Citrus Sinensis ID: 048610

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-------
MVKAPGSEKPSLRKGSWAPEEDRKLIAYIRRYGIWNWSEMPKYAGLLRCGKSCRLRWMNYLRPDIRRGNFTQEEDETIIKLHEQLGN
ccccccccccccccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHcHHHHHHHHcccccccccccccHHHHHHHHHHHHHHcc
cccccccHccccccccccHHHHHHHHHHHHHcccccHHHccHHccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcc
mvkapgsekpslrkgswapeeDRKLIAYIRRYGIwnwsempkyagllrcgksCRLRWmnylrpdirrgnftqeEDETIIKLHEQLGN
mvkapgsekpslrkgswapeedrKLIAYIRRYGIWNWSEMPKYAGLLRCGKSCRLRWMNYlrpdirrgnftqeedeTIIKLHEQLGN
MVKAPGSEKPSLRKGSWAPEEDRKLIAYIRRYGIWNWSEMPKYAGLLRCGKSCRLRWMNYLRPDIRRGNFTQEEDETIIKLHEQLGN
**********************RKLIAYIRRYGIWNWSEMPKYAGLLRCGKSCRLRWMNYLRPDIRRGNF*****************
**KAPGSEKPSLRKGSWAPEEDRKLIAYIRRYGIWNWSEMPKYAGLLRCGKSCRLRWMNYLRPDIRRGNFTQEEDETIIKLHEQLG*
*****************APEEDRKLIAYIRRYGIWNWSEMPKYAGLLRCGKSCRLRWMNYLRPDIRRGNFTQEEDETIIKLHEQLGN
***APGSEKPSLRKGSWAPEEDRKLIAYIRRYGIWNWSEMPKYAGLLRCGKSCRLRWMNYLRPDIRRGNFTQEEDETIIKLHEQLGN
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVKAPGSEKPSLRKGSWAPEEDRKLIAYIRRYGIWNWSEMPKYAGLLRCGKSCRLRWMNYLRPDIRRGNFTQEEDETIIKLHEQLGN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query87 2.2.26 [Sep-21-2011]
Q7XBH4 257 Myb-related protein Myb4 no no 1.0 0.338 0.666 6e-30
P20024 340 Myb-related protein Zm1 O N/A no 0.977 0.25 0.647 3e-28
P81393 232 Myb-related protein 308 O N/A no 1.0 0.375 0.643 3e-28
Q9SZP1 282 Transcription repressor M no no 1.0 0.308 0.632 8e-28
P81395 274 Myb-related protein 330 O N/A no 1.0 0.317 0.643 1e-27
Q9S9K9 257 Transcription factor MYB3 no no 1.0 0.338 0.620 4e-27
Q38851 236 Transcription repressor M no no 1.0 0.368 0.609 6e-27
P20026 267 Myb-related protein Hv1 O N/A no 1.0 0.325 0.620 9e-27
P20025 255 Myb-related protein Zm38 N/A no 1.0 0.341 0.597 1e-26
O49608 274 Transcription factor MYB3 no no 1.0 0.317 0.609 9e-26
>sp|Q7XBH4|MYB4_ORYSJ Myb-related protein Myb4 OS=Oryza sativa subsp. japonica GN=MYB4 PE=2 SV=2 Back     alignment and function desciption
 Score =  129 bits (324), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 58/87 (66%), Positives = 72/87 (82%)

Query: 1  MVKAPGSEKPSLRKGSWAPEEDRKLIAYIRRYGIWNWSEMPKYAGLLRCGKSCRLRWMNY 60
          M +AP  EK  L+KG W PEED+ L+A+I+R+G  NW  +PK AGLLRCGKSCRLRW+NY
Sbjct: 1  MGRAPCCEKMGLKKGPWTPEEDKVLVAHIQRHGHGNWRALPKQAGLLRCGKSCRLRWINY 60

Query: 61 LRPDIRRGNFTQEEDETIIKLHEQLGN 87
          LRPDI+RGNF++EE++TII LHE LGN
Sbjct: 61 LRPDIKRGNFSKEEEDTIIHLHELLGN 87
Putative transcription factor which is may be involved in cold stress response.
Oryza sativa subsp. japonica (taxid: 39947)
>sp|P20024|MYB1_MAIZE Myb-related protein Zm1 OS=Zea mays PE=2 SV=1 Back     alignment and function description
>sp|P81393|MYB08_ANTMA Myb-related protein 308 OS=Antirrhinum majus GN=MYB308 PE=2 SV=1 Back     alignment and function description
>sp|Q9SZP1|MYB4_ARATH Transcription repressor MYB4 OS=Arabidopsis thaliana GN=MYB4 PE=1 SV=1 Back     alignment and function description
>sp|P81395|MYB30_ANTMA Myb-related protein 330 OS=Antirrhinum majus GN=MYB330 PE=2 SV=1 Back     alignment and function description
>sp|Q9S9K9|MYB3_ARATH Transcription factor MYB3 OS=Arabidopsis thaliana GN=MYB3 PE=1 SV=1 Back     alignment and function description
>sp|Q38851|MYB6_ARATH Transcription repressor MYB6 OS=Arabidopsis thaliana GN=MYB6 PE=1 SV=1 Back     alignment and function description
>sp|P20026|MYB1_HORVU Myb-related protein Hv1 OS=Hordeum vulgare GN=MYB1 PE=2 SV=1 Back     alignment and function description
>sp|P20025|MYB38_MAIZE Myb-related protein Zm38 OS=Zea mays PE=2 SV=1 Back     alignment and function description
>sp|O49608|MYB32_ARATH Transcription factor MYB32 OS=Arabidopsis thaliana GN=MYB32 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query87
356515230 324 PREDICTED: transcription repressor MYB6- 1.0 0.268 0.678 1e-33
356544870 305 PREDICTED: transcription repressor MYB4 1.0 0.285 0.678 2e-33
357453601 250 MYB transcription factor [Medicago trunc 1.0 0.348 0.712 9e-33
110931846155 MYB transcription factor MYB122 [Glycine 1.0 0.561 0.678 1e-32
356515228 318 PREDICTED: transcription repressor MYB4 1.0 0.273 0.666 1e-32
147837078 284 hypothetical protein VITISV_019320 [Viti 1.0 0.306 0.689 6e-32
302398929 253 MYB domain class transcription factor [M 1.0 0.343 0.678 6e-32
225447697 257 PREDICTED: myb-related protein Myb4 [Vit 1.0 0.338 0.689 7e-32
224126823 256 predicted protein [Populus trichocarpa] 1.0 0.339 0.666 2e-31
255544351 218 r2r3-myb transcription factor, putative 1.0 0.399 0.666 3e-31
>gi|356515230|ref|XP_003526304.1| PREDICTED: transcription repressor MYB6-like [Glycine max] Back     alignment and taxonomy information
 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 59/87 (67%), Positives = 75/87 (86%)

Query: 1  MVKAPGSEKPSLRKGSