Citrus Sinensis ID: 048467
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 198 | ||||||
| 357502825 | 339 | Aldo/keto reductase [Medicago truncatula | 0.732 | 0.427 | 0.744 | 5e-58 | |
| 217073738 | 339 | unknown [Medicago truncatula] gi|3885195 | 0.732 | 0.427 | 0.744 | 6e-58 | |
| 357502827 | 220 | Aldo/keto reductase [Medicago truncatula | 0.732 | 0.659 | 0.744 | 9e-58 | |
| 449468806 | 342 | PREDICTED: probable aldo-keto reductase | 0.732 | 0.423 | 0.778 | 3e-57 | |
| 449484655 | 342 | PREDICTED: probable aldo-keto reductase | 0.732 | 0.423 | 0.778 | 7e-57 | |
| 62526573 | 344 | aldo/keto reductase AKR [Manihot esculen | 0.732 | 0.421 | 0.751 | 3e-56 | |
| 224131488 | 343 | predicted protein [Populus trichocarpa] | 0.732 | 0.422 | 0.748 | 3e-56 | |
| 225433674 | 341 | PREDICTED: auxin-induced protein PCNT115 | 0.732 | 0.425 | 0.765 | 4e-56 | |
| 147767361 | 341 | hypothetical protein VITISV_040294 [Viti | 0.732 | 0.425 | 0.765 | 4e-56 | |
| 224069573 | 343 | predicted protein [Populus trichocarpa] | 0.732 | 0.422 | 0.746 | 4e-56 |
| >gi|357502825|ref|XP_003621701.1| Aldo/keto reductase [Medicago truncatula] gi|124360844|gb|ABN08816.1| Aldo/keto reductase [Medicago truncatula] gi|355496716|gb|AES77919.1| Aldo/keto reductase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Score = 229 bits (584), Expect = 5e-58, Method: Compositional matrix adjust.
Identities = 111/149 (74%), Positives = 127/149 (85%), Gaps = 4/149 (2%)
Query: 5 IKLSFFH--PKPKSDTIALIHHAIDSGITILDTSDAYGPHTNEILPGKALKARYRGRVEL 62
+ +S F+ PKP++D IALIHHAI SG+T LDTSD YGPHTNE+L GKALK R +VEL
Sbjct: 24 MSMSAFYGPPKPQTDMIALIHHAIQSGVTFLDTSDIYGPHTNELLLGKALKGGVREKVEL 83
Query: 63 ATKFGIRYEDGQYSYCGDPAYVRAACEARLKRLDVDCIDLYYQHRIDTKVPIEVTIGELK 122
ATKFG +Y +G++ CGDPAYVR ACEA LKRLD+DCIDLYYQHRIDT++PIE+TIGELK
Sbjct: 84 ATKFGAKYTEGKFEICGDPAYVREACEASLKRLDIDCIDLYYQHRIDTRLPIEITIGELK 143
Query: 123 KLVEEGKIKYIGLSEASASTIRRAR--HP 149
KLVEEGKIKYIGLSEASASTIRRA HP
Sbjct: 144 KLVEEGKIKYIGLSEASASTIRRAHAVHP 172
|
Source: Medicago truncatula Species: Medicago truncatula Genus: Medicago Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|217073738|gb|ACJ85229.1| unknown [Medicago truncatula] gi|388519533|gb|AFK47828.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|357502827|ref|XP_003621702.1| Aldo/keto reductase [Medicago truncatula] gi|355496717|gb|AES77920.1| Aldo/keto reductase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|449468806|ref|XP_004152112.1| PREDICTED: probable aldo-keto reductase 2-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449484655|ref|XP_004156942.1| PREDICTED: probable aldo-keto reductase 4-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|62526573|gb|AAX84672.1| aldo/keto reductase AKR [Manihot esculenta] | Back alignment and taxonomy information |
|---|
| >gi|224131488|ref|XP_002321097.1| predicted protein [Populus trichocarpa] gi|222861870|gb|EEE99412.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225433674|ref|XP_002266027.1| PREDICTED: auxin-induced protein PCNT115 isoform 1 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147767361|emb|CAN68994.1| hypothetical protein VITISV_040294 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224069573|ref|XP_002303002.1| predicted protein [Populus trichocarpa] gi|222844728|gb|EEE82275.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 198 | ||||||
| TAIR|locus:2036504 | 345 | ATB2 [Arabidopsis thaliana (ta | 0.722 | 0.414 | 0.734 | 1.7e-52 | |
| TAIR|locus:2036611 | 345 | AT1G60690 "AT1G60690" [Arabido | 0.691 | 0.397 | 0.769 | 5.6e-52 | |
| TAIR|locus:2196446 | 344 | AT1G10810 "AT1G10810" [Arabido | 0.722 | 0.415 | 0.734 | 9.5e-50 | |
| TAIR|locus:2036591 | 346 | AT1G60680 "AT1G60680" [Arabido | 0.696 | 0.398 | 0.723 | 5.2e-49 | |
| TAIR|locus:2036551 | 330 | AT1G60750 [Arabidopsis thalian | 0.722 | 0.433 | 0.702 | 5.2e-49 | |
| TIGR_CMR|SPO_A0345 | 327 | SPO_A0345 "oxidoreductase, ald | 0.707 | 0.428 | 0.482 | 3.4e-29 | |
| TIGR_CMR|GSU_3126 | 334 | GSU_3126 "oxidoreductase, aldo | 0.752 | 0.446 | 0.452 | 1.5e-28 | |
| POMBASE|SPAC1F7.12 | 340 | yak3 "aldose reductase ARK13 f | 0.702 | 0.408 | 0.471 | 1.9e-26 | |
| ASPGD|ASPL0000072041 | 351 | AN8733 [Emericella nidulans (t | 0.707 | 0.398 | 0.414 | 1.3e-22 | |
| ASPGD|ASPL0000051701 | 339 | AN10217 [Emericella nidulans ( | 0.681 | 0.398 | 0.416 | 6.3e-21 |
| TAIR|locus:2036504 ATB2 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 544 (196.6 bits), Expect = 1.7e-52, P = 1.7e-52
Identities = 108/147 (73%), Positives = 123/147 (83%)
Query: 7 LSFFH--PKPKSDTIALIHHAIDSGITILDTSDAYGPHTNEILPGKALKARYRGRVELAT 64
LS F+ PKP+++ IALIHHAI SG+T+LDTSD YGP TNE+L GKALK R +VELAT
Sbjct: 29 LSAFYGAPKPENEAIALIHHAIHSGVTLLDTSDIYGPETNEVLLGKALKDGVREKVELAT 88
Query: 65 KFGIRYEDGQYSYCGDPAYVRAACEARLKRLDVDCIDLYYQHRIDTKVPIEVTIGELKKL 124
KFGI Y +G+ GDP YVRAACEA LKRLD+ CIDLYYQHR+DT+VPIE+T+GELKKL
Sbjct: 89 KFGISYAEGKREVRGDPEYVRAACEASLKRLDIACIDLYYQHRVDTRVPIEITMGELKKL 148
Query: 125 VEEGKIKYIGLSEASASTIRRAR--HP 149
VEEGKIKYIGLSEASASTIRRA HP
Sbjct: 149 VEEGKIKYIGLSEASASTIRRAHAVHP 175
|
|
| TAIR|locus:2036611 AT1G60690 "AT1G60690" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2196446 AT1G10810 "AT1G10810" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2036591 AT1G60680 "AT1G60680" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2036551 AT1G60750 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SPO_A0345 SPO_A0345 "oxidoreductase, aldo/keto reductase family" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_3126 GSU_3126 "oxidoreductase, aldo/keto reductase family" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPAC1F7.12 yak3 "aldose reductase ARK13 family YakC" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000072041 AN8733 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000051701 AN10217 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 198 | |||
