Citrus Sinensis ID: 048525

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80------
MQKIVIKVQVRCDKCRSKAMETAADTDGVISVSLQGKYKDTVVVTGDGVDSASLAKRLGKKLGHASLETVEEMKEKPGVDNDETKG
cEEEEEEEEcccHHHHHHHHHHHHcccccEEEEEEcccccEEEEEEccccHHHHHHHHHcccccEEEEEEEccccccccccccccc
ccEEEEEEEcccHHHHHHHHHHHHHccccEEEEEEcccccEEEEEcccccHHHHHHHHHHHccccEEEEEEEccccccccccHccc
MQKIVIKVQVRCDKCRSKAMEtaadtdgvisvslqgkykdtvvvtgdgvdsASLAKRLGKKLGHASLETVEEMkekpgvdndetkg
MQKIVIKVQVRCDKCRSKAmetaadtdgvisvslqgkyKDTVVVTGDGVDSASLAKRlgkklghasletveemkekpgvdndetkg
MQKIVIKVQVRCDKCRSKAMETAADTDGVISVSLQGKYKdtvvvtgdgvdSASLAKRLGKKLGHASLETVEEMKEKPGVDNDETKG
***IVIKVQVRCDKCRSKAMETAADTDGVISVSLQGKYKDTVVVTGDGV*************************************
MQKIVIKVQVRCDKCRSKAMETAADTDGVISVSLQGKYKDTVVVTGDGVDSASLAKRLGKKLGHASLE******************
MQKIVIKVQVRCDKCRSKAMETAADTDGVISVSLQGKYKDTVVVTGDGVDSASLAKRLGKKLGHASLETVE***************
MQKIVIKVQVRCDKCRSKAMETAADTDGVISVSLQGKYKDTVVVTGDGVDSASLAKRLGKKLGHASLETVEEMKE***********
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQKIVIKVQVRCDKCRSKAMETAADTDGVISVSLQGKYKDTVVVTGDGVDSASLAKRLGKKLGHASLETVEEMKEKPGVDNDETKG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query86
296090013111 unnamed protein product [Vitis vinifera] 0.837 0.648 0.638 1e-17
359494352120 PREDICTED: uncharacterized protein LOC10 0.872 0.625 0.64 5e-17
255584629119 metal ion binding protein, putative [Ric 0.883 0.638 0.578 1e-14
296090016110 unnamed protein product [Vitis vinifera] 0.779 0.609 0.641 3e-14
296090011132 unnamed protein product [Vitis vinifera] 0.779 0.507 0.641 5e-14
15231057118 putative copper transport protein [Arabi 0.860 0.627 0.546 3e-13
357500209 233 hypothetical protein MTR_6g082330 [Medic 0.837 0.309 0.527 4e-13
22408628172 predicted protein [Populus trichocarpa] 0.802 0.958 0.565 4e-13
46806257119 hypothetical protein [Oryza sativa Japon 0.802 0.579 0.608 2e-12
297834950118 metal ion binding protein [Arabidopsis l 0.860 0.627 0.52 3e-12
>gi|296090013|emb|CBI39832.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score = 93.6 bits (231), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 46/72 (63%), Positives = 60/72 (83%)

Query: 2  QKIVIKVQVRCDKCRSKAMETAADTDGVISVSLQGKYKDTVVVTGDGVDSASLAKRLGKK 61
          QKI++KVQ+ CDKCR+KAM+ AA  +GVISV+++G  KD VVV GDGVDSASL   LGKK
Sbjct: 3  QKIIVKVQMNCDKCRAKAMKIAAVEEGVISVAIEGAEKDRVVVIGDGVDSASLTHCLGKK 62

