Citrus Sinensis ID: 048448


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------31
MARKKDVESGNSNSSEPNVDRKNEYGNVREPLIDRKNQAKEQQNPTQFGIMADLKESYAEYSLFGSILTIGAIIGAITSGRIADWVARKGAAPLLDFGRFLAGCGIGVMSYVVPVYIAEITPKNLRAALATVNQLFIVTGALFAYVIGALMSWRILALTGLFFIPESPRWLAMIGKNQEFEVALSMVRGPNVDVSRELNEILSKRITLILQESLALINQLPRVNILDLFNRRNIRFVNVYIAFYSIGMGPIPWVIMFEIFPLNIKGPGGSLVTLVNWIGSWAISYSFILLMTWSSCGRTLEEVQASVS
cccccccccccccccccccccccccccccHHHHcccccccccccccHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHcccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHcccccHHHHHHHHHHHHHHcccccEEEEEEEcHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHcc
cccccccccccccccccccccccHHHHHHHHHHHHHcHHHccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEEEEEHHcccHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHcccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHccccHHHHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEcc
markkdvesgnsnssepnvdrkneygnvreplidrknqakeqqnptqfGIMADLKESYAEYSLFGSILTIGAIIGAITSGRIADWVArkgaaplldFGRFLAGCGIGVMSYVVPVYIAEITPKNLRAALATVNQLFIVTGALFAYVIGALMSWRILALTGlffipesprwLAMIGKNQEFEVALSmvrgpnvdvSRELNEILSKRITLILQESLALInqlprvnildlfnrrnirFVNVYIAFYsigmgpipwVIMFEifplnikgpggsLVTLVNWIGSWAISYSFILLMTWSSCGRTLEEVQASVS
markkdvesgnsnssepnvdrkneygnvreplidrknqakeqqnptQFGIMADLKESYAEYSLFGSILTIGAIIGAITSGRIADWVARKGAAPLLDFGRFLAGCGIGVMSYVVPVYIAEITPKNLRAALATVNQLFIVTGALFAYVIGALMSWRILALTGLFFIPESPRWLAMIGKNQEFEVALSMVRGPNVDVSRELNEILSKRITLILQESLALINQLPRVNILDLFNRRNIRFVNVYIAFYSIGMGPIPWVIMFEIFPLNIKGPGGSLVTLVNWIGSWAISYSFILLMTWSSCGRTLEEVQASVS
MARKKDVESGNSNSSEPNVDRKNEYGNVREPLIDRKNQAKEQQNPTQFGIMADLKESYAEYSLFgsiltigaiigaitsgriaDWVARKGAAPLLDFGRFLAGCGIGVMSYVVPVYIAEITPKNLRAALATVNQLFIVTGALFAYVIGALMSWRILALTGLFFIPESPRWLAMIGKNQEFEVALSMVRGPNVDVSRELNEILSKRITLILQESLALINQLPRVNILDLFNRRNIRFVNVYIAFYSIGMGPIPWVIMFEIFPLNIKGPGGSLVTLVNWIGSWAISYSFILLMTWSSCGRTLEEVQASVS
***********************************************FGIMADLKESYAEYSLFGSILTIGAIIGAITSGRIADWVARKGAAPLLDFGRFLAGCGIGVMSYVVPVYIAEITPKNLRAALATVNQLFIVTGALFAYVIGALMSWRILALTGLFFIPESPRWLAMIGKNQEFEVALSMVRGPNVDVSRELNEILSKRITLILQESLALINQLPRVNILDLFNRRNIRFVNVYIAFYSIGMGPIPWVIMFEIFPLNIKGPGGSLVTLVNWIGSWAISYSFILLMTWSSCGRTL********
**********************NEYGNVREPLIDRKNQAKEQQNPTQFGIMADLKESYAEYSLFGSILTIGAIIGAITSGRIADWVARKGAAPLLDFGRFLAGCGIGVMSYVVPVYIAEITPKNLRAALATVNQLFIVTGALFAYVIGALMSWRILALTGLFFIPESPRWLAMIGKNQEFEVALSMVRGPNVDVSRELNEILSKRITLILQESLALINQLPRVNILDLFNRRNIRFVNVYIAFYSIGMGPIPWVIMFEIFPLNIKGPGGSLVTLVNWIGSWAISYSFILLMTWSSCGRTLEEVQASVS
********************RKNEYGNVREPLIDRKNQAKEQQNPTQFGIMADLKESYAEYSLFGSILTIGAIIGAITSGRIADWVARKGAAPLLDFGRFLAGCGIGVMSYVVPVYIAEITPKNLRAALATVNQLFIVTGALFAYVIGALMSWRILALTGLFFIPESPRWLAMIGKNQEFEVALSMVRGPNVDVSRELNEILSKRITLILQESLALINQLPRVNILDLFNRRNIRFVNVYIAFYSIGMGPIPWVIMFEIFPLNIKGPGGSLVTLVNWIGSWAISYSFILLMTWSSCGRTL********
*******************DRKNEYGNVREPLIDRKNQAKEQQNPTQFGIMADLKESYAEYSLFGSILTIGAIIGAITSGRIADWVARKGAAPLLDFGRFLAGCGIGVMSYVVPVYIAEITPKNLRAALATVNQLFIVTGALFAYVIGALMSWRILALTGLFFIPESPRWLAMIGKNQEFEVALSMVRGPNVDVSRELNEILSKRITLILQESLALINQLPRVNILDLFNRRNIRFVNVYIAFYSIGMGPIPWVIMFEIFPLNIKGPGGSLVTLVNWIGSWAISYSFILLMTWSSCGRTLEEVQASVS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHiiHHHHHHHHHHHHHHHHHHHHHooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MARKKDVESGNSNSSEPNVDRKNEYGNVREPLIDRKNQAKEQQNPTQFGIMADLKESYAEYSLFGSILTIGAIIGAITSGRIADWVARKGAAPLLDFGRFLAGCGIGVMSYVVPVYIAEITPKNLRAALATVNQLFIVTGALFAYVIGALMSWRILALTGLFFIPESPRWLAMIGKNQEFEVALSMVRGPNVDVSRELNEILSKRITLILQESLALINQLPRVNILDLFNRRNIRFVNVYIAFYSIGMGPIPWVIMFEIFPLNIKGPGGSLVTLVNWIGSWAISYSFILLMTWSSCGRTLEEVQASVS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query308 2.2.26 [Sep-21-2011]
Q0WQ63 470 Sugar transporter ERD6-li yes no 0.603 0.395 0.488 1e-54
P93051 463 Sugar transporter ERD6-li no no 0.662 0.440 0.424 8e-48
Q8LBI9 482 Sugar transporter ERD6-li no no 0.698 0.446 0.397 2e-46
Q3ECP7 470 Sugar transporter ERD6-li no no 0.574 0.376 0.463 4e-42
Q9FRL3 487 Sugar transporter ERD6-li no no 0.587 0.371 0.409 2e-39
Q93YP9 488 Sugar transporter ERD6-li no no 0.587 0.370 0.409 5e-39
Q94KE0 470 Sugar transporter ERD6-li no no 0.600 0.393 0.410 2e-36
O04036 496 Sugar transporter ERD6 OS no no 0.574 0.356 0.398 4e-36
Q9LTP6 488 Putative sugar transporte no no 0.613 0.387 0.403 5e-36
Q7XA64327 Sugar transporter ERD6-li no no 0.509 0.480 0.449 2e-34
>sp|Q0WQ63|ERDL8_ARATH Sugar transporter ERD6-like 8 OS=Arabidopsis thaliana GN=At3g05150 PE=2 SV=1 Back     alignment and function desciption
 Score =  213 bits (543), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 110/225 (48%), Positives = 151/225 (67%), Gaps = 39/225 (17%)

Query: 45  PTQFGIMADLKESYAEYSLFGSILTIGAIIGAITSGRIADWVARKGAAPL---------- 94
           PTQFGIM +L  SY+++S+FGSIL +GA++GAITSG+I+D++ RKGA  L          
Sbjct: 58  PTQFGIMEELNLSYSQFSVFGSILNMGAVLGAITSGKISDFIGRKGAMRLSSVISAIGWL 117

Query: 95  ----------LDFGRFLAGCGIGVMSYVVPVYIAEITPKNLRAALATVNQLFIVTGALFA 144
                     LDFGRFL G G G +S+VVPV+IAEI+P+ LR ALAT+NQLFIV G    
Sbjct: 118 IIYLAKGDVPLDFGRFLTGYGCGTLSFVVPVFIAEISPRKLRGALATLNQLFIVIGLASM 177

Query: 145 YVIGALMSWRILALTGL----------FFIPESPRWLAMIGKNQEFEVALSMVRGPNVDV 194
           ++IGA+++WR LALTG+          +FIPESPRWL M+G++ +FE+AL  +RGP  ++
Sbjct: 178 FLIGAVVNWRTLALTGVAPCVVLFFGTWFIPESPRWLEMVGRHSDFEIALQKLRGPQANI 237

