Citrus Sinensis ID: 048299


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------46
MLGSLNNTTSSRHDQQQEEDPLAAAASSSDLMLQHHQPLHQSHHQYSSSSSSSRVGGLMNSPPAIHMRQLLISCAELFSQADFSAAHRLISILSANSSPYGDSIERLVHQFIRALSLRLNLHHANATLLMMNITTTTTATTLPYNTTTYNDRNALQSCYLSLNQITPFIRFSHLTANQAILESLQVGQQSIHILDFDIMHGVQWPPLMQALVERFKNSNMLQPPPMLRITGTGNDIEILQRTGERLLKFAQSLGLRFQFHPLLLMNDDPTSVAFYLPSALTILPDETLAVNCMLFLHKLLKDHDTRDLRLFLHKIKALNPRVVTIAEREASHNHPLFLQRFVEAVDHYGAIFDSLEATLPPNSRERLAVEQVWFGREIVEIVATEGENRKERHERFDSWEMILRSCGYSNVPLSGYALSQAKLLLRLHYPSEGYQLQVLNNSLFLGWQNRALFSVSSWH
ccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccEEEEEEccccccccccHHHHHHHHccccccccccccEEEEEcccccHHHHHHHHHHHHHHHHHccccEEEEEEcccccccccccccccccccccccccEEEEEEccccccccccccHHHHHHHHHHHcccccEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccccccEEEEEccEEEEEEcccEEEEEEccc
***************************************************************AIHMRQLLISCAELFSQADFSAAHRLISILSANSSPYGDSIERLVHQFIRALSLRLNLHHANATLLMMN**************TTYNDRNALQSCYLSLNQITPFIRFSHLTANQAILESLQVGQQSIHILDFDIMHGVQWPPLMQALVERFKNSNMLQPPPMLRITGTGNDIEILQRTGERLLKFAQSLGLRFQFHPLLLMNDDPTSVAFYLPSALTILPDETLAVNCMLFLHKLLKDHDTRDLRLFLHKIKALNPRVVTIAEREASHNHPLFLQRFVEAVDHYGAIFDSLEATLPPNSRERLAVEQVWFGREIVEIVATEGENRKERHERFDSWEMILRSCGYSNVPLSGYALSQAKLLLRLHYPSEGYQLQVLNNSLFLGWQNRALFSVSSWH
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLGSLNNTTSSRHDQQQEEDPLAAAASSSDLMLQHHQPLHQSHHQYSSSSSSSRVGGLMNSPPAIHMRQLLISCAELFSQADFSAAHRLISILSANSSPYGDSIERLVHQFIRALSLRLNLHHANATLLMMNITTTTTATTLPYNTTTYNDRNALQSCYLSLNQITPFIRFSHLTANQAILESLQVGQQSIHILDFDIMHGVQWPPLMQALVERFKNSNMLQPPPMLRITGTGNDIEILQRTGERLLKFAQSLGLRFQFHPLLLMNDDPTSVAFYLPSALTILPDETLAVNCMLFLHKLLKDHDTRDLRLFLHKIKALNPRVVTIAEREASHNHPLFLQRFVEAVDHYGAIFDSLEATLPPNSRERLAVEQVWFGREIVEIVATEGENRKERHERFDSWEMILRSCGYSNVPLSGYALSQAKLLLRLHYPSEGYQLQVLNNSLFLGWQNRALFSVSSWH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Scarecrow-like protein 18 Probable transcription factor required for axillary (lateral) shoot meristem formation during vegetative development. Seems to act upstream of REVOLUTA.probableQ9ZWC5

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2R3S, chain A
Confidence level:confident
Coverage over the Query: 178-271,282-331
View the alignment between query and template
View the model in PyMOL
Template: 3DTN, chain A
Confidence level:probable
Coverage over the Query: 178-365,377-413
View the alignment between query and template
View the model in PyMOL
Template: 2QE6, chain A
Confidence level:probable
Coverage over the Query: 159-330
View the alignment between query and template
View the model in PyMOL