Query: 62 LGHASLETVEEM 73
          LG+A++ +VEE+
Sbjct: 63 LGYATIVSVEEV 74

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359494352|ref|XP_003634762.1| PREDICTED: uncharacterized protein LOC100853541 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255584629|ref|XP_002533038.1| metal ion binding protein, putative [Ricinus communis] gi|223527176|gb|EEF29346.1| metal ion binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|296090016|emb|CBI39835.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|296090011|emb|CBI39830.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|15231057|ref|NP_188653.1| putative copper transport protein [Arabidopsis thaliana] gi|332642823|gb|AEE76344.1| putative copper transport protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357500209|ref|XP_003620393.1| hypothetical protein MTR_6g082330 [Medicago truncatula] gi|355495408|gb|AES76611.1| hypothetical protein MTR_6g082330 [Medicago truncatula] Back     alignment and taxonomy information
>gi|224086281|ref|XP_002307843.1| predicted protein [Populus trichocarpa] gi|222853819|gb|EEE91366.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|46806257|dbj|BAD17465.1| hypothetical protein [Oryza sativa Japonica Group] gi|50253091|dbj|BAD29339.1| hypothetical protein [Oryza sativa Japonica Group] gi|125582662|gb|EAZ23593.1| hypothetical protein OsJ_07292 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|297834950|ref|XP_002885357.1| metal ion binding protein [Arabidopsis lyrata subsp. lyrata] gi|297331197|gb|EFH61616.1| metal ion binding protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query86
TAIR|locus:2087580118 AT3G20180 "AT3G20180" [Arabido 0.860 0.627 0.44 1.5e-10
TAIR|locus:2138376110 AT4G05030 "AT4G05030" [Arabido 0.872 0.681 0.36 2e-08
TAIR|locus:2156253181 AT5G48290 [Arabidopsis thalian 0.965 0.458 0.341 1.9e-05
TAIR|locus:2091112157 AT3G07600 [Arabidopsis thalian 0.930 0.509 0.317 3.9e-05
TAIR|locus:2172808103 AT5G23760 "AT5G23760" [Arabido 0.941 0.786 0.329 0.00035
TAIR|locus:2149584118 AT5G52740 "AT5G52740" [Arabido 0.930 0.677 0.305 0.00035
TAIR|locus:2025421177 AT1G01490 [Arabidopsis thalian 0.453 0.220 0.333 0.00079
TAIR|locus:2087580 AT3G20180 "AT3G20180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 148 (57.2 bits), Expect = 1.5e-10, P = 1.5e-10
 Identities = 33/75 (44%), Positives = 46/75 (61%)

Query:     6 IKVQVRCDKCRSKAMETAADTDGVISVSLQGKYKXXXXXXXXXXXSASLAKRLGKKLGHA 65
             IK+ V  +KCR KAM+ A   DGV SV+++G+++           SASL   L KK  H 
Sbjct:     3 IKLSVNSEKCRKKAMQVAVAADGVTSVAMEGEFQDELVVVGDGVDSASLIMALRKKACHV 62

Query:    66 SLETVEEMKEKPGVD 80
             +LET+EE+K KP V+
Sbjct:    63 TLETLEEVK-KPQVE 76
GO:0005575 "cellular_component" evidence=ND
TAIR|locus:2138376 AT4G05030 "AT4G05030" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2156253 AT5G48290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2091112 AT3G07600 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2172808 AT5G23760 "AT5G23760" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149584 AT5G52740 "AT5G52740" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025421 AT1G01490 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query86
pfam0040362 pfam00403, HMA, Heavy-metal-associated domain 0.003
>gnl|CDD|215902 pfam00403, HMA, Heavy-metal-associated domain Back     alignment and domain information 
 Score = 32.6 bits (75), Expect = 0.003
 Identities = 13/48 (27%), Positives = 19/48 (39%), Gaps = 1/48 (2%)

Query: 4  IVIKVQVRCDKCRSKAMETAADTDGVISVSLQGKYKDTVVVTGDGVDS 51
           +    + C  C  K  +  +   GV SVS+  +    V VTGD    
Sbjct: 1  TLRVPGMTCAGCAKKVEKALSKLPGVSSVSVDLE-TGKVTVTGDPDPL 47