Query: 195 SRELNEILSKRITLILQESLALINQLPRVNILDLFNRRNIRFVNV 239
           +RE  EI         QE LA +  LP+  ++DL +++NIRFV V
Sbjct: 238 TREAGEI---------QEYLASLAHLPKATLMDLIDKKNIRFVIV 273




Sugar transporter.
Arabidopsis thaliana (taxid: 3702)
>sp|P93051|ERDL7_ARATH Sugar transporter ERD6-like 7 OS=Arabidopsis thaliana GN=At2g48020 PE=2 SV=2 Back     alignment and function description
>sp|Q8LBI9|EDL16_ARATH Sugar transporter ERD6-like 16 OS=Arabidopsis thaliana GN=At5g18840 PE=2 SV=2 Back     alignment and function description
>sp|Q3ECP7|ERDL5_ARATH Sugar transporter ERD6-like 5 OS=Arabidopsis thaliana GN=At1g54730 PE=2 SV=2 Back     alignment and function description
>sp|Q9FRL3|ERDL6_ARATH Sugar transporter ERD6-like 6 OS=Arabidopsis thaliana GN=At1g75220 PE=1 SV=1 Back     alignment and function description
>sp|Q93YP9|ERDL4_ARATH Sugar transporter ERD6-like 4 OS=Arabidopsis thaliana GN=At1g19450 PE=2 SV=1 Back     alignment and function description
>sp|Q94KE0|ERDL3_ARATH Sugar transporter ERD6-like 3 OS=Arabidopsis thaliana GN=SUGTL2 PE=2 SV=1 Back     alignment and function description
>sp|O04036|ERD6_ARATH Sugar transporter ERD6 OS=Arabidopsis thaliana GN=ERD6 PE=1 SV=3 Back     alignment and function description
>sp|Q9LTP6|EDL13_ARATH Putative sugar transporter ERD6-like 13 OS=Arabidopsis thaliana GN=At3g20460 PE=3 SV=2 Back     alignment and function description
>sp|Q7XA64|ERDL9_ARATH Sugar transporter ERD6-like 9 OS=Arabidopsis thaliana GN=At3g05155 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query308
147865507 771 hypothetical protein VITISV_037729 [Viti 0.964 0.385 0.421 2e-69
255542514 455 sugar transporter, putative [Ricinus com 0.737 0.498 0.531 4e-66
356557849312 PREDICTED: LOW QUALITY PROTEIN: sugar tr 0.740 0.730 0.442 7e-61
310877874 473 putative ERD6-like transporter [Vitis vi 0.746 0.486 0.475 2e-58
3776581 483 Similar to Beta integral membrane protei 0.857 0.546 0.408 1e-57
298205019 874 unnamed protein product [Vitis vinifera] 0.746 0.263 0.475 1e-57
359487967 1179 PREDICTED: uncharacterized protein LOC10 0.746 0.195 0.475 2e-57
30679397 470 sugar transporter ERD6-like 8 [Arabidops 0.603 0.395 0.488 7e-53
6729025 463 putative sugar transporter [Arabidopsis 0.603 0.401 0.488 8e-53
297829028 470 sugar transporter family protein [Arabid 0.603 0.395 0.488 1e-52
>gi|147865507|emb|CAN83661.1| hypothetical protein VITISV_037729 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  268 bits (686), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 170/403 (42%), Positives = 216/403 (53%), Gaps = 106/403 (26%)

Query: 1   MARKKDVESGNSNSSEPNVDR--------KNEYGNVREPLID------------------ 34
           MA K++VE GN N +EP + +        K+  G +R  L+                   
Sbjct: 1   MAAKQEVEKGNGNITEPLIVQEKQGEAQIKSNNGGLRMVLLSIFVAVCGSFEFGSCVGLC 60

Query: 35  ----RKNQAKEQ--QNPTQFGIMADLKESYAEYSLFGSILTIGAIIGAITSGRIADWVAR 88
                K  A +     P Q+GIM +L  SY++YS+FGSIL+IGA+IGAI+SG IAD + R
Sbjct: 61  YFSAYKLLAMQAGFSAPAQYGIMNELGLSYSQYSVFGSILSIGAMIGAISSGWIADSIGR 120

Query: 89  KGAAPLLDFGRFLAGCGIGVMSYVVPVYIAEITPKNLRAALATVNQLFIVTGALFAYVIG 148
           KG +  LD GRFL G GIG++SYV+PV+IAEITPKN R  LAT NQLFIVTG   A+V+G
Sbjct: 121 KGGSVSLDSGRFLLGYGIGILSYVIPVFIAEITPKNHRGTLATANQLFIVTGLFIAFVVG 180

Query: 149 ALMSWRILALTG----------LFFIPESPRWLAMIGKNQEFEVALSMVRGPNVDVSREL 198
           A ++WR LALTG          LFFIPESPRWLA  G  +EF+  L  +RG   DVS E 
Sbjct: 181 AFVTWRTLALTGILPCMVLLVGLFFIPESPRWLARAGYEREFKAELQKLRGVEADVSEEE 240

Query: 199 NEILSKRITL-----------------------------ILQESL---------ALINQL 220
            EI    +T                              IL  SL         +LI++L
Sbjct: 241 AEIQEYMVTHQLLPKVGIMVLLDKQNVSSVIESLLNLGGILYSSLQVIVTAFGASLIDRL 300

Query: 221 PR----------------------VNILDLFNRRNIR----FVNVYIAFYSIGMGPIPWV 254
            R                      ++I  L NR N       + V+I FYS+G+GPIPW+
Sbjct: 301 GRRPLLMAHQLAPNLVPILAVTGIMHIDKLVNRENGTDVSVLIQVHIGFYSVGLGPIPWL 360

Query: 255 IMFEIFPLNIKGPGGSLVTLVNWIGSWAISYSFILLMTWSSCG 297
           IM EIFPL++K   GSLVTLVNW G+WA+SY+F  LM WSS G
Sbjct: 361 IMSEIFPLHVKAIAGSLVTLVNWFGAWAVSYTFNFLMNWSSHG 403




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255542514|ref|XP_002512320.1| sugar transporter, putative [Ricinus communis] gi|223548281|gb|EEF49772.1| sugar transporter, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356557849|ref|XP_003547223.1| PREDICTED: LOW QUALITY PROTEIN: sugar transporter ERD6-like 16-like [Glycine max] Back     alignment and taxonomy information
>gi|310877874|gb|ADP37168.1| putative ERD6-like transporter [Vitis vinifera] Back     alignment and taxonomy information
>gi|3776581|gb|AAC64898.1| Similar to Beta integral membrane protein homolog gb|U43629 from A. thaliana [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|298205019|emb|CBI34326.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359487967|ref|XP_002263811.2| PREDICTED: uncharacterized protein LOC100264207 [Vitis vinifera] Back     alignment and taxonomy information
>gi|30679397|ref|NP_187166.2| sugar transporter ERD6-like 8 [Arabidopsis thaliana] gi|117940178|sp|Q0WQ63.1|ERDL8_ARATH RecName: Full=Sugar transporter ERD6-like 8 gi|110737589|dbj|BAF00736.1| putative sugar transporter [Arabidopsis thaliana] gi|332640670|gb|AEE74191.1| sugar transporter ERD6-like 8 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|6729025|gb|AAF27021.1|AC009177_11 putative sugar transporter [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297829028|ref|XP_002882396.1| sugar transporter family protein [Arabidopsis lyrata subsp. lyrata] gi|297328236|gb|EFH58655.1| sugar transporter family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query308
TAIR|locus:2144975 482 AT5G18840 "AT5G18840" [Arabido 0.480 0.307 0.479 2e-59
TAIR|locus:2066400 463 AT2G48020 [Arabidopsis thalian 0.477 0.317 0.465 1.7e-56
TAIR|locus:2199539 470 AT1G54730 [Arabidopsis thalian 0.389 0.255 0.522 2.9e-53
TAIR|locus:2096219 470 AT3G05150 [Arabidopsis thalian 0.522 0.342 0.489 9e-49
TAIR|locus:2146365 478 SFP2 [Arabidopsis thaliana (ta 0.363 0.234 0.467 4.7e-44
TAIR|locus:2036084 496 ERD6 "EARLY RESPONSE TO DEHYDR 0.376 0.233 0.460 1.1e-42
TAIR|locus:2146350 474 SFP1 [Arabidopsis thaliana (ta 0.350 0.227 0.491 1.4e-42
TAIR|locus:2036009 462 AT1G08900 [Arabidopsis thalian 0.409 0.272 0.445 3.3e-42
TAIR|locus:2138927 482 AT4G04750 [Arabidopsis thalian 0.353 0.226 0.453 4.3e-42
TAIR|locus:2092379 488 AT3G20460 [Arabidopsis thalian 0.448 0.282 0.420 6e-42
TAIR|locus:2144975 AT5G18840 "AT5G18840" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 339 (124.4 bits), Expect = 2.0e-59, Sum P(3) = 2.0e-59
 Identities = 82/171 (47%), Positives = 107/171 (62%)

Query:    85 WVA---RKGAAPLLDFGRFLAGCGIGVMSYVVPVYIAEITPKNLRAALATVNQLFIVTGA 141
             W+A    KGA  LLD GRF  G GIGV SYVVPVYIAEI+PKNLR  L T+NQL IV G+
Sbjct:   125 WLAVFFTKGAL-LLDVGRFFTGYGIGVFSYVVPVYIAEISPKNLRGGLTTLNQLMIVIGS 183