| COG0667 | 316 | COG0667, Tas, Predicted oxidoreductases (related t | 5e-47 | |
| cd06660 | 285 | cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) | 1e-44 | |
| pfam00248 | 277 | pfam00248, Aldo_ket_red, Aldo/keto reductase famil | 2e-40 | |
| PRK09912 | 346 | PRK09912, PRK09912, L-glyceraldehyde 3-phosphate r | 1e-18 | |
| COG0656 | 280 | COG0656, ARA1, Aldo/keto reductases, related to di | 1e-18 | |
| PRK10376 | 290 | PRK10376, PRK10376, putative oxidoreductase; Provi | 6e-16 | |
| PLN02587 | 314 | PLN02587, PLN02587, L-galactose dehydrogenase | 8e-15 | |
| COG4989 | 298 | COG4989, COG4989, Predicted oxidoreductase [Genera | 1e-14 | |
| COG1453 | 391 | COG1453, COG1453, Predicted oxidoreductases of the | 2e-12 | |
| PRK10625 | 346 | PRK10625, tas, putative aldo-keto reductase; Provi | 2e-08 | |
| PRK11565 | 275 | PRK11565, dkgA, 2,5-diketo-D-gluconate reductase A | 4e-07 | |
| TIGR01293 | 317 | TIGR01293, Kv_beta, voltage-dependent potassium ch | 2e-06 |
| >gnl|CDD|223739 COG0667, Tas, Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] | Back alignment and domain information |
|---|
Score = 156 bits (396), Expect = 5e-47
Identities = 59/138 (42%), Positives = 81/138 (58%), Gaps = 3/138 (2%)
Query: 14 PKSDTIALIHHAIDSGITILDTSDAYGPHTNEILPGKALKAR-YRGRVELATKFGIRYED 72
+++ I ++ A+D+GI DT+D YG +E + G+ALK R R +V +ATK G R D
Sbjct: 31 EEAEAIEILDAALDAGINFFDTADVYGDGRSEEILGEALKERGRRDKVVIATKVGYRPGD 90
Query: 73 GQYS--YCGDPAYVRAACEARLKRLDVDCIDLYYQHRIDTKVPIEVTIGELKKLVEEGKI 130
+ + ++R A EA LKRL D IDLY HR D + PIE T+ L +LV EGKI
Sbjct: 91 PGPNGVFGLSRDHIRRAVEASLKRLGTDYIDLYQLHRPDPETPIEETLEALDELVREGKI 150
Query: 131 KYIGLSEASASTIRRARH 148
+YIG+S SA I A
Sbjct: 151 RYIGVSNYSAEQIAEALA 168
|
Length = 316 |
| >gnl|CDD|119408 cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols | Back alignment and domain information |
|---|
| >gnl|CDD|215817 pfam00248, Aldo_ket_red, Aldo/keto reductase family | Back alignment and domain information |
|---|
| >gnl|CDD|182140 PRK09912, PRK09912, L-glyceraldehyde 3-phosphate reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223729 COG0656, ARA1, Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|236676 PRK10376, PRK10376, putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178198 PLN02587, PLN02587, L-galactose dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|227322 COG4989, COG4989, Predicted oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224370 COG1453, COG1453, Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|236727 PRK10625, tas, putative aldo-keto reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183203 PRK11565, dkgA, 2,5-diketo-D-gluconate reductase A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213602 TIGR01293, Kv_beta, voltage-dependent potassium channel beta subunit, animal | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 198 | |||
| COG0667 | 316 | Tas Predicted oxidoreductases (related to aryl-alc | 100.0 | |
| COG0656 | 280 | ARA1 Aldo/keto reductases, related to diketogulona | 100.0 | |
| KOG1575 | 336 | consensus Voltage-gated shaker-like K+ channel, su | 100.0 | |
| KOG1577 | 300 | consensus Aldo/keto reductase family proteins [Gen | 100.0 | |
| TIGR01293 | 317 | Kv_beta voltage-dependent potassium channel beta s | 100.0 | |
| PRK09912 | 346 | L-glyceraldehyde 3-phosphate reductase; Provisiona | 100.0 | |
| PF00248 | 283 | Aldo_ket_red: Aldo/keto reductase family; InterPro | 100.0 | |
| PRK10376 | 290 | putative oxidoreductase; Provisional | 100.0 | |
| PLN02587 | 314 | L-galactose dehydrogenase | 100.0 | |
| PRK11172 | 267 | dkgB 2,5-diketo-D-gluconate reductase B; Provision | 100.0 | |
| PRK10625 | 346 | tas putative aldo-keto reductase; Provisional | 100.0 | |
| cd06660 | 285 | Aldo_ket_red Aldo-keto reductases (AKRs) are a sup | 100.0 | |
| PRK14863 | 292 | bifunctional regulator KidO; Provisional | 99.97 | |
| PRK11565 | 275 | dkgA 2,5-diketo-D-gluconate reductase A; Provision | 99.97 | |
| COG4989 | 298 | Predicted oxidoreductase [General function predict | 99.96 | |
| KOG1576 | 342 | consensus Predicted oxidoreductase [Energy product | 99.96 | |
| COG1453 | 391 | Predicted oxidoreductases of the aldo/keto reducta | 99.92 | |
| KOG3023 | 285 | consensus Glutamate-cysteine ligase regulatory sub | 97.4 | |
| PRK13796 | 365 | GTPase YqeH; Provisional | 88.42 | |
| COG1748 | 389 | LYS9 Saccharopine dehydrogenase and related protei | 84.66 | |
| PF03102 | 241 | NeuB: NeuB family; InterPro: IPR013132 NeuB is the | 83.76 | |
| PF07555 | 306 | NAGidase: beta-N-acetylglucosaminidase ; InterPro: | 80.47 |
| >COG0667 Tas Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] | Back alignment and domain information |
|---|
Probab=100.00 E-value=6.3e-37 Score=259.30 Aligned_cols=177 Identities=36% Similarity=0.517 Sum_probs=144.9
Q ss_pred CCccCC-CCCC---CChHHHHHHHHHHHHcCCCeEeCCCCCCCCChhHHHHHHhhhcc-CCcEEEEEeeccccCC-CCc-
Q 048467 3 NNIKLS-FFHP---KPKSDTIALIHHAIDSGITILDTSDAYGPHTNEILPGKALKARY-RGRVELATKFGIRYED-GQY- 75 (198)
Q Consensus 3 ~~~~~~-~g~~---~~~~~~~~~l~~A~~~Gi~~~DtA~~Yg~g~sE~~~G~~l~~~~-R~~~~i~tK~~~~~~~-~~~- 75 (198)
.++|++ +|.. .+.+++.++|++|+++||||||||+.||.|.||+++|++|+... |++++|+||++....+ ...
T Consensus 16 lglG~~~~g~~~~~~~~~~a~~il~~A~d~Gin~~DTA~~Yg~g~sE~ilG~~l~~~~~Rd~vvIaTK~g~~~~~~~~~~ 95 (316)
T COG0667 16 LGLGTMTLGGDTDDEEEAEAIEILDAALDAGINFFDTADVYGDGRSEEILGEALKERGRRDKVVIATKVGYRPGDPGPNG 95 (316)
T ss_pred eeeeccccCCCCCchhhhHHHHHHHHHHHcCCCEEECccccCCCchHHHHHHHHhccCCCCeEEEEEeeccCCCCCCCCc
Confidence 455553 4442 34557778999999999999999999999999999999999944 8999999999877642 222
Q ss_pred ccCCCHHHHHHHHHHHHHhcCCCccceEEeccCCCCCChHHHHHHHHHHHHcCcCcEEEecCCCHHHHHHHc-C--Cc-c
Q 048467 76 SYCGDPAYVRAACEARLKRLDVDCIDLYYQHRIDTKVPIEVTIGELKKLVEEGKIKYIGLSEASASTIRRAR-H--PS-N 151 (198)
Q Consensus 76 ~~~~~~~~i~~~~~~sL~~L~~~~lDl~~lh~p~~~~~~~~~~~~l~~l~~~G~ir~iGvSn~~~~~~~~~~-~--p~-~ 151 (198)
..+.+++.|+++++.||++||||||||||+|+||+.+|.++++++|.+|+++|||++||+||++.+++.+++ . |+ .
T Consensus 96 ~~~~s~~~i~~~v~~SL~RLgtd~IDl~~iH~~d~~~p~~e~~~aL~~l~~~G~ir~iG~S~~~~~~i~~a~~~~~~~~~ 175 (316)
T COG0667 96 VFGLSRDHIRRAVEASLKRLGTDYIDLYQLHRPDPETPIEETLEALDELVREGKIRYIGVSNYSAEQIAEALAVAAPIDS 175 (316)
T ss_pred cCCCCHHHHHHHHHHHHHHhCCCceeEEEeCCCCCCCCHHHHHHHHHHHHHcCCeeEEEecCCCHHHHHHHHHhcCCcee
Confidence 257899999999999999999999999999999999999999999999999999999999999999999998 2 33 3
Q ss_pred cccccCcee------eeecc----------CCCCcccccCceee
Q 048467 152 NSCAVGMVL------VVTRC----------GGRDCSYLQGTWHW 179 (198)
Q Consensus 152 ~~~~~~~~~------~~~~~----------~~~~~~~~~g~~~~ 179 (198)
.+..++..+ +...| .+...|+++|++.-
T Consensus 176 ~Q~~ynl~~R~~e~~l~~~~~~~gi~~~~~spla~G~Ltgk~~~ 219 (316)
T COG0667 176 LQPEYNLLERDAEKELLPLCREEGIGLLAYSPLASGLLTGKYLP 219 (316)
T ss_pred ecccCccccccchhHHHHHHHHcCCeEEEecCccccccCCCcCC
Confidence 344444433 11122 56777888998865
|
|
| >COG0656 ARA1 Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1575 consensus Voltage-gated shaker-like K+ channel, subunit beta/KCNAB [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG1577 consensus Aldo/keto reductase family proteins [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01293 Kv_beta voltage-dependent potassium channel beta subunit, animal | Back alignment and domain information |
|---|
| >PRK09912 L-glyceraldehyde 3-phosphate reductase; Provisional | Back alignment and domain information |
|---|
| >PF00248 Aldo_ket_red: Aldo/keto reductase family; InterPro: IPR023210 The aldo-keto reductase family includes a number of related monomeric NADPH-dependent oxidoreductases, such as aldehyde reductase, aldose reductase, prostaglandin F synthase, xylose reductase, rho crystallin, and many others [] | Back alignment and domain information |
|---|
| >PRK10376 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PLN02587 L-galactose dehydrogenase | Back alignment and domain information |
|---|
| >PRK11172 dkgB 2,5-diketo-D-gluconate reductase B; Provisional | Back alignment and domain information |
|---|
| >PRK10625 tas putative aldo-keto reductase; Provisional | Back alignment and domain information |
|---|
| >cd06660 Aldo_ket_red Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols | Back alignment and domain information |
|---|
| >PRK14863 bifunctional regulator KidO; Provisional | Back alignment and domain information |
|---|
| >PRK11565 dkgA 2,5-diketo-D-gluconate reductase A; Provisional | Back alignment and domain information |
|---|
| >COG4989 Predicted oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1576 consensus Predicted oxidoreductase [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG1453 Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3023 consensus Glutamate-cysteine ligase regulatory subunit [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13796 GTPase YqeH; Provisional | Back alignment and domain information |
|---|
| >COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF03102 NeuB: NeuB family; InterPro: IPR013132 NeuB is the prokaryotic N-acetylneuraminic acid synthase (Neu5Ac) | Back alignment and domain information |
|---|
| >PF07555 NAGidase: beta-N-acetylglucosaminidase ; InterPro: IPR011496 This family consists of both eukaryotic and prokaryotic hyaluronidases | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 198 | ||||
| 3v0t_A | 337 | Crystal Structure Of Perakine Reductase, Founder Me | 1e-37 | ||
| 3v0u_A | 338 | Crystal Structure Of Perakine Reductase, Founder Me | 1e-37 | ||
| 3uyi_A | 337 | Crystal Structure Of Perakine Reductase, Founder Me | 6e-37 | ||
| 3v0s_A | 337 | Crystal Structure Of Perakine Reductase, Founder Me | 2e-35 | ||
| 1ynp_A | 317 | Aldo-keto Reductase Akr11c1 From Bacillus Haloduran | 3e-17 | ||
| 1pz1_A | 333 | Structure Of Nadph-Dependent Family 11 Aldo-Keto Re | 2e-15 | ||
| 4aub_A | 366 | The Complex Structure Of The Bacterial Aldo-Keto Re | 1e-14 | ||
| 3n6q_A | 346 | Crystal Structure Of Yghz From E. Coli Length = 346 | 1e-14 | ||
| 3erp_A | 353 | Structure Of Idp01002, A Putative Oxidoreductase Fr | 1e-14 | ||
| 1pyf_A | 312 | Structure Of Nadph-Dependent Family 11 Aldo-Keto Re | 2e-14 | ||
| 3n2t_A | 348 | Structure Of The Glycerol Dehydrogenase Akr11b4 Fro | 4e-14 | ||
| 1og6_A | 298 | Ydhf, An Aldo-keto Reductase From E.coli Complexed | 3e-08 | ||
| 1ur3_M | 319 | Crystal Structure Of The Apo Form Of The E.Coli Ydh | 1e-07 | ||
| 3eb4_A | 327 | Voltage-Dependent K+ Channel Beta Subunit (I211r) I | 4e-07 | ||
| 3eau_A | 327 | Voltage-Dependent K+ Channel Beta Subunit In Comple | 5e-07 | ||
| 1zsx_A | 347 | Crystal Structure Of Human Potassium Channel Kv Bet | 5e-07 | ||
| 1qrq_A | 325 | Structure Of A Voltage-Dependent K+ Channel Beta Su | 5e-07 | ||
| 1exb_A | 332 | Structure Of The Cytoplasmic Beta Subunit-T1 Assemb | 6e-07 | ||
| 2a79_A | 333 | Mammalian Shaker Kv1.2 Potassium Channel- Beta Subu | 6e-07 | ||
| 3lut_A | 367 | A Structural Model For The Full-Length Shaker Potas | 6e-07 | ||
| 2bp1_B | 360 | Structure Of The Aflatoxin Aldehyde Reductase In Co | 2e-06 | ||
| 3eb3_A | 327 | Voltage-Dependent K+ Channel Beta Subunit (W121a) I | 2e-06 | ||
| 1gve_A | 327 | Aflatoxin Aldehyde Reductase (Akr7a1) From Rat Live | 2e-06 | ||
| 4exa_A | 292 | Crystal Structure Of The Pa4992, The Putative Aldo- | 2e-05 | ||
| 2c91_A | 338 | Mouse Succinic Semialdehyde Reductase, Akr7a5 Lengt | 3e-05 | ||
| 2clp_A | 347 | Crystal Structure Of Human Aflatoxin B1 Aldehyde Re | 4e-05 | ||
| 3up8_A | 298 | Crystal Structure Of A Putative 2,5-Diketo-D-Glucon | 8e-05 | ||
| 2wzm_A | 283 | Crystal Structure Of A Mycobacterium Aldo-Keto Redu | 4e-04 | ||
| 3krb_A | 334 | Structure Of Aldose Reductase From Giardia Lamblia | 5e-04 |
| >pdb|3V0T|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 | Back alignment and structure |
|
| >pdb|3V0U|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 338 | Back alignment and structure |
| >pdb|3UYI|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 | Back alignment and structure |
| >pdb|3V0S|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 | Back alignment and structure |
| >pdb|1YNP|A Chain A, Aldo-keto Reductase Akr11c1 From Bacillus Halodurans (apo Form) Length = 317 | Back alignment and structure |
| >pdb|1PZ1|A Chain A, Structure Of Nadph-Dependent Family 11 Aldo-Keto Reductase Akr11b(Holo) Length = 333 | Back alignment and structure |
| >pdb|4AUB|A Chain A, The Complex Structure Of The Bacterial Aldo-Keto Reductase Akr14a1 With Nadp And Citrate Length = 366 | Back alignment and structure |
| >pdb|3N6Q|A Chain A, Crystal Structure Of Yghz From E. Coli Length = 346 | Back alignment and structure |
| >pdb|3ERP|A Chain A, Structure Of Idp01002, A Putative Oxidoreductase From And Essential Gene Of Salmonella Typhimurium Length = 353 | Back alignment and structure |
| >pdb|1PYF|A Chain A, Structure Of Nadph-Dependent Family 11 Aldo-Keto Reductase Akr11a(Apo) Length = 312 | Back alignment and structure |
| >pdb|3N2T|A Chain A, Structure Of The Glycerol Dehydrogenase Akr11b4 From Gluconobacter Oxydans Length = 348 | Back alignment and structure |
| >pdb|1OG6|A Chain A, Ydhf, An Aldo-keto Reductase From E.coli Complexed With Nadph Length = 298 | Back alignment and structure |
| >pdb|1UR3|M Chain M, Crystal Structure Of The Apo Form Of The E.Coli Ydhf Protein Length = 319 | Back alignment and structure |
| >pdb|3EB4|A Chain A, Voltage-Dependent K+ Channel Beta Subunit (I211r) In Complex With Cortisone Length = 327 | Back alignment and structure |
| >pdb|3EAU|A Chain A, Voltage-Dependent K+ Channel Beta Subunit In Complex With Cortisone Length = 327 | Back alignment and structure |
| >pdb|1ZSX|A Chain A, Crystal Structure Of Human Potassium Channel Kv Beta-Subunit (Kcnab2) Length = 347 | Back alignment and structure |
| >pdb|1QRQ|A Chain A, Structure Of A Voltage-Dependent K+ Channel Beta Subunit Length = 325 | Back alignment and structure |
| >pdb|1EXB|A Chain A, Structure Of The Cytoplasmic Beta Subunit-T1 Assembly Of Voltage-Dependent K Channels Length = 332 | Back alignment and structure |
| >pdb|2A79|A Chain A, Mammalian Shaker Kv1.2 Potassium Channel- Beta Subunit Complex Length = 333 | Back alignment and structure |
| >pdb|3LUT|A Chain A, A Structural Model For The Full-Length Shaker Potassium Channel Kv1.2 Length = 367 | Back alignment and structure |
| >pdb|3EB3|A Chain A, Voltage-Dependent K+ Channel Beta Subunit (W121a) In Complex With Cortisone Length = 327 | Back alignment and structure |
| >pdb|1GVE|A Chain A, Aflatoxin Aldehyde Reductase (Akr7a1) From Rat Liver Length = 327 | Back alignment and structure |
| >pdb|4EXA|A Chain A, Crystal Structure Of The Pa4992, The Putative Aldo-keto Reductase From Pseudomona Aeruginosa Length = 292 | Back alignment and structure |
| >pdb|2C91|A Chain A, Mouse Succinic Semialdehyde Reductase, Akr7a5 Length = 338 | Back alignment and structure |
| >pdb|2CLP|A Chain A, Crystal Structure Of Human Aflatoxin B1 Aldehyde Reductase Member 3 Length = 347 | Back alignment and structure |
| >pdb|3UP8|A Chain A, Crystal Structure Of A Putative 2,5-Diketo-D-Gluconic Acid Reductase B Length = 298 | Back alignment and structure |
| >pdb|2WZM|A Chain A, Crystal Structure Of A Mycobacterium Aldo-Keto Reductase In Its Apo And Liganded Form Length = 283 | Back alignment and structure |
| >pdb|3KRB|A Chain A, Structure Of Aldose Reductase From Giardia Lamblia At 1.75a Resolution Length = 334 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 198 | |||
| 1pyf_A | 312 | IOLS protein; beta-alpha barrel, aldo-keto reducta | 2e-77 | |
| 3n2t_A | 348 | Putative oxidoreductase; aldo/keto reductase super | 2e-74 | |
| 1pz1_A | 333 | GSP69, general stress protein 69; beta-alpha barre | 9e-66 | |
| 1ynp_A | 317 | Oxidoreductase, AKR11C1; aldo-keto reductase, NADP | 5e-59 | |