Length = 62

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 86
KOG160373 consensus Copper chaperone [Inorganic ion transpor 99.79
PF0040362 HMA: Heavy-metal-associated domain; InterPro: IPR0 99.54
COG260871 CopZ Copper chaperone [Inorganic ion transport and 99.39
KOG4656 247 consensus Copper chaperone for superoxide dismutas 98.99
PLN02957 238 copper, zinc superoxide dismutase 98.63
PRK10671 834 copA copper exporting ATPase; Provisional 98.52
TIGR0000368 copper ion binding protein. This model describes a 97.81
COG2217 713 ZntA Cation transport ATPase [Inorganic ion transp 97.63
PRK10671 834 copA copper exporting ATPase; Provisional 97.13
KOG0207 951 consensus Cation transport ATPase [Inorganic ion t 96.67
KOG0207 951 consensus Cation transport ATPase [Inorganic ion t 96.21
PRK11033 741 zntA zinc/cadmium/mercury/lead-transporting ATPase 96.11
PF0188372 DUF59: Domain of unknown function DUF59; InterPro: 90.09
COG188897 Uncharacterized protein conserved in archaea [Func 89.82
PF0268095 DUF211: Uncharacterized ArCR, COG1888; InterPro: I 89.23
PF1373284 DUF4162: Domain of unknown function (DUF4162) 87.53
PRK13748 561 putative mercuric reductase; Provisional 86.7
TIGR0205292 MerP mercuric transport protein periplasmic compon 84.57
>KOG1603 consensus Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information 
Probab=99.79  E-value=5.1e-19  Score=107.12  Aligned_cols=67  Identities=33%  Similarity=0.492  Sum_probs=62.8

Q ss_pred             CeEEEEEEEeechhhHHHHHHHhccCCCceEEEecCCccceEEEeccCCCHHHHHHHHHhhc-CceeEEe
Q 048525            1 MQKIVIKVQVRCDKCRSKAMETAADTDGVISVSLQGKYKDTVVVTGDGVDSASLAKRLGKKL-GHASLET   69 (86)
Q Consensus         1 m~~vvlkV~m~C~~C~~kv~k~l~~~~GV~sV~vd~~~~~~vtV~G~~vDp~~l~~~l~kk~-~~aei~s   69 (86)
                      |++++++|+|||++|.++|.+.++.+.||+++.+|. .+++|||.|+ +||..|+++|++.+ +.+.+|.
T Consensus         4 ~~~~v~kv~~~C~gc~~kV~~~l~~~~GV~~v~id~-~~~kvtV~g~-~~p~~vl~~l~k~~~k~~~~~~   71 (73)
T KOG1603|consen    4 IKTVVLKVNMHCEGCARKVKRVLQKLKGVESVDIDI-KKQKVTVKGN-VDPVKLLKKLKKTGGKRAELWK   71 (73)
T ss_pred             ccEEEEEECcccccHHHHHHHHhhccCCeEEEEecC-CCCEEEEEEe-cCHHHHHHHHHhcCCCceEEec
Confidence            478999999999999999999999999999999999 9999999999 99999999999988 6777764

