Citrus Sinensis ID: 048310


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100--
MKSLVSQRQFFHSHRAQPMAWEQVVSDRDSEDEVDDDVADLEDRRMLDDFVDVTKDEKQMMHMWNSFVRKQRVLADGHIPWACEAFTKLYGHDLVQAPALKW
cccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccccccc
***LVSQRQFFHSHRAQPM**************VDDDVADLEDRRMLDDFVDVTKDEKQMMHMWNSFVRKQRVLADGHIPWACEAFTKLYGHDLVQAPALK*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKSLVSQRQFFHSHRAQPMAWEQVVSDRDSEDEVDDDVADLEDRRMLDDFVDVTKDEKQMMHMWNSFVRKQRVLADGHIPWACEAFTKLYGHDLVQAPALKW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Polycomb group protein EMBRYONIC FLOWER 2 Polycomb group (PcG) protein. Involved in flowering processes by repressing unknown target genes and preventing reproductive development. Participates in polycomb group (PcG) protein complex-mediated (probably in complex with EMF1) silencing of the flower homeotic genes AGAMOUS (AG), PISTILLATA (PI), and APETALA3 (AP3), as well as of some regulatory genes such as ABSCISIC ACID INSENSITIVE3 (ABI3), LONG VEGETATIVE PHASE1 (LOV1), and FLOWERING LOCUS C (FLC) during vegetative development, by mediating trimethylation of histone 3 lysine 27 on the AG chromatin (H3K27me3). PcG proteins act by forming multiprotein complexes, which are required to maintain the transcriptionally repressive state of homeotic genes throughout development. PcG proteins are not required to initiate repression, but to maintain it during later stages of development. They probably act via the methylation of histones, rendering chromatin heritably changed in its expressibility.probableQ8L6Y4

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1QZV, chain F
Confidence level:probable
Coverage over the Query: 90-100
View the alignment between query and template
View the model in PyMOL