Query:   142 LFAYVIGALMSWRILALTGL-------F---FIPESPRWLAMIGKNQEFEVALSMVRGPN 191
               +++IG+L+SW+ LALTGL       F   FIPESPRWLA  G  +EF VAL  +RG +
Sbjct:   184 SVSFLIGSLISWKTLALTGLAPCIVLLFGLCFIPESPRWLAKAGHEKEFRVALQKLRGKD 243

Query:   192 VDVSRELNEILSKRITLILQESLALINQLPRVNILDLFNRRNIRFVNVYIA 242
              D++ E + I         Q S+  +  LP+  I DL +++  R V + ++
Sbjct:   244 ADITNEADGI---------QVSIQALEILPKARIQDLVSKKYGRSVIIGVS 285


GO:0005351 "sugar:hydrogen symporter activity" evidence=ISS
GO:0005886 "plasma membrane" evidence=ISM
GO:0015144 "carbohydrate transmembrane transporter activity" evidence=ISS
GO:0016020 "membrane" evidence=IEA;ISS
GO:0016021 "integral to membrane" evidence=IEA
GO:0022857 "transmembrane transporter activity" evidence=IEA
GO:0022891 "substrate-specific transmembrane transporter activity" evidence=IEA
GO:0055085 "transmembrane transport" evidence=IEA
TAIR|locus:2066400 AT2G48020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2199539 AT1G54730 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2096219 AT3G05150 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2146365 SFP2 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036084 ERD6 "EARLY RESPONSE TO DEHYDRATION 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2146350 SFP1 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036009 AT1G08900 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2138927 AT4G04750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2092379 AT3G20460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00006100001
SubName- Full=Chromosome chr14 scaffold_164, whole genome shotgun sequence; (473 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query308
pfam00083 449 pfam00083, Sugar_tr, Sugar (and other) transporter 1e-27
TIGR00879 481 TIGR00879, SP, MFS transporter, sugar porter (SP) 1e-26
PRK10077 479 PRK10077, xylE, D-xylose transporter XylE; Provisi 3e-16
TIGR00898 505 TIGR00898, 2A0119, cation transport protein 4e-12
cd06174352 cd06174, MFS, The Major Facilitator Superfamily (M 4e-09
TIGR00879481 TIGR00879, SP, MFS transporter, sugar porter (SP) 2e-08
pfam00083449 pfam00083, Sugar_tr, Sugar (and other) transporter 4e-08
TIGR00895398 TIGR00895, 2A0115, benzoate transport 4e-07
PRK10077479 PRK10077, xylE, D-xylose transporter XylE; Provisi 2e-05
TIGR01299 742 TIGR01299, synapt_SV2, synaptic vesicle protein SV 5e-05
pfam07690346 pfam07690, MFS_1, Major Facilitator Superfamily 5e-04
>gnl|CDD|215702 pfam00083, Sugar_tr, Sugar (and other) transporter Back     alignment and domain information
 Score =  110 bits (278), Expect = 1e-27
 Identities = 63/191 (32%), Positives = 91/191 (47%), Gaps = 40/191 (20%)

Query: 53  DLKESYAEYSLFGSILTIGAIIGAITSGRIADWVARK-----------------GAAP-- 93
               S     L  SI ++G +IG++ +G++ D   RK                 G A   
Sbjct: 40  ACAASTVLSGLIVSIFSVGCLIGSLFAGKLGDRFGRKKSLLIGNVLFVIGALLQGFAKGK 99

Query: 94  ---LLDFGRFLAGCGIGVMSYVVPVYIAEITPKNLRAALATVNQLFIVTGALFAYVIGAL 150
              +L  GR + G G+G +S +VP+YI+EI PK LR AL ++ QL I  G L A +IG  
Sbjct: 100 SFYMLIVGRVIVGLGVGGISVLVPMYISEIAPKKLRGALGSLYQLGITFGILVAAIIGLG 159

Query: 151 MS-----------------WRILALTGLFFIPESPRWLAMIGKNQEFEVALSMVRGPNVD 193
           ++                   IL L GL F+PESPRWL + GK +E    L+ +RG + D
Sbjct: 160 LNKYSNSDGWRIPLGLQFVPAILLLIGLLFLPESPRWLVLKGKLEEARAVLAKLRGVS-D 218