>PF00403 HMA: Heavy-metal-associated domain; InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures Back     alignment and domain information
>COG2608 CopZ Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4656 consensus Copper chaperone for superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN02957 copper, zinc superoxide dismutase Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>TIGR00003 copper ion binding protein Back     alignment and domain information
>COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional Back     alignment and domain information
>PF01883 DUF59: Domain of unknown function DUF59; InterPro: IPR002744 This family includes prokaryotic proteins of unknown function Back     alignment and domain information
>COG1888 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>PF02680 DUF211: Uncharacterized ArCR, COG1888; InterPro: IPR003831 This entry describes proteins of unknown function Back     alignment and domain information
>PF13732 DUF4162: Domain of unknown function (DUF4162) Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR02052 MerP mercuric transport protein periplasmic component Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query86
3iwl_A68 Copper transport protein ATOX1; beta-alpha-beta-BE 99.7
1cc8_A73 Protein (metallochaperone ATX1); copper transport, 99.63
3dxs_X74 Copper-transporting ATPase RAN1; CXXC motif, ferre 99.55
4a4j_A69 Pacszia, cation-transporting ATPase PACS; hydrolas 99.53
2crl_A98 Copper chaperone for superoxide dismutase; SOD1, f 99.52
3fry_A73 Probable copper-exporting P-type ATPase A; transpo 99.47
2roe_A66 Heavy metal binding protein; NMR {Thermus thermoph 99.34
2xmm_A64 SSR2857 protein, ATX1; metal transport, copper hom 99.31
2l3m_A71 Copper-ION-binding protein; structural genomics, c 99.3
2xmw_A71 PACS-N, cation-transporting ATPase PACS; hydrolase 99.27
2qif_A69 Copper chaperone COPZ; tetranuclear Cu(I) cluster; 99.26
1mwy_A73 ZNTA; open-faced beta-sandwich fold, beta-alpha-be 99.25
2k2p_A85 Uncharacterized protein ATU1203; putative metal-bi 99.25
1y3j_A77 Copper-transporting ATPase 1; ferrodoxin-like fold 99.23
1qup_A 222 Superoxide dismutase 1 copper chaperone; two domai 99.23
1fvq_A72 Copper-transporting ATPase; APO-CCC2A, hydrolase; 99.22
1opz_A76 Potential copper-transporting ATPase; mutation, fo 99.21
1osd_A72 MERP, hypothetical protein MERP; mercury resistanc 99.21
1aw0_A72 Menkes copper-transporting ATPase; copper-binding 99.19
2g9o_A90 Copper-transporting ATPase 1; menkes disease, solu 99.18
1kvi_A79 Copper-transporting ATPase 1; menkes, Cu-protein, 99.17
3cjk_B75 Copper-transporting ATPase 1; HAH1, ATP7B, menkes 99.17
1jww_A80 Potential copper-transporting ATPase; beta-alpha-b 99.16
1jk9_B 249 CCS, copper chaperone for superoxide dismutase; pr 99.14
1cpz_A68 Protein (COPZ); copper chaperone, metal transport, 99.14
2ldi_A71 Zinc-transporting ATPase; metal homeostasis, metal 99.12
1yjr_A75 Copper-transporting ATPase 1; metallochaperone, pr 99.12
2kyz_A67 Heavy metal binding protein; structural genomics, 99.11
1q8l_A84 Copper-transporting ATPase 1; metal binding protei 99.11
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 99.08
2kkh_A95 Putative heavy metal transporter; zinc transport, 99.07
1yg0_A66 COP associated protein; open-faced beta-sandwich, 99.06
2kt2_A69 Mercuric reductase; nmera, MERA, HMA domain, mercu 99.06
2aj0_A71 Probable cadmium-transporting ATPase; ferrodoxin-l 99.05
2ofg_X111 Zinc-transporting ATPase; ferredoxin-like fold, be 99.04
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 99.03
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 98.96
2rop_A202 Copper-transporting ATPase 2; wilson protein, mobi 98.95
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 98.62
2rop_A202 Copper-transporting ATPase 2; wilson protein, mobi 98.59
3j09_A 723 COPA, copper-exporting P-type ATPase A; copper tra 98.38
2raq_A97 Conserved protein MTH889; alpha-beta protein, stru 89.49
2x3d_A96 SSO6206; unknown function; 2.70A {Sulfolobus solfa 88.8
3bpd_A100 Uncharacterized protein; heptamer, Mg+2 ION, PSI-2 88.62
3cq1_A103 Putative uncharacterized protein TTHB138; DTDP-4-k 81.28
3lno_A108 Putative uncharacterized protein; alpha-beta fold, 81.15
>3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} SCOP: d.58.17.1 PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A Back     alignment and structure
Probab=99.70  E-value=9.2e-17  Score=92.82  Aligned_cols=67  Identities=18%  Similarity=0.230  Sum_probs=63.8