| 3v0s_A | 337 | Perakine reductase; AKR superfamily, oxidoreductas | 1e-56 | |
| 1ur3_M | 319 | Hypothetical oxidoreductase YDHF; NADP binding, al | 5e-54 | |
| 1gve_A | 327 | Aflatoxin B1 aldehyde reductase member 3; oxidored | 3e-35 | |
| 3erp_A | 353 | Putative oxidoreductase; funded by the national in | 5e-33 | |
| 2bp1_A | 360 | Aflatoxin B1 aldehyde reductase member 2; oxidored | 5e-33 | |
| 3n6q_A | 346 | YGHZ aldo-keto reductase; TIM barrel, oxidoreducta | 1e-32 | |
| 3eau_A | 327 | Voltage-gated potassium channel subunit beta-2; kv | 1e-30 | |
| 3lut_A | 367 | Voltage-gated potassium channel subunit beta-2; vo | 7e-30 | |
| 1lqa_A | 346 | TAS protein; TIM barrel, structure 2 function proj | 1e-22 | |
| 1qwk_A | 317 | Aldose reductase, aldo-keto reductase family 1 mem | 3e-10 | |
| 3up8_A | 298 | Putative 2,5-diketo-D-gluconic acid reductase B; n | 4e-10 | |
| 1s1p_A | 331 | Aldo-keto reductase family 1 member C3; TIM-barrel | 1e-09 | |
| 2ao0_A | 324 | Aldehyde dehydrogenase; TIM barrel, aldo-keto redu | 2e-09 | |
| 3buv_A | 326 | 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc | 2e-09 | |
| 1vp5_A | 298 | 2,5-diketo-D-gluconic acid reductase; TM1009, stru | 3e-09 | |
| 1us0_A | 316 | Aldose reductase; oxidoreductase, NADP, IDD594; HE | 3e-09 | |
| 1afs_A | 323 | 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; | 5e-09 | |
| 3krb_A | 334 | Aldose reductase; ssgcid, SBRI, emerald biostructu | 6e-09 | |
| 3o3r_A | 316 | Aldo-keto reductase family 1, member B7; aldose re | 8e-09 | |
| 4f40_A | 288 | Prostaglandin F2-alpha synthase/D-arabinose dehyd; | 1e-08 | |
| 2bgs_A | 344 | Aldose reductase; holoenzyme, aldo/keto reductase, | 1e-08 | |
| 1vbj_A | 281 | Prostaglandin F synthase; TIM barrel, oxidoreducta | 1e-08 | |
| 2wzm_A | 283 | Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 | 2e-08 | |
| 1mi3_A | 322 | Xylose reductase, XR; aldo-keto reductase, beta-al | 2e-08 | |
| 1zgd_A | 312 | Chalcone reductase; polyketide, deoxychalcone, iso | 2e-08 | |
| 3h7u_A | 335 | Aldo-keto reductase; stress response, NADP, drough | 3e-08 | |
| 4gie_A | 290 | Prostaglandin F synthase; structural genomics, nia | 3e-08 | |
| 3h7r_A | 331 | Aldo-keto reductase; stress response, NADP, drough | 4e-08 | |
| 1hw6_A | 278 | 2,5-diketo-D-gluconic acid reductase; aldo-keto re | 6e-08 | |
| 3f7j_A | 276 | YVGN protein; aldo-keto reductase, oxidoreductase; | 6e-08 | |
| 3b3e_A | 310 | YVGN protein; aldo-keto reductase, oxidoreductase; | 7e-08 | |
| 1mzr_A | 296 | 2,5-diketo-D-gluconate reductase A; alpha/beta-bar | 1e-07 | |
| 3o0k_A | 283 | Aldo/keto reductase; ssgcid, ALS collaborative cry | 1e-07 |
| >1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* Length = 312 | Back alignment and structure |
|---|
Score = 233 bits (596), Expect = 2e-77
Identities = 42/143 (29%), Positives = 72/143 (50%), Gaps = 2/143 (1%)
Query: 9 FFHPKPKSDTIALIHHAIDSGITILDTSDAYGPHTNEILPGKALKARYRGRVELATKFGI 68
+ + L+ AI +G+T+LDT+ YG +E L G+ L+ R V +ATK
Sbjct: 28 LYPNLNEETGKELVREAIRNGVTMLDTAYIYGIGRSEELIGEVLREFNREDVVIATKAAH 87
Query: 69 RYEDGQYSYCGDPAYVRAACEARLKRLDVDCIDLYYQHRIDTKVPIEVTIGELKKLVEEG 128
R + + + P +++ + + LKRL+ D IDL+Y H D P + + L ++ + G
Sbjct: 88 RKQGNDFVFDNSPDFLKKSVDESLKRLNTDYIDLFYIHFPDEHTPKDEAVNALNEMKKAG 147
Query: 129 KIKYIGLSEASASTIRRAR--HP 149
KI+ IG+S S ++ A
Sbjct: 148 KIRSIGVSNFSLEQLKEANKDGL 170
|
| >3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} Length = 348 | Back alignment and structure |
|---|
| >1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 Length = 333 | Back alignment and structure |
|---|
| >1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* Length = 317 | Back alignment and structure |
|---|
| >3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* Length = 337 | Back alignment and structure |
|---|
| >1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* Length = 319 | Back alignment and structure |
|---|
| >1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* Length = 327 | Back alignment and structure |
|---|
| >3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} Length = 353 | Back alignment and structure |
|---|
| >3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} Length = 346 | Back alignment and structure |
|---|
| >3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* Length = 327 | Back alignment and structure |
|---|
| >3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} Length = 367 | Back alignment and structure |
|---|
| >1lqa_A TAS protein; TIM barrel, structure 2 function project, S2F, structural GE oxidoreductase; HET: NDP; 1.60A {Escherichia coli} SCOP: c.1.7.1 Length = 346 | Back alignment and structure |
|---|
| >1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 Length = 317 | Back alignment and structure |
|---|
| >3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} Length = 298 | Back alignment and structure |
|---|
| >1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... Length = 331 | Back alignment and structure |
|---|
| >3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* Length = 326 | Back alignment and structure |
|---|
| >1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 Length = 298 | Back alignment and structure |
|---|
| >1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... Length = 316 | Back alignment and structure |
|---|
| >1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* Length = 323 | Back alignment and structure |
|---|
| >3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} Length = 334 | Back alignment and structure |
|---|
| >3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} PDB: 3qkz_A* Length = 316 | Back alignment and structure |
|---|
| >4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} Length = 288 | Back alignment and structure |
|---|
| >2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* Length = 344 | Back alignment and structure |
|---|
| >1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} Length = 281 | Back alignment and structure |
|---|
| >2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A Length = 283 | Back alignment and structure |
|---|
| >1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* Length = 322 | Back alignment and structure |
|---|
| >1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} Length = 312 | Back alignment and structure |
|---|
| >3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} Length = 335 | Back alignment and structure |
|---|
| >4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* Length = 290 | Back alignment and structure |
|---|
| >3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} Length = 331 | Back alignment and structure |
|---|
| >1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* Length = 278 | Back alignment and structure |
|---|
| >3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* Length = 276 | Back alignment and structure |
|---|
| >1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 Length = 296 | Back alignment and structure |
|---|
| >3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} Length = 283 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 198 | |||
| 1pyf_A | 312 | IOLS protein; beta-alpha barrel, aldo-keto reducta | 100.0 | |
| 3n6q_A | 346 | YGHZ aldo-keto reductase; TIM barrel, oxidoreducta | 100.0 | |
| 3v0s_A | 337 | Perakine reductase; AKR superfamily, oxidoreductas | 100.0 | |
| 3n2t_A | 348 | Putative oxidoreductase; aldo/keto reductase super | 100.0 | |
| 3erp_A | 353 | Putative oxidoreductase; funded by the national in | 100.0 | |
| 3eau_A | 327 | Voltage-gated potassium channel subunit beta-2; kv | 100.0 | |
| 1pz1_A | 333 | GSP69, general stress protein 69; beta-alpha barre | 100.0 | |
| 1ynp_A | 317 | Oxidoreductase, AKR11C1; aldo-keto reductase, NADP | 100.0 | |
| 3lut_A | 367 | Voltage-gated potassium channel subunit beta-2; vo | 100.0 | |
| 1ur3_M | 319 | Hypothetical oxidoreductase YDHF; NADP binding, al | 100.0 | |
| 1gve_A | 327 | Aflatoxin B1 aldehyde reductase member 3; oxidored | 100.0 | |
| 3ln3_A | 324 | Dihydrodiol dehydrogenase; putative reductase, str | 100.0 | |
| 4exb_A | 292 | Putative uncharacterized protein; aldo-keto reduct | 100.0 | |
| 2bp1_A | 360 | Aflatoxin B1 aldehyde reductase member 2; oxidored | 100.0 | |
| 3o3r_A | 316 | Aldo-keto reductase family 1, member B7; aldose re | 100.0 | |
| 3o0k_A | 283 | Aldo/keto reductase; ssgcid, ALS collaborative cry | 100.0 | |
| 3buv_A | 326 | 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc | 100.0 | |
| 1lqa_A | 346 | TAS protein; TIM barrel, structure 2 function proj | 100.0 | |
| 1vbj_A | 281 | Prostaglandin F synthase; TIM barrel, oxidoreducta | 100.0 | |
| 3up8_A | 298 | Putative 2,5-diketo-D-gluconic acid reductase B; n | 100.0 | |
| 4f40_A | 288 | Prostaglandin F2-alpha synthase/D-arabinose dehyd; | 100.0 | |
| 1us0_A | 316 | Aldose reductase; oxidoreductase, NADP, IDD594; HE | 100.0 | |
| 1hw6_A | 278 | 2,5-diketo-D-gluconic acid reductase; aldo-keto re | 100.0 | |
| 3f7j_A | 276 | YVGN protein; aldo-keto reductase, oxidoreductase; | 100.0 | |
| 1afs_A | 323 | 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; | 100.0 | |
| 1zgd_A | 312 | Chalcone reductase; polyketide, deoxychalcone, iso | 100.0 | |
| 1qwk_A | 317 | Aldose reductase, aldo-keto reductase family 1 mem | 100.0 | |
| 1s1p_A | 331 | Aldo-keto reductase family 1 member C3; TIM-barrel | 100.0 | |
| 1mi3_A | 322 | Xylose reductase, XR; aldo-keto reductase, beta-al | 100.0 | |
| 3b3e_A | 310 | YVGN protein; aldo-keto reductase, oxidoreductase; | 100.0 | |
| 4gie_A | 290 | Prostaglandin F synthase; structural genomics, nia | 100.0 | |
| 3krb_A | 334 | Aldose reductase; ssgcid, SBRI, emerald biostructu | 100.0 | |
| 2wzm_A | 283 | Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 | 100.0 | |
| 1vp5_A | 298 | 2,5-diketo-D-gluconic acid reductase; TM1009, stru | 100.0 | |
| 1mzr_A | 296 | 2,5-diketo-D-gluconate reductase A; alpha/beta-bar | 100.0 | |
| 3h7u_A | 335 | Aldo-keto reductase; stress response, NADP, drough | 100.0 | |
| 3h7r_A | 331 | Aldo-keto reductase; stress response, NADP, drough | 100.0 | |
| 2bgs_A | 344 | Aldose reductase; holoenzyme, aldo/keto reductase, | 100.0 | |
| 3b3d_A | 314 | YTBE protein, putative morphine dehydrogenase; ald | 100.0 | |
| 4gac_A | 324 | Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldhe | 100.0 | |
| 3cf4_A | 807 | Acetyl-COA decarboxylase/synthase alpha subunit; m | 87.87 |
| >1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=7.2e-38 Score=263.34 Aligned_cols=135 Identities=31% Similarity=0.518 Sum_probs=122.3
Q ss_pred CChHHHHHHHHHHHHcCCCeEeCCCCCCCCChhHHHHHHhhhccCCcEEEEEeeccccCCCCcccCCCHHHHHHHHHHHH
Q 048467 13 KPKSDTIALIHHAIDSGITILDTSDAYGPHTNEILPGKALKARYRGRVELATKFGIRYEDGQYSYCGDPAYVRAACEARL 92 (198)
Q Consensus 13 ~~~~~~~~~l~~A~~~Gi~~~DtA~~Yg~g~sE~~~G~~l~~~~R~~~~i~tK~~~~~~~~~~~~~~~~~~i~~~~~~sL 92 (198)
.+++++.++|+.|+++||||||||+.||+|.||+++|++|+..+|+++||+||++....++....+.+++.+++++++||
T Consensus 32 ~~~~~~~~~l~~Al~~Gi~~~DTA~~Yg~G~sE~~lG~al~~~~R~~~~i~TK~g~~~~~~~~~~~~~~~~i~~~~~~SL 111 (312)
T 1pyf_A 32 LNEETGKELVREAIRNGVTMLDTAYIYGIGRSEELIGEVLREFNREDVVIATKAAHRKQGNDFVFDNSPDFLKKSVDESL 111 (312)
T ss_dssp CCHHHHHHHHHHHHHTTCCEEECCTTTTTTHHHHHHHHHHTTSCGGGCEEEEEECEEEETTEEEECCCHHHHHHHHHHHH
T ss_pred CCHHHHHHHHHHHHHcCCCEEECccccCCCchHHHHHHHhhhcCCCeEEEEEEeCCCCCCCCCCCCCCHHHHHHHHHHHH
Confidence 57889999999999999999999999999999999999999767999999999763211111123578999999999999
Q ss_pred HhcCCCccceEEeccCCCCCChHHHHHHHHHHHHcCcCcEEEecCCCHHHHHHHc
Q 048467 93 KRLDVDCIDLYYQHRIDTKVPIEVTIGELKKLVEEGKIKYIGLSEASASTIRRAR 147 (198)
Q Consensus 93 ~~L~~~~lDl~~lh~p~~~~~~~~~~~~l~~l~~~G~ir~iGvSn~~~~~~~~~~ 147 (198)
++||+||||||++|+|++..+.+++|++|++|+++||||+||||||+++++++++
T Consensus 112 ~rL~~dyiDl~~lH~p~~~~~~~e~~~al~~l~~~Gkir~iGvSn~~~~~l~~~~ 166 (312)
T 1pyf_A 112 KRLNTDYIDLFYIHFPDEHTPKDEAVNALNEMKKAGKIRSIGVSNFSLEQLKEAN 166 (312)
T ss_dssp HHHTSSCBSEEEECSCCSSSCHHHHHHHHHHHHHTTSBSCEEEESCCHHHHHHHT
T ss_pred HHhCCCcEEEEEeCCCCCCCCHHHHHHHHHHHHHCCCcCEEEecCCCHHHHHHHH
Confidence 9999999999999999998899999999999999999999999999999999999
|
| >3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} SCOP: c.1.7.0 PDB: 4ast_A 4aub_A* | Back alignment and structure |
|---|
| >3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* | Back alignment and structure |
|---|
| >3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} SCOP: c.1.7.0 | Back alignment and structure |
|---|
| >3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* | Back alignment and structure |
|---|
| >1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* | Back alignment and structure |
|---|
| >3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* | Back alignment and structure |
|---|
| >1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* | Back alignment and structure |
|---|
| >3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >4exb_A Putative uncharacterized protein; aldo-keto reductase, NADP+ binding, oxidoreducta; 2.75A {Pseudomonas aeruginosa} PDB: 4exa_A | Back alignment and structure |
|---|
| >3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 3qkz_A* | Back alignment and structure |
|---|
| >3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} | Back alignment and structure |
|---|
| >3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* | Back alignment and structure |
|---|
| >1lqa_A TAS protein; TIM barrel, structure 2 function project, S2F, structural GE oxidoreductase; HET: NDP; 1.60A {Escherichia coli} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} PDB: 4g5d_A* | Back alignment and structure |
|---|
| >1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... | Back alignment and structure |
|---|
| >1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* | Back alignment and structure |
|---|
| >3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* | Back alignment and structure |
|---|
| >1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* | Back alignment and structure |
|---|
| >1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} | Back alignment and structure |
|---|
| >1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... | Back alignment and structure |
|---|
| >1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* | Back alignment and structure |
|---|
| >4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* | Back alignment and structure |
|---|
| >3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} | Back alignment and structure |
|---|
| >2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A | Back alignment and structure |
|---|
| >1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* | Back alignment and structure |
|---|
| >3b3d_A YTBE protein, putative morphine dehydrogenase; aldo-keto reductase, oxidoreductase; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >4gac_A Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldheyde reductase AKR1A4, SMAR1, oxidoreductase; HET: FLC; 1.64A {Mus musculus} PDB: 2alr_A 3h4g_A* 3cv7_A* 3fx4_A* 1ae4_A* 1cwn_A* 1hqt_A* | Back alignment and structure |
|---|
| >3cf4_A Acetyl-COA decarboxylase/synthase alpha subunit; methanomicrobia, iron-nikel-sulfur, 4Fe-NI-4S, oxidoreductas; 2.00A {Methanosarcina barkeri} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 198 | ||||
| d1pyfa_ | 311 | c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillu | 5e-21 | |
| d1lqaa_ | 346 | c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: | 2e-20 | |
| d1pz1a_ | 333 | c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillu | 4e-18 | |
| d1hqta_ | 324 | c.1.7.1 (A:) Aldose reductase (aldehyde reductase) | 2e-16 | |
| d1s1pa_ | 315 | c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (ak | 2e-16 | |
| d1afsa_ | 319 | c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase | 6e-16 | |
| d1us0a_ | 314 | c.1.7.1 (A:) Aldose reductase (aldehyde reductase) | 2e-15 | |
| d3eaua1 | 326 | c.1.7.1 (A:36-361) Voltage-dependent K+ channel be | 4e-15 | |
| d1frba_ | 315 | c.1.7.1 (A:) FR-1 (fibroblast growth factor-induce | 4e-14 | |
| d1qwka_ | 312 | c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematod | 5e-14 | |
| d1vp5a_ | 284 | c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase | 9e-14 | |
| d1mzra_ | 274 | c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase | 1e-13 | |
| d1mi3a_ | 319 | c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenu | 2e-13 | |
| d1gvea_ | 324 | c.1.7.1 (A:) Aflatoxin aldehyde reductase (akr7a1) | 3e-11 | |
| d1ur3m_ | 298 | c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Esc | 6e-10 | |
| d1hw6a_ | 262 | c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase | 4e-08 |
| >d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} Length = 311 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: NAD(P)-linked oxidoreductase family: Aldo-keto reductases (NADP) domain: Putative oxidoreductase IolS species: Bacillus subtilis [TaxId: 1423]
Score = 86.2 bits (212), Expect = 5e-21
Identities = 44/161 (27%), Positives = 77/161 (47%)
Query: 9 FFHPKPKSDTIALIHHAIDSGITILDTSDAYGPHTNEILPGKALKARYRGRVELATKFGI 68
+ + L+ AI +G+T+LDT+ YG +E L G+ L+ R V +ATK
Sbjct: 27 LYPNLNEETGKELVREAIRNGVTMLDTAYIYGIGRSEELIGEVLREFNREDVVIATKAAH 86
Query: 69 RYEDGQYSYCGDPAYVRAACEARLKRLDVDCIDLYYQHRIDTKVPIEVTIGELKKLVEEG 128
R + + + P +++ + + LKRL+ D IDL+Y H D P + + L ++ + G
Sbjct: 87 RKQGNDFVFDNSPDFLKKSVDESLKRLNTDYIDLFYIHFPDEHTPKDEAVNALNEMKKAG 146
Query: 129 KIKYIGLSEASASTIRRARHPSNNSCAVGMVLVVTRCGGRD 169
KI+ IG+S S ++ A G ++ R +
Sbjct: 147 KIRSIGVSNFSLEQLKEANKDGLVDVLQGEYNLLNREAEKT 187
|
| >d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} Length = 346 | Back information, alignment and structure |
|---|
| >d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} Length = 333 | Back information, alignment and structure |
|---|
| >d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} Length = 324 | Back information, alignment and structure |
|---|
| >d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} Length = 315 | Back information, alignment and structure |
|---|
| >d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 319 | Back information, alignment and structure |
|---|
| >d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} Length = 314 | Back information, alignment and structure |
|---|
| >d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 326 | Back information, alignment and structure |
|---|
| >d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 315 | Back information, alignment and structure |
|---|
| >d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 312 | Back information, alignment and structure |
|---|
| >d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} Length = 284 | Back information, alignment and structure |
|---|
| >d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} Length = 274 | Back information, alignment and structure |
|---|
| >d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} Length = 319 | Back information, alignment and structure |
|---|
| >d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} Length = 298 | Back information, alignment and structure |
|---|
| >d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} Length = 262 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 198 | |||
| d1gvea_ | 324 | Aflatoxin aldehyde reductase (akr7a1) {Rat (Rattus | 100.0 | |
| d1ur3m_ | 298 | Hypothetical oxidoreductase YdhF {Escherichia coli | 100.0 | |
| d1pyfa_ | 311 | Putative oxidoreductase IolS {Bacillus subtilis [T | 100.0 | |
| d1pz1a_ | 333 | Putative oxidoreductase YhdN {Bacillus subtilis [T | 100.0 | |
| d1afsa_ | 319 | 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus | 99.97 | |
| d1s1pa_ | 315 | Prostaglandin d2 11-ketoreductase (akr1c3) {Human | 99.97 | |
| d1qwka_ | 312 | Hypothetical protein C07D8.6 {Nematode (Caenorhabd | 99.97 | |
| d3eaua1 | 326 | Voltage-dependent K+ channel beta subunit {Rat (Ra | 99.97 | |
| d1vp5a_ | 284 | 2,5-diketo-D-gluconic acid reductase A {Thermotoga | 99.96 | |
| d1hw6a_ | 262 | 2,5-diketo-D-gluconic acid reductase A {Corynebact | 99.96 | |
| d1lqaa_ | 346 | Tas protein {Escherichia coli [TaxId: 562]} | 99.96 | |
| d1mzra_ | 274 | 2,5-diketo-D-gluconic acid reductase A {Escherichi | 99.96 | |
| d1us0a_ | 314 | Aldose reductase (aldehyde reductase) {Human (Homo | 99.96 | |
| d1mi3a_ | 319 | Xylose reductase {Fungi (Candida tenuis) [TaxId: 4 | 99.96 | |
| d1hqta_ | 324 | Aldose reductase (aldehyde reductase) {Pig (Sus sc | 99.95 | |
| d1frba_ | 315 | FR-1 (fibroblast growth factor-induced) protein {M | 99.95 | |
| d3bofa2 | 300 | Cobalamin-dependent methionine synthase MetH, N-te | 86.86 |
| >d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} | Back information, alignment and structure |
|---|
| >d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} | Back information, alignment and structure |
|---|
| >d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3bofa2 c.1.26.1 (A:1-300) Cobalamin-dependent methionine synthase MetH, N-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|