Query: 194 VSRELNEILSK 204
           V +E+ E    
Sbjct: 219 VDQEIQEEKDS 229


Length = 449

>gnl|CDD|233165 TIGR00879, SP, MFS transporter, sugar porter (SP) family Back     alignment and domain information
>gnl|CDD|182225 PRK10077, xylE, D-xylose transporter XylE; Provisional Back     alignment and domain information
>gnl|CDD|233176 TIGR00898, 2A0119, cation transport protein Back     alignment and domain information
>gnl|CDD|119392 cd06174, MFS, The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>gnl|CDD|233165 TIGR00879, SP, MFS transporter, sugar porter (SP) family Back     alignment and domain information
>gnl|CDD|215702 pfam00083, Sugar_tr, Sugar (and other) transporter Back     alignment and domain information
>gnl|CDD|233175 TIGR00895, 2A0115, benzoate transport Back     alignment and domain information
>gnl|CDD|182225 PRK10077, xylE, D-xylose transporter XylE; Provisional Back     alignment and domain information
>gnl|CDD|130366 TIGR01299, synapt_SV2, synaptic vesicle protein SV2 Back     alignment and domain information
>gnl|CDD|219516 pfam07690, MFS_1, Major Facilitator Superfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 308
KOG0569485 consensus Permease of the major facilitator superf 100.0
KOG0254513 consensus Predicted transporter (major facilitator 99.96
PF00083451 Sugar_tr: Sugar (and other) transporter; InterPro: 99.94
TIGR00887 502 2A0109 phosphate:H+ symporter. This model represen 99.93
PRK10077 479 xylE D-xylose transporter XylE; Provisional 99.93
TIGR00898505 2A0119 cation transport protein. 99.92
TIGR01299 742 synapt_SV2 synaptic vesicle protein SV2. This mode 99.89
KOG0253 528 consensus Synaptic vesicle transporter SV2 (major 99.88
TIGR00879 481 SP MFS transporter, sugar porter (SP) family. This 99.88
KOG0255521 consensus Synaptic vesicle transporter SVOP and re 99.87
KOG0252 538 consensus Inorganic phosphate transporter [Inorgan 99.85
TIGR00903368 2A0129 major facilitator 4 family protein. This fa 99.85
TIGR00891405 2A0112 putative sialic acid transporter. 99.83
TIGR02332412 HpaX 4-hydroxyphenylacetate permease. This protein 99.82
TIGR00893399 2A0114 d-galactonate transporter. 99.79
PRK10642 490 proline/glycine betaine transporter; Provisional 99.79
PRK11551406 putative 3-hydroxyphenylpropionic transporter MhpT 99.78
PRK12307426 putative sialic acid transporter; Provisional 99.78
PRK10406432 alpha-ketoglutarate transporter; Provisional 99.75
TIGR00895398 2A0115 benzoate transport. 99.75
TIGR00881379 2A0104 phosphoglycerate transporter family protein 99.75
PRK09952438 shikimate transporter; Provisional 99.73
PRK11663434 regulatory protein UhpC; Provisional 99.72
PRK03545390 putative arabinose transporter; Provisional 99.72
KOG2532 466 consensus Permease of the major facilitator superf 99.71
PRK09556 467 uhpT sugar phosphate antiporter; Reviewed 99.7
TIGR00890377 2A0111 Oxalate/Formate Antiporter. 99.7
PRK03893 496 putative sialic acid transporter; Provisional 99.69
COG2271448 UhpC Sugar phosphate permease [Carbohydrate transp 99.69
TIGR00900365 2A0121 H+ Antiporter protein. 99.69
COG2814394 AraJ Arabinose efflux permease [Carbohydrate trans 99.68
PRK11273452 glpT sn-glycerol-3-phosphate transporter; Provisio 99.67
TIGR00894 465 2A0114euk Na(+)-dependent inorganic phosphate cotr 99.66
PRK10489417 enterobactin exporter EntS; Provisional 99.66
PRK12382392 putative transporter; Provisional 99.65
PRK14995 495 methyl viologen resistance protein SmvA; Provision 99.64
TIGR00711 485 efflux_EmrB drug resistance transporter, EmrB/QacA 99.64
PRK05122399 major facilitator superfamily transporter; Provisi 99.64
PRK10213394 nepI ribonucleoside transporter; Reviewed 99.63
PRK09705393 cynX putative cyanate transporter; Provisional 99.62
PF07690352 MFS_1: Major Facilitator Superfamily; InterPro: IP 99.61
KOG1330 493 consensus Sugar transporter/spinster transmembrane 99.61
PRK15075434 citrate-proton symporter; Provisional 99.6
cd06174352 MFS The Major Facilitator Superfamily (MFS) is a l 99.59
TIGR00712438 glpT glycerol-3-phosphate transporter. This model 99.59
KOG2533 495 consensus Permease of the major facilitator superf 99.59
TIGR00710385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 99.59
PRK15403413 multidrug efflux system protein MdtM; Provisional 99.58
TIGR00806 511 rfc RFC reduced folate carrier. Proteins of the RF 99.56
TIGR00896355 CynX cyanate transporter. This family of proteins 99.56
PRK10091382 MFS transport protein AraJ; Provisional 99.56
PRK11102377 bicyclomycin/multidrug efflux system; Provisional 99.55
PRK03699394 putative transporter; Provisional 99.54
TIGR00883394 2A0106 metabolite-proton symporter. This model rep 99.54
TIGR00885410 fucP L-fucose:H+ symporter permease. This family d 99.53
PRK10504 471 putative transporter; Provisional 99.53
TIGR00899375 2A0120 sugar efflux transporter. This family of pr 99.52
PRK03633381 putative MFS family transporter protein; Provision 99.52
PRK11646400 multidrug resistance protein MdtH; Provisional 99.51
PRK15402406 multidrug efflux system translocase MdfA; Provisio 99.51
PRK11195393 lysophospholipid transporter LplT; Provisional 99.51
PRK11043401 putative transporter; Provisional 99.49
PRK10133 438 L-fucose transporter; Provisional 99.49
PRK11652394 emrD multidrug resistance protein D; Provisional 99.48
TIGR00897402 2A0118 polyol permease family. This family of prot 99.48
PLN00028 476 nitrate transmembrane transporter; Provisional 99.48
PRK10054395 putative transporter; Provisional 99.47
PRK10642490 proline/glycine betaine transporter; Provisional 99.47
PRK09874408 drug efflux system protein MdtG; Provisional 99.47
PRK10473392 multidrug efflux system protein MdtL; Provisional 99.47
KOG2615 451 consensus Permease of the major facilitator superf 99.46
TIGR00892 455 2A0113 monocarboxylate transporter 1. 99.44
TIGR00886366 2A0108 nitrite extrusion protein (nitrite facilita 99.42
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 99.4
TIGR00805 633 oat sodium-independent organic anion transporter. 99.38
PRK15034 462 nitrate/nitrite transport protein NarU; Provisiona 99.38
COG2223417 NarK Nitrate/nitrite transporter [Inorganic ion tr 99.34
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 99.33
PRK11010 491 ampG muropeptide transporter; Validated 99.31
TIGR00901356 2A0125 AmpG-related permease. 99.31
COG0738 422 FucP Fucose permease [Carbohydrate transport and m 99.31
PTZ00207 591 hypothetical protein; Provisional 99.31
TIGR00902382 2A0127 phenyl proprionate permease family protein. 99.28
PRK11128382 putative 3-phenylpropionic acid transporter; Provi 99.21
PRK10207 489 dipeptide/tripeptide permease B; Provisional 99.21
PRK11902402 ampG muropeptide transporter; Reviewed 99.19
PRK15011393 sugar efflux transporter B; Provisional 99.18
TIGR00792 437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 99.17
PRK09528420 lacY galactoside permease; Reviewed 99.12
TIGR00882396 2A0105 oligosaccharide:H+ symporter. 99.12
TIGR00924 475 yjdL_sub1_fam amino acid/peptide transporter (Pept 99.11
COG2807 395 CynX Cyanate permease [Inorganic ion transport and 99.08
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 99.05
TIGR00880141 2_A_01_02 Multidrug resistance protein. 99.01
TIGR00889418 2A0110 nucleoside transporter. This family of prot 99.01
PRK15462 493 dipeptide/tripeptide permease D; Provisional 98.95
PRK09584 500 tppB putative tripeptide transporter permease; Rev 98.95
TIGR00890377 2A0111 Oxalate/Formate Antiporter. 98.9
KOG3764464 consensus Vesicular amine transporter [Intracellul 98.9
PF06609 599 TRI12: Fungal trichothecene efflux pump (TRI12); I 98.9
TIGR01299742 synapt_SV2 synaptic vesicle protein SV2. This mode 98.88
TIGR02718390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 98.88
PRK15011393 sugar efflux transporter B; Provisional 98.87
KOG2504 509 consensus Monocarboxylate transporter [Carbohydrat 98.8
TIGR01301 477 GPH_sucrose GPH family sucrose/H+ symporter. This 98.75
TIGR00891405 2A0112 putative sialic acid transporter. 98.72
PF03137 539 OATP: Organic Anion Transporter Polypeptide (OATP) 98.72
PRK09556467 uhpT sugar phosphate antiporter; Reviewed 98.69
KOG2325 488 consensus Predicted transporter/transmembrane prot 98.69
TIGR00788 468 fbt folate/biopterin transporter. The only functio 98.65
TIGR00899375 2A0120 sugar efflux transporter. This family of pr 98.64
TIGR00889418 2A0110 nucleoside transporter. This family of prot 98.64
cd06174352 MFS The Major Facilitator Superfamily (MFS) is a l 98.63
PRK11551406 putative 3-hydroxyphenylpropionic transporter MhpT 98.61
PRK10077479 xylE D-xylose transporter XylE; Provisional 98.6
PRK03893496 putative sialic acid transporter; Provisional 98.58
TIGR00883394 2A0106 metabolite-proton symporter. This model rep 98.57
PRK09669 444 putative symporter YagG; Provisional 98.57
TIGR00895398 2A0115 benzoate transport. 98.56
PRK03633381 putative MFS family transporter protein; Provision 98.55
PRK09528420 lacY galactoside permease; Reviewed 98.53
TIGR00892455 2A0113 monocarboxylate transporter 1. 98.53
PRK09952438 shikimate transporter; Provisional 98.52
PRK11273452 glpT sn-glycerol-3-phosphate transporter; Provisio 98.5
PF13347428 MFS_2: MFS/sugar transport protein 98.49
PRK05122399 major facilitator superfamily transporter; Provisi 98.46
TIGR00893399 2A0114 d-galactonate transporter. 98.44
PRK03545390 putative arabinose transporter; Provisional 98.44
TIGR00879481 SP MFS transporter, sugar porter (SP) family. This 98.42
PRK12382392 putative transporter; Provisional 98.4
PF03825400 Nuc_H_symport: Nucleoside H+ symporter 98.39
PRK10489417 enterobactin exporter EntS; Provisional 98.39
TIGR00900365 2A0121 H+ Antiporter protein. 98.38
PRK03699394 putative transporter; Provisional 98.36
PRK09874408 drug efflux system protein MdtG; Provisional 98.35
TIGR00897402 2A0118 polyol permease family. This family of prot 98.34
TIGR00881379 2A0104 phosphoglycerate transporter family protein 98.32
PRK09705393 cynX putative cyanate transporter; Provisional 98.31
PF11700477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 98.31
TIGR00711485 efflux_EmrB drug resistance transporter, EmrB/QacA 98.3
PRK15075434 citrate-proton symporter; Provisional 98.26
PRK14995495 methyl viologen resistance protein SmvA; Provision 98.26
PRK11663434 regulatory protein UhpC; Provisional 98.24
PF01306 412 LacY_symp: LacY proton/sugar symporter; InterPro: 98.24
TIGR00902382 2A0127 phenyl proprionate permease family protein. 98.23
PRK10406432 alpha-ketoglutarate transporter; Provisional 98.23
PF05631354 DUF791: Protein of unknown function (DUF791); Inte 98.21
PRK12307426 putative sialic acid transporter; Provisional 98.2
PRK10429 473 melibiose:sodium symporter; Provisional 98.2
KOG0569485 consensus Permease of the major facilitator superf 98.19
PF07690352 MFS_1: Major Facilitator Superfamily; InterPro: IP 98.19
COG2271448 UhpC Sugar phosphate permease [Carbohydrate transp 98.18
PF11700477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 98.17
PRK11010491 ampG muropeptide transporter; Validated 98.16
TIGR00898505 2A0119 cation transport protein. 98.13
PF06813250 Nodulin-like: Nodulin-like; InterPro: IPR010658 Th 98.12
TIGR00712438 glpT glycerol-3-phosphate transporter. This model 98.12
TIGR02718390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 98.11
KOG4686 459 consensus Predicted sugar transporter [Carbohydrat 98.08
TIGR02332412 HpaX 4-hydroxyphenylacetate permease. This protein 98.07
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 98.06
TIGR00887502 2A0109 phosphate:H+ symporter. This model represen 98.05
PLN00028476 nitrate transmembrane transporter; Provisional 98.05
PRK09848 448 glucuronide transporter; Provisional 98.05
PRK10504471 putative transporter; Provisional 98.05
KOG3626 735 consensus Organic anion transporter [Secondary met 98.04
COG2270438 Permeases of the major facilitator superfamily [Ge 98.03
COG3104 498 PTR2 Dipeptide/tripeptide permease [Amino acid tra 98.0
PRK11128382 putative 3-phenylpropionic acid transporter; Provi 98.0
TIGR00901356 2A0125 AmpG-related permease. 97.99
COG2223417 NarK Nitrate/nitrite transporter [Inorganic ion tr 97.99
COG2814394 AraJ Arabinose efflux permease [Carbohydrate trans 97.97
KOG4686459 consensus Predicted sugar transporter [Carbohydrat 97.96
TIGR00710385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 97.95
TIGR00896355 CynX cyanate transporter. This family of proteins 97.92
PF05977524 MFS_3: Transmembrane secretion effector; InterPro: 97.92
TIGR00792437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 97.91
TIGR01272310 gluP glucose/galactose transporter. Disruption of 97.9
PRK11195393 lysophospholipid transporter LplT; Provisional 97.9
PRK15402406 multidrug efflux system translocase MdfA; Provisio 97.89
TIGR00882396 2A0105 oligosaccharide:H+ symporter. 97.88
PRK10213394 nepI ribonucleoside transporter; Reviewed 97.88
PRK10091382 MFS transport protein AraJ; Provisional 97.85
KOG2563 480 consensus Permease of the major facilitator superf 97.84
PRK11902402 ampG muropeptide transporter; Reviewed 97.83
COG2270438 Permeases of the major facilitator superfamily [Ge 97.83
PF03209403 PUCC: PUCC protein; InterPro: IPR004896 This prote 97.79
PRK09848448 glucuronide transporter; Provisional 97.72
PF13347428 MFS_2: MFS/sugar transport protein 97.72
COG2211 467 MelB Na+/melibiose symporter and related transport 97.72
TIGR00788468 fbt folate/biopterin transporter. The only functio 97.71
KOG2816 463 consensus Predicted transporter ADD1 (major facili 97.71
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 97.7
TIGR00894465 2A0114euk Na(+)-dependent inorganic phosphate cotr 97.7
COG0477338 ProP Permeases of the major facilitator superfamil 97.68
PRK11462 460 putative transporter; Provisional 97.66
PF05978156 UNC-93: Ion channel regulatory protein UNC-93; Int 97.64
PRK11043401 putative transporter; Provisional 97.63
PRK11102377 bicyclomycin/multidrug efflux system; Provisional 97.6
PRK10429473 melibiose:sodium symporter; Provisional 97.57
KOG0253528 consensus Synaptic vesicle transporter SV2 (major 97.57
PRK11652394 emrD multidrug resistance protein D; Provisional 97.55
PF03825400 Nuc_H_symport: Nucleoside H+ symporter 97.54
PRK10133438 L-fucose transporter; Provisional 97.53
PRK11646400 multidrug resistance protein MdtH; Provisional 97.52
TIGR01272310 gluP glucose/galactose transporter. Disruption of 97.44
PRK10054395 putative transporter; Provisional 97.42
PF03092 433 BT1: BT1 family; InterPro: IPR004324 Members of th 97.42
PRK09669444 putative symporter YagG; Provisional 97.41
TIGR00886366 2A0108 nitrite extrusion protein (nitrite facilita 97.41
PF1283277 MFS_1_like: MFS_1 like family 97.38
PF0677985 DUF1228: Protein of unknown function (DUF1228); In 97.33
TIGR00903368 2A0129 major facilitator 4 family protein. This fa 97.27
PRK10473392 multidrug efflux system protein MdtL; Provisional 97.26
KOG2504509 consensus Monocarboxylate transporter [Carbohydrat 97.26
TIGR00926 654 2A1704 Peptide:H+ symporter (also transports b-lac 97.19
KOG2532466 consensus Permease of the major facilitator superf 96.98
PRK15034462 nitrate/nitrite transport protein NarU; Provisiona 96.94
COG2211467 MelB Na+/melibiose symporter and related transport 96.89
PF01770412 Folate_carrier: Reduced folate carrier; InterPro: 96.81
PRK09584500 tppB putative tripeptide transporter permease; Rev 96.77
COG2807395 CynX Cyanate permease [Inorganic ion transport and 96.76
KOG0254513 consensus Predicted transporter (major facilitator 96.75
PRK10207489 dipeptide/tripeptide permease B; Provisional 96.74
TIGR00769 472 AAA ADP/ATP carrier protein family. These proteins 96.65
PRK11462460 putative transporter; Provisional 96.65
PF03209403 PUCC: PUCC protein; InterPro: IPR004896 This prote 96.61
PF00083451 Sugar_tr: Sugar (and other) transporter; InterPro: 96.52
TIGR00885410 fucP L-fucose:H+ symporter permease. This family d 96.38
KOG3764464 consensus Vesicular amine transporter [Intracellul 96.36
TIGR00924475 yjdL_sub1_fam amino acid/peptide transporter (Pept 96.32
PF01306412 LacY_symp: LacY proton/sugar symporter; InterPro: 96.29
COG0738422 FucP Fucose permease [Carbohydrate transport and m 96.17
PRK15403413 multidrug efflux system protein MdtM; Provisional 95.79
KOG3762618 consensus Predicted transporter [General function 95.67
KOG3574510 consensus Acetyl-CoA transporter [Inorganic ion tr 95.24
KOG0252538 consensus Inorganic phosphate transporter [Inorgan 95.05
KOG3098 461 consensus Uncharacterized conserved protein [Funct 94.89
KOG4332 454 consensus Predicted sugar transporter [Carbohydrat 94.84
KOG2615451 consensus Permease of the major facilitator superf 94.65
PRK15462493 dipeptide/tripeptide permease D; Provisional 94.49
KOG0637 498 consensus Sucrose transporter and related proteins 93.94
PF13000 544 Acatn: Acetyl-coenzyme A transporter 1; InterPro: 93.38
KOG0255521 consensus Synaptic vesicle transporter SVOP and re 93.35
PF02487402 CLN3: CLN3 protein; InterPro: IPR003492 Batten's d 91.89
KOG1237 571 consensus H+/oligopeptide symporter [Amino acid tr 91.78
PF06963432 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 Thi 91.67
PF06609599 TRI12: Fungal trichothecene efflux pump (TRI12); I 91.51
PF03219 491 TLC: TLC ATP/ADP transporter; InterPro: IPR004667 91.46
KOG1479406 consensus Nucleoside transporter [Nucleotide trans 91.02
KOG2533495 consensus Permease of the major facilitator superf 90.72
PF00854 372 PTR2: POT family; InterPro: IPR000109 This entry r 90.46
KOG3762 618 consensus Predicted transporter [General function 90.03
TIGR01301477 GPH_sucrose GPH family sucrose/H+ symporter. This 90.03
TIGR00880141 2_A_01_02 Multidrug resistance protein. 90.0
PF06963432 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 Thi 89.61
KOG2816463 consensus Predicted transporter ADD1 (major facili 89.59
PTZ00207591 hypothetical protein; Provisional 87.23
COG3104498 PTR2 Dipeptide/tripeptide permease [Amino acid tra 87.0
PRK03612 521 spermidine synthase; Provisional 86.94
COG3202 509 ATP/ADP translocase [Energy production and convers 86.69
PF03092433 BT1: BT1 family; InterPro: IPR004324 Members of th 85.63
COG5336116 Uncharacterized protein conserved in bacteria [Fun 84.75
KOG3097390 consensus Predicted membrane protein [Function unk 84.56
>KOG0569 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
Probab=100.00  E-value=8.9e-32  Score=242.93  Aligned_cols=238  Identities=33%  Similarity=0.566  Sum_probs=204.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHhhhhhcccccchH-----------------------HHHHHHHHHHHhhhhccccchhhhh
Q 048448           61 YSLFGSILTIGAIIGAITSGRIADWVARKGAA-----------------------PLLDFGRFLAGCGIGVMSYVVPVYI  117 (308)
Q Consensus        61 ~~~~~s~~~~g~~~g~~~~g~l~d~~Grr~~~-----------------------~~~~~~r~l~G~~~g~~~~~~~~~~  117 (308)
                      .+.+.+++.+|.++|++..++++|++|||..+                       .+++++|++.|+..|......+.|+
T Consensus        62 wS~~vs~f~iG~~~Gs~~~~~la~~~GRK~~l~~~~~l~~~~~~~~~~s~~~~~~e~li~GR~i~Gl~~gl~~~~~pmyl  141 (485)
T KOG0569|consen   62 WSLIVSIFFIGGMIGSFSSGLLADRFGRKNALLLSNLLAVLAALLMGLSKSAPSFEMLILGRLIVGLACGLSTGLVPMYL  141 (485)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhhcchHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHhHHHHHHHHHHH
Confidence            57788999999999999999999999999776                       8899999999999999999999999