Q ss_pred             CeEEEEEEEeechhhHHHHHHHhccCCCceEEEecCCccceEEEeccCCCHHHHHHHHHhhcCceeEEec
Q 048525            1 MQKIVIKVQVRCDKCRSKAMETAADTDGVISVSLQGKYKDTVVVTGDGVDSASLAKRLGKKLGHASLETV   70 (86)
Q Consensus         1 m~~vvlkV~m~C~~C~~kv~k~l~~~~GV~sV~vd~~~~~~vtV~G~~vDp~~l~~~l~kk~~~aei~s~   70 (86)
                      |+++.|+|+|+|.+|+.++.++|.+++|| ++.+|. ..++++|.++ +++..|.+.|++.|+.+++|++
T Consensus         1 m~~~~~~vgm~C~~C~~~i~~~l~~~~gV-~v~v~~-~~~~~~v~~~-~~~~~i~~~i~~~Gy~~~~~~~   67 (68)
T 3iwl_A            1 MPKHEFSVDMTCGGCAEAVSRVLNKLGGV-KYDIDL-PNKKVCIESE-HSMDTLLATLKKTGKTVSYLGL   67 (68)
T ss_dssp             -CEEEEEECCCSHHHHHHHHHHHHHHCSE-EEEEET-TTTEEEEEES-SCHHHHHHHHHTTCSCEEEEEC
T ss_pred             CceEEEEECcCcHHHHHHHHHHHHcCCCe-EEEEEc-CCCEEEEEec-CCHHHHHHHHHHcCCceEecCC
Confidence            78899999999999999999999999999 999999 9999999998 9999999999999999999975
>1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A Back     alignment and structure
>3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} SCOP: d.58.17.0 Back     alignment and structure
>4a4j_A Pacszia, cation-transporting ATPase PACS; hydrolase, copper homeostasis, zinc homeostasis, ATX1, metal-transporting atpases; 1.25A {Synechocystis} PDB: 4a48_A 2gcf_A 2xmw_A Back     alignment and structure
>2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A Back     alignment and structure
>2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A Back     alignment and structure
>2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} Back     alignment and structure
>2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A Back     alignment and structure
>2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A Back     alignment and structure
>1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A Back     alignment and structure
>2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} Back     alignment and structure
>1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A Back     alignment and structure
>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B Back     alignment and structure
>1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A Back     alignment and structure
>1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A Back     alignment and structure
>1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A Back     alignment and structure
>2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A Back     alignment and structure
>1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A Back     alignment and structure
>3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A Back     alignment and structure
>1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A Back     alignment and structure
>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 Back     alignment and structure
>2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} Back     alignment and structure
>1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A Back     alignment and structure
>2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} Back     alignment and structure
>1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A Back     alignment and structure
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Back     alignment and structure
>2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} Back     alignment and structure
>1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} Back     alignment and structure
>2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A Back     alignment and structure
>2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A Back     alignment and structure
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Back     alignment and structure
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Back     alignment and structure
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Back     alignment and structure
>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>2raq_A Conserved protein MTH889; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 3.11A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: d.58.61.1 Back     alignment and structure
>2x3d_A SSO6206; unknown function; 2.70A {Sulfolobus solfataricus} Back     alignment and structure
>3bpd_A Uncharacterized protein; heptamer, Mg+2 ION, PSI-2, NYSGXRC, structural genom protein structure initiative; 2.80A {Archaeoglobus fulgidus dsm 4304} SCOP: d.58.61.1 Back     alignment and structure
>3cq1_A Putative uncharacterized protein TTHB138; DTDP-4-keto-L-rhamnose reductase, plasmid, oxidoreductase, structural genomics, NPPSFA; 1.90A {Thermus thermophilus} PDB: 2cu6_A 3cq2_A 3cq3_A* Back     alignment and structure
>3lno_A Putative uncharacterized protein; alpha-beta fold, structural genomics, center for structural genomics of infectious diseases, csgid; 2.10A {Bacillus anthracis} SCOP: d.52.8.0 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query86
d1fe0a_66 ATX1 metallochaperone protein (ATOX1) {Human (Homo 99.77
d1cc8a_72 ATX1 metallochaperone protein (ATOX1) {Baker's yea 99.77
d1qupa272 Copper chaperone for superoxide dismutase, N-termi 99.75
d2ggpb172 Copper transporter domain ccc2a {Baker's yeast (Sa 99.61
d1sb6a_64 Copper chaperone {Synechocystis sp. pcc 6803, Scat 99.61
d2qifa169 Copper chaperone {Bacillus subtilis, CopZ [TaxId: 99.59
d1osda_72 Mercuric ion binding protein MerP {Ralstonia metal 99.58
d1kvja_79 Menkes copper-transporting ATPase {Human (Homo sap 99.56
d2aw0a_72 Menkes copper-transporting ATPase {Human (Homo sap 99.55
d1cpza_68 Copper chaperone {Enterococcus hirae [TaxId: 1354] 99.54
d1p6ta279 Potential copper-translocating P-type ATPase CopA 99.48
d1p6ta172 Potential copper-translocating P-type ATPase CopA 99.47
d1q8la_84 Menkes copper-transporting ATPase {Human (Homo sap 99.45
d1mwza_73 Metal ion-transporting ATPase ZntA, N-terminal dom 99.44
d2raqa193 Uncharacterized protein MTH889 {Methanobacterium t 90.02
d3bpda191 Uncharacterized protein AF1549 {Archaeoglobus fulg 88.27
d1uwda_102 Hypothetical protein TM0487 {Thermotoga maritima [ 86.25
d2cu6a191 Hypothetical protein TTHB138 {Thermus thermophilus 85.64
>d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: HMA, heavy metal-associated domain
family: HMA, heavy metal-associated domain
domain: ATX1 metallochaperone protein (ATOX1)
species: Human (Homo sapiens), HAH1 [TaxId: 9606]

Probab=99.77  E-value=6.1e-19  Score=102.92  Aligned_cols=65  Identities=17%  Similarity=0.216  Sum_probs=61.8

Q ss_pred             EEEEEEEeechhhHHHHHHHhccCCCceEEEecCCccceEEEeccCCCHHHHHHHHHhhcCceeEEec
Q 048525            3 KIVIKVQVRCDKCRSKAMETAADTDGVISVSLQGKYKDTVVVTGDGVDSASLAKRLGKKLGHASLETV   70 (86)
Q Consensus         3 ~vvlkV~m~C~~C~~kv~k~l~~~~GV~sV~vd~~~~~~vtV~G~~vDp~~l~~~l~kk~~~aei~s~   70 (86)
                      +..|+|+|||.+|+++|.++|.+++|| ++.+|. .+++++|.|+ +++..|+++|++.|+.|+|+.+
T Consensus         2 k~ef~V~M~C~~C~~~I~~aL~~~~gv-~v~v~~-~~~~v~V~~~-~~~~~i~~~I~~~Gy~a~lig~   66 (66)
T d1fe0a_           2 KHEFSVDMTCGGCAEAVSRVLNKLGGV-KYDIDL-PNKKVCIESE-HSMDTLLATLKKTGKTVSYLGL   66 (66)
T ss_dssp             EEEEEECCCSHHHHHHHHHHHHHHCSE-EEEEET-TTTEEEEEES-SCHHHHHHHHHTTTSCEEEEEC
T ss_pred             CEEEEEccCchHHHHHHHHHHhcCCCc-EEEEEc-CCCEEEEEee-CCHHHHHHHHHHhCCeEEEeeC
Confidence            578999999999999999999999998 699999 9999999999 9999999999999999999863
>d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Back     information, alignment and structure
>d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Back     information, alignment and structure
>d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Back     information, alignment and structure
>d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Back     information, alignment and structure
>d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2raqa1 d.58.61.1 (A:3-95) Uncharacterized protein MTH889 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d3bpda1 d.58.61.1 (A:1-91) Uncharacterized protein AF1549 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1uwda_ d.52.8.2 (A:) Hypothetical protein TM0487 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2cu6a1 d.52.8.2 (A:6-96) Hypothetical protein TTHB138 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure