccccCEEEEEEEccccccccEEEEEcccccccccccEEEEEccccccccccccccccccccc

**FTNICQYFCLVSLLVMYFWAIHALCRPIGEKLIMLKMHEQWMAQHGLVYADEAEKAETAYDFRRQYRGYKLAVNKFADLTNDEFRSMYAGYD*********************ANSTVTDVPSSMDSRENGAVTPVKDQGDCNCCWAFSSVAAVEGITKIETGKLMSLSEQELVDCDTGSFDRGCTVGRMDTAFEFIKNNNGLTTEADYPFVGNDYGACKTTKDENDAAAATISGFKFVPANNEQALMQVVADQPVSVSIDSSGYMFQFYSSGIIKSEECGTDIDHGVTAIGYGASSDGTKYWLVKNSWGTGWGEGGYVRIQREVGAQEGACGIAMMASYPTV

xxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Cathepsin L1	Important for the overall degradation of proteins in lysosomes.	probable	P06797
Cathepsin L1	Important for the overall degradation of proteins in lysosomes.	probable	Q28944
Cathepsin L1	Important for the overall degradation of proteins in lysosomes.	probable	Q9GL24

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1PCI, chain A
Confidence level:very confident
Coverage over the Query: 30-345
View the alignment between query and template
View the model in PyMOL