Q ss_pred             hccCCCCCchhHHHHHHHHHHHHHHHHHHHhhhh------hhHHHHHh----------hhcccccCchhHhh-cCChHHH
Q 048448          118 AEITPKNLRAALATVNQLFIVTGALFAYVIGALM------SWRILALT----------GLFFIPESPRWLAM-IGKNQEF  180 (308)
Q Consensus       118 ~e~~~~~~r~~~~~~~~~~~~~g~~~~~~l~~~~------~w~~~~~~----------~~~~~~esp~~~~~-~~~~~~~  180 (308)
                      .|..|.+.||....+.+.+.++|.+++..++.--      .|++.+.+          ...++||||+|++. ++++++|
T Consensus       142 ~E~sP~~~RG~~g~~~~~~~~~g~ll~~~~~l~~ilGt~~~W~~l~~~~~i~~~~~l~~l~~~PESPk~Ll~~k~~~~~A  221 (485)
T KOG0569|consen  142 TEISPKNLRGALGTLLQIGVVIGILLGQVLGLPSLLGTEDLWPYLLAFPLIPALLQLALLPFLPESPKYLLIKKGDEEEA  221 (485)
T ss_pred             hhcChhhhccHHHHHHHHHHHHHHHHHHHHccHHhcCCCcchHHHHHHHHHHHHHHHHHHhcCCCCcchHHHHcCCHHHH
Confidence            9999999999999999999999999986665432      69887766          56899999999988 8999999


Q ss_pred             HHHHHHhcCCCcchHHHHHHHHHHHHHHHHHHHHHHH--hcCCccchhhccccchhhHH---------------------
Q 048448          181 EVALSMVRGPNVDVSRELNEILSKRITLILQESLALI--NQLPRVNILDLFNRRNIRFV---------------------  237 (308)
Q Consensus       181 ~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~l~~~~~~~~~---------------------  237 (308)
                      +++++++++.+.+.++..++.          ...+++  ++.++.++.++++++..|+-                     
T Consensus       222 ~~sl~~y~G~~~~~~~~e~~~----------~e~~~~~~~~~~~~sl~~~~~~~~lR~~~~i~~~v~~~qq~sGi~ai~~  291 (485)
T KOG0569|consen  222 RKALKFYRGKEDVEAEIEEML----------REIEEEELEKKKQISLRQLLKNPTLRRPLLIGIVVSFAQQFSGINAIFF  291 (485)
T ss_pred             HHHHHHHhCCCcchhHHHHHH----------HHHHHhccccccCCcHHHHhcCcchhHHHHHHHHHHHHHHhcCcceeHH
Confidence            999999998864333322222          222222  22367788999998777753                     


Q ss_pred             --------------------------------------------------------------------------------
Q 048448          238 --------------------------------------------------------------------------------  237 (308)
Q Consensus       238 --------------------------------------------------------------------------------  237 (308)
                                                                                                      
T Consensus       292 Yst~i~~~aG~~~~~a~~an~~~g~v~~~~t~~~~~lid~~gRRpLll~~~~~~~~~~~~~~~~~~l~~~~~~~~~y~~i  371 (485)
T KOG0569|consen  292 YSTSIFKTAGFTPEEAQYANLGIGIVNLLSTLVSPFLIDRLGRRPLLLISLSLMAVALLLMSIALFLSNSFGSWLSYLCI  371 (485)
T ss_pred             HHHHHHHHcCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCcHHHHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHH
Confidence                                                                                            


Q ss_pred             ---HHHHHhhhccccccccceecccCCCCchhhHhHHHHHHHHHHHHHHHHHHHHHHHhhc-------------------
Q 048448          238 ---NVYIAFYSIGMGPIPWVIMFEIFPLNIKGPGGSLVTLVNWIGSWAISYSFILLMTWSS-------------------  295 (308)
Q Consensus       238 ---~~~~~~~~~g~~~~~~~~~~e~~p~~~r~~~~g~~~~~~~~~~~i~~~~~~~~~~~~~-------------------  295 (308)
                         +++..+|++|.+|++|.+.+|+||++.|+.+.+++.+++|+.+++..+.||++.+..+                   
T Consensus       372 ~~~~~~~~~f~~G~gpi~~fi~aELf~~~~R~aa~s~~~~~~w~~~fiv~~~fp~l~~~~g~~~filF~i~~~~~~i~~~  451 (485)
T KOG0569|consen  372 AAIFLFIISFAIGPGPIPWFIGAELFPQSARSAAQSVATAVNWLSNFIVGFAFPPLQNVIGPYVFILFVIPLAIFLIYLY  451 (485)
T ss_pred             HHHHHHHHhhhcCCCchhHHHHHHhCCccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcchhhHHHHHHHHHHHHHHH
Confidence               6777889999999999999999999999999999999999999999999999998777                   


Q ss_pred             ------CCCCHHHHHhhcC
Q 048448          296 ------CGRTLEEVQASVS  308 (308)
Q Consensus       296 ------~g~~~~~~~~~~~  308 (308)
                            |||+.+||.+.++
T Consensus       452 ~~lPETkgr~~~eI~~~~~  470 (485)
T KOG0569|consen  452 RYLPETKGRTPYEIIEELE  470 (485)
T ss_pred             HhCcccCCCCHHHHHHHHH
Confidence                  9999999988763



>KOG0254 consensus Predicted transporter (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>KOG0253 consensus Synaptic vesicle transporter SV2 (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>KOG0255 consensus Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>KOG0252 consensus Inorganic phosphate transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>KOG2532 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>KOG1330 consensus Sugar transporter/spinster transmembrane protein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>KOG2533 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>TIGR00806 rfc RFC reduced folate carrier Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>KOG2615 consensus Permease of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>TIGR00880 2_A_01_02 Multidrug resistance protein Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>KOG3764 consensus Vesicular amine transporter [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>KOG2504 consensus Monocarboxylate transporter [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>PF03137 OATP: Organic Anion Transporter Polypeptide (OATP) family; InterPro: IPR004156 This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs) Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>KOG2325 consensus Predicted transporter/transmembrane protein [General function prediction only] Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>PF05631 DUF791: Protein of unknown function (DUF791); InterPro: IPR008509 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>KOG0569 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>PF06813 Nodulin-like: Nodulin-like; InterPro: IPR010658 This entry represents a conserved region within plant nodulin-like proteins and a number of uncharacterised proteins Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>KOG4686 consensus Predicted sugar transporter [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>KOG3626 consensus Organic anion transporter [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>COG3104 PTR2 Dipeptide/tripeptide permease [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4686 consensus Predicted sugar transporter [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>KOG2563 consensus Permease of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>KOG2816 consensus Predicted transporter ADD1 (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>COG0477 ProP Permeases of the major facilitator superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / Inorganic ion transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>PF05978 UNC-93: Ion channel regulatory protein UNC-93; InterPro: IPR010291 The proteins in this family are represented by UNC-93 from Caenorhabditis elegans Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>KOG0253 consensus Synaptic vesicle transporter SV2 (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>PF12832 MFS_1_like: MFS_1 like family Back     alignment and domain information
>PF06779 DUF1228: Protein of unknown function (DUF1228); InterPro: IPR010645 This entry represents the N terminus of several putative bacterial membrane proteins, which may be sugar transporters Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>KOG2504 consensus Monocarboxylate transporter [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00926 2A1704 Peptide:H+ symporter (also transports b-lactam antibiotics, the antitumor agent, bestatin, and various protease inhibitors) Back     alignment and domain information
>KOG2532 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF01770 Folate_carrier: Reduced folate carrier; InterPro: IPR002666 The reduced folate carrier (a transmembrane glycoprotein) transports reduced folate into mammalian cells via the carrier mediated mechanism (as opposed to the receptor mediated mechanism) it also transports cytotoxic folate analogues used in chemotherapy [], such as methotrexate (MTX) Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0254 consensus Predicted transporter (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>TIGR00769 AAA ADP/ATP carrier protein family Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>KOG3764 consensus Vesicular amine transporter [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>KOG3762 consensus Predicted transporter [General function prediction only] Back     alignment and domain information
>KOG3574 consensus Acetyl-CoA transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0252 consensus Inorganic phosphate transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG3098 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4332 consensus Predicted sugar transporter [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2615 consensus Permease of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>KOG0637 consensus Sucrose transporter and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF13000 Acatn: Acetyl-coenzyme A transporter 1; InterPro: IPR024371 Acetyl-coenzyme A transporter 1 (also known as acatn) is a multipass transmembrane protein that appears to promote 9-O-acetylation in gangliosides [, ] Back     alignment and domain information
>KOG0255 consensus Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>PF02487 CLN3: CLN3 protein; InterPro: IPR003492 Batten's disease, the juvenile variant of neuronal ceroid lipofuscionosis (NCL), is a recessively inherited disorder affecting children of 5-10 years of age Back     alignment and domain information
>KOG1237 consensus H+/oligopeptide symporter [Amino acid transport and metabolism] Back     alignment and domain information
>PF06963 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 This entry represents the solute carrier family 40 member 1 family of proteins, also known as Ferroportin 1 Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>PF03219 TLC: TLC ATP/ADP transporter; InterPro: IPR004667 These proteins are members of the ATP:ADP Antiporter (AAA) family, which consists of nucleotide transporters that have 12 GES predicted transmembrane regions Back     alignment and domain information
>KOG1479 consensus Nucleoside transporter [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG2533 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF00854 PTR2: POT family; InterPro: IPR000109 This entry represents the POT (proton-dependent oligopeptide transport) family, which all appear to be proton dependent transporters Back     alignment and domain information
>KOG3762 consensus Predicted transporter [General function prediction only] Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>TIGR00880 2_A_01_02 Multidrug resistance protein Back     alignment and domain information
>PF06963 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 This entry represents the solute carrier family 40 member 1 family of proteins, also known as Ferroportin 1 Back     alignment and domain information
>KOG2816 consensus Predicted transporter ADD1 (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>COG3104 PTR2 Dipeptide/tripeptide permease [Amino acid transport and metabolism] Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>COG3202 ATP/ADP translocase [Energy production and conversion] Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>COG5336 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG3097 consensus Predicted membrane protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query308
4gby_A 491 The Structure Of The Mfs (Major Facilitator Superfa 2e-10
>pdb|4GBY|A Chain A, The Structure Of The Mfs (Major Facilitator Superfamily) Proton:xylose Symporter Xyle Bound To D-Xylose Length = 491 Back     alignment and structure

Iteration: 1

Score = 62.8 bits (151), Expect = 2e-10, Method: Compositional matrix adjust. Identities = 42/138 (30%), Positives = 64/138 (46%), Gaps = 23/138 (16%) Query: 86 VARKGAAPLLDFGRFLAGCGIGVMSYVVPVYIAEITPKNLRAALATVNQLFIVTGALFAY 145 V G P R + G G+G+ S + P+YIAE+ P ++R L + NQ I+ G L Y Sbjct: 120 VYLAGYVPEFVIYRIIGGIGVGLASMLSPMYIAELAPAHIRGKLVSFNQFAIIFGQLLVY 179 Query: 146 VIGALMS------------WR----------ILALTGLFFIPESPRWLAMIGKNQEFEVA 183 + ++ WR +L L L+ +PESPRWL GK ++ E Sbjct: 180 CVNYFIARSGDASWLNTDGWRYMFASECIPALLFLMLLYTVPESPRWLMSRGKQEQAEGI 239 Query: 184 LSMVRGPNVDVSRELNEI 201 L + G N ++ + EI Sbjct: 240 LRKIMG-NTLATQAVQEI 256

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query308
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-06
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 46.4 bits (109), Expect = 8e-06
 Identities = 29/211 (13%), Positives = 59/211 (27%), Gaps = 66/211 (31%)

Query: 100 FLAGCGI-------GVMSYVVPVYIAEITPKNLRAALATVNQLFIVTGALFAYVIGALMS 152
           F   C I        V  ++       I+  +    L           +L    +     
Sbjct: 262 FNLSCKILLTTRFKQVTDFLSAATTTHISLDHHSMTLTPDEVK-----SLLLKYLD--CR 314

Query: 153 WRIL---ALTGLFFIPESPRWLAMIGKNQEFEVALSMVRGPNVDVSRELNEILSKRITLI 209
            + L    LT       +PR L++I +          +R   +        +   ++T I
Sbjct: 315 PQDLPREVLTT------NPRRLSIIAE---------SIR-DGLATWDNWKHVNCDKLTTI 358

Query: 210 LQESLALINQLPRVNILDLFNRRNIRFVNVYIAFYSIGMGPIPWVIMFEIFPLNIKGPGG 269
           ++ SL   N L       +F+                            +FP +   P  
Sbjct: 359 IESSL---NVLEPAEYRKMFD-------------------------RLSVFPPSAHIPTI 390

Query: 270 SLVTLVNWIGSWAISYSFILLMTWSSCGRTL 300
            L  +  W   + +  S ++++       +L
Sbjct: 391 LLSLI--W---FDVIKSDVMVVVNKLHKYSL 416


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query308
4gc0_A491 D-xylose-proton symporter; MFS, transport protein; 100.0
3o7q_A 438 L-fucose-proton symporter; transporter, multi-PASS 99.79
1pw4_A451 Glycerol-3-phosphate transporter; transmembrane, i 99.78
2gfp_A375 EMRD, multidrug resistance protein D; membrane pro 99.7
4aps_A 491 DI-OR tripeptide H+ symporter; transport protein, 99.66
2xut_A 524 Proton/peptide symporter family protein; transport 99.46
2cfq_A417 Lactose permease; transport, transport mechanism, 99.21
1pw4_A451 Glycerol-3-phosphate transporter; transmembrane, i 98.64
4gc0_A491 D-xylose-proton symporter; MFS, transport protein; 98.62
3o7q_A438 L-fucose-proton symporter; transporter, multi-PASS 98.41
2cfq_A417 Lactose permease; transport, transport mechanism, 98.36
4aps_A491 DI-OR tripeptide H+ symporter; transport protein, 98.24
2gfp_A375 EMRD, multidrug resistance protein D; membrane pro 98.14
2xut_A524 Proton/peptide symporter family protein; transport 95.89
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
Probab=100.00  E-value=2.9e-33  Score=258.32  Aligned_cols=274  Identities=25%  Similarity=0.458  Sum_probs=196.6

Q ss_pred             ccCCccccccccccccccccC--------CChhHHHHHHHHHHHHHHHHHHHHhhhhhcccccchH--------------
Q 048448           35 RKNQAKEQQNPTQFGIMADLK--------ESYAEYSLFGSILTIGAIIGAITSGRIADWVARKGAA--------------   92 (308)
Q Consensus        35 ~~~~~~~~~~~~~~~l~~~~~--------l~~~~~~~~~s~~~~g~~~g~~~~g~l~d~~Grr~~~--------------   92 (308)
                      .+|++.+..+...+.+.++++        .++.+.+++.+++.+|.++|++++|+++||+|||+++              
T Consensus        23 ~~Gyd~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~s~~~~G~~iG~~~~G~laDr~GRk~~l~~~~~l~~i~~i~~  102 (491)
T 4gc0_A           23 LFGYDTAVISGTVESLNTVFVAPQNLSESAANSLLGFCVASALIGCIIGGALGGYCSNRFGRRDSLKIAAVLFFISGVGS  102 (491)
T ss_dssp             HHHHHHHGGGGTHHHHHHHHTGGGCCCHHHHHHHHHHHHHTHHHHHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHhcCCCCCCcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHHHHHH
Confidence            455666677777777766653        2345678999999999999999999999999999987              


Q ss_pred             ------------------------HHHHHHHHHHHhhhhccccchhhhhhccCCCCCchhHHHHHHHHHHHHHHHHHHHh
Q 048448           93 ------------------------PLLDFGRFLAGCGIGVMSYVVPVYIAEITPKNLRAALATVNQLFIVTGALFAYVIG  148 (308)
Q Consensus        93 ------------------------~~~~~~r~l~G~~~g~~~~~~~~~~~e~~~~~~r~~~~~~~~~~~~~g~~~~~~l~  148 (308)
                                              ++++++|+++|++.|+..++.+.+++|++|+++|++..++.+.+..+|.++++.++
T Consensus       103 a~~~~~~~~~~~~~~~~~~~a~~~~~l~~~R~l~G~g~G~~~~~~~~~i~E~~p~~~rg~~~~~~~~~~~~g~~~~~~~~  182 (491)
T 4gc0_A          103 AWPELGFTSINPDNTVPVYLAGYVPEFVIYRIIGGIGVGLASMLSPMYIAELAPAHIRGKLVSFNQFAIIFGQLLVYCVN  182 (491)
T ss_dssp             HCTTTTTSCSSSSSSCCGGGGGCHHHHHHHHHHHHHHHHHHHHHHHHHHHTTSCGGGHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHhhhhhhhcchhHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHhhCCHHhhhhhHHhhhhhhhhhhhhhhhcc
Confidence                                    24788999999999999999999999999999999999999999999999888776


Q ss_pred             hhh------------hhHHHHHh----------hhcccccCchhHhhcCChHHHHHHHHHhcCCCcchHHHHHHH--HHH
Q 048448          149 ALM------------SWRILALT----------GLFFIPESPRWLAMIGKNQEFEVALSMVRGPNVDVSRELNEI--LSK  204 (308)
Q Consensus       149 ~~~------------~w~~~~~~----------~~~~~~esp~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~--~~~  204 (308)
                      ...            .||+.+.+          ..+++||||+|+..+++.+++++.+++..+++...++..+..  ...
T Consensus       183 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~peSp~~L~~~~~~~~a~~~l~~~~~~~~~~~~~~~~~~~~~~  262 (491)
T 4gc0_A          183 YFIARSGDASWLNTDGWRYMFASECIPALLFLMLLYTVPESPRWLMSRGKQEQAEGILRKIMGNTLATQAVQEIKHSLDH  262 (491)
T ss_dssp             HHHHTTSCTTTTTTTHHHHHHHTTHHHHHHHHHHGGGSCCCHHHHHHTTCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             hhhccccccccccchhhHHHhhhhhhhhhhhhhhhhcCCCChHHHHHcCchhHHHHhHHHhcCCchhHHHHHHHHHHHHh
Confidence            543            47766554          557899999999999999999999888765432211111110  000


Q ss_pred             ------------HHHHHHH-------------------HHHHHHhcCCccc---------------------hhhccccc
Q 048448          205 ------------RITLILQ-------------------ESLALINQLPRVN---------------------ILDLFNRR  232 (308)
Q Consensus       205 ------------~~~~~~~-------------------~~~~~~~~~~~~~---------------------~~~l~~~~  232 (308)
                                  ..+....                   .............                     +.|-+.++
T Consensus       263 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~dr~Grr  342 (491)
T 4gc0_A          263 GRKTGGRLLMFGVGVIVIGVMLSIFQQFVGINVVLYYAPEVFKTLGASTDIALLQTIIVGVINLTFTVLAIMTVDKFGRK  342 (491)
T ss_dssp             HHHHTTHHHHSCCTHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHSSCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCSH
T ss_pred             hhhhhhHHHHhcccHHHHHHHHHHHHHHhhhhHHHhcchHHHHhcCCCccchhhHHHHHHHHHHHHHHHHHHHHHhhcCc
Confidence                        0000000                   0000000000000                     00000000


Q ss_pred             hhhHH-----------------------------HHHHHhhhccccccccceecccCCCCchhhHhHHHHHHHHHHHHHH
Q 048448          233 NIRFV-----------------------------NVYIAFYSIGMGPIPWVIMFEIFPLNIKGPGGSLVTLVNWIGSWAI  283 (308)
Q Consensus       233 ~~~~~-----------------------------~~~~~~~~~g~~~~~~~~~~e~~p~~~r~~~~g~~~~~~~~~~~i~  283 (308)
                      .....                             +++..+++.+++|++|++.+|++|++.|+++.|++++++++++++.
T Consensus       343 ~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~E~fPt~~R~~~~g~~~~~~~~~~~i~  422 (491)
T 4gc0_A          343 PLQIIGALGMAIGMFSLGTAFYTQAPGIVALLSMLFYVAAFAMSWGPVCWVLLSEIFPNAIRGKALAIAVAAQWLANYFV  422 (491)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHTTTTHHHHHHHHHSSCTTTHHHHHHHHHHHHHHHHHHH
T ss_pred             chhccchHHHHHHHHHHHHHHhcccchHHHHHHHHHHHHHHHhHHHHHHHHHHHHhCCHhHHHHHHHHHHHHHHHHHHHH
Confidence            00000                             4445667778889999999999999999999999999999999999


Q ss_pred             HHHHHHHHHhhc--------------------------------CCCCHHHHHhhcC
Q 048448          284 SYSFILLMTWSS--------------------------------CGRTLEEVQASVS  308 (308)
Q Consensus       284 ~~~~~~~~~~~~--------------------------------~g~~~~~~~~~~~  308 (308)
                      ++++|.+.+...                                ||||+||||++|+
T Consensus       423 ~~~~p~l~~~~~~~~~~~~~~~~~i~~~~~~~~~i~~~~~~PETkg~tLeei~~~f~  479 (491)
T 4gc0_A          423 SWTFPMMDKNSWLVAHFHNGFSYWIYGCMGVLAALFMWKFVPETKGKTLEELEALWE  479 (491)
T ss_dssp             HTHHHHHCHHHHHHHHHTTCHHHHHHHHHHHHHHHHHHHHCCCCTTCCHHHHGGGTC
T ss_pred             HHHHHHHHHHHHHHhhhhhhHHHHHHHHHHHHHHHHHHheecCCCCCCHHHHHHHhC
Confidence            999988754211                                9999999999986



>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 308
d1pw4a_ 447 f.38.1.1 (A:) Glycerol-3-phosphate transporter {Es 8e-06
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Length = 447 Back     information, alignment and structure

class: Membrane and cell surface proteins and peptides
fold: MFS general substrate transporter
superfamily: MFS general substrate transporter
family: Glycerol-3-phosphate transporter
domain: Glycerol-3-phosphate transporter
species: Escherichia coli [TaxId: 562]
 Score = 44.7 bits (104), Expect = 8e-06
 Identities = 27/269 (10%), Positives = 65/269 (24%), Gaps = 33/269 (12%)

Query: 50  IMADLKESYAEYSLFGSILTIGAIIGAITSGRIADWVARK-------------------- 89
            + +   S  +     S ++I         G ++D    +                    
Sbjct: 50  YLVEQGFSRGDLGFALSGISIAYGFSKFIMGSVSDRSNPRVFLPAGLILAAAVMLFMGFV 109

Query: 90  ----GAAPLLDFGRFLAGCGIGVMSYVVPVYIAEITPKNLRAALATVNQLFIVTGALFAY 145
                +  ++    FL G   G+        +     +  R  + +V       G     
Sbjct: 110 PWATSSIAVMFVLLFLCGWFQGMGWPPCGRTMVHWWSQKERGGIVSVWNCAHNVGGGIPP 169

Query: 146 VIGALMSWRILALTGLFFIPESPRWLAMIGKNQEFEVALSMVRGPNVDVSRELNEILSKR 205
           ++  L            ++P     L  +          +     +   S  L  I   +
Sbjct: 170 LLFLLGMAWFNDWHAALYMPAFCAILVAL---------FAFAMMRDTPQSCGLPPIEEYK 220

Query: 206 ITLILQESLALINQLPRVNILDLFNRRNIRFVNVYIAFYSIGMGPIPWVIMFEIFPLNIK 265
                  +     +L    I   +   N     + IA   + +     +     +   +K
Sbjct: 221 NDYPDDYNEKAEQELTAKQIFMQYVLPNKLLWYIAIANVFVYLLRYGILDWSPTYLKEVK 280

Query: 266 GPGGSLVTLVNWIGSWAISYSFILLMTWS 294
                  +   ++  +A     +L    S
Sbjct: 281 HFALDKSSWAYFLYEYAGIPGTLLCGWMS 309


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query308
d1pw4a_447 Glycerol-3-phosphate transporter {Escherichia coli 99.82
d1pv7a_ 417 Lactose permease {Escherichia coli [TaxId: 562]} 99.41
d1pv7a_417 Lactose permease {Escherichia coli [TaxId: 562]} 98.56
d1pw4a_447 Glycerol-3-phosphate transporter {Escherichia coli 98.54
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: MFS general substrate transporter
superfamily: MFS general substrate transporter
family: Glycerol-3-phosphate transporter
domain: Glycerol-3-phosphate transporter
species: Escherichia coli [TaxId: 562]
Probab=99.82  E-value=9.8e-22  Score=176.02  Aligned_cols=124  Identities=12%  Similarity=0.051  Sum_probs=105.2

Q ss_pred             cccccccccCCChhHHHHHHHHHHHHHHHHHHHHhhhhhcccccchH------------------------HHHHHHHHH
Q 048448           46 TQFGIMADLKESYAEYSLFGSILTIGAIIGAITSGRIADWVARKGAA------------------------PLLDFGRFL  101 (308)
Q Consensus        46 ~~~~l~~~~~l~~~~~~~~~s~~~~g~~~g~~~~g~l~d~~Grr~~~------------------------~~~~~~r~l  101 (308)
                      ..|.+. ++|++.++.|++.+++.+++.++++++|+++||+|||+++                        ..+++.|++
T Consensus        47 ~~p~~~-~~g~s~~~~g~~~s~~~~~~~~~~~~~G~l~Dr~g~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  125 (447)
T d1pw4a_          47 AMPYLV-EQGFSRGDLGFALSGISIAYGFSKFIMGSVSDRSNPRVFLPAGLILAAAVMLFMGFVPWATSSIAVMFVLLFL  125 (447)
T ss_dssp             HHHHTT-SSTTCSSCHHHHHHHHHHHHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHHHHHHHHCHHHHSSSSHHHHHHHH
T ss_pred             HHHHHH-HhCcCHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCchHHHHHHHHHHHHHHhhccccchhhhhHHHHHHHHHH
Confidence            345554 6899999999999999999999999999999999999987                        567889999


Q ss_pred             HHhhhhccccchhhhhhccCCCCCchhHHHHHHHHHHHHHHHHHHHhhhh-----hhHHHHHh-----------hhcccc
Q 048448          102 AGCGIGVMSYVVPVYIAEITPKNLRAALATVNQLFIVTGALFAYVIGALM-----SWRILALT-----------GLFFIP  165 (308)
Q Consensus       102 ~G~~~g~~~~~~~~~~~e~~~~~~r~~~~~~~~~~~~~g~~~~~~l~~~~-----~w~~~~~~-----------~~~~~~  165 (308)
                      .|++.|...+....++.|++|+++|++.+++.+.+..+|..+++.+....     +||+.+++           ...+.+
T Consensus       126 ~g~~~~~~~~~~~~~i~~~~~~~~r~~~~~~~~~~~~~g~~i~~~~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~  205 (447)
T d1pw4a_         126 CGWFQGMGWPPCGRTMVHWWSQKERGGIVSVWNCAHNVGGGIPPLLFLLGMAWFNDWHAALYMPAFCAILVALFAFAMMR  205 (447)
T ss_dssp             HHHHHHHTHHHHHHHHHTTCTTTHHHHHHHHHHHHHHHHHTSHHHHHHHHHHHTCCSTTCTHHHHHHHHHHHHHHHHHCC
T ss_pred             HHHhhhhhhhHHHHHHHHHHHhhcccccccccccccchhhhhhhhhhhhHhhhhhcccccchhhhhhHHHHHHHHHHhcc
Confidence            99999999999999999999999999999999999999988887765543     67765544           345566


Q ss_pred             cCchh
Q 048448          166 ESPRW  170 (308)
Q Consensus       166 esp~~  170 (308)
                      ++|+.
T Consensus       206 ~~~~~  210 (447)
T d1pw4a_         206 DTPQS  210 (447)
T ss_dssp             CSSTT
T ss_pred             cchhh
Confidence            66643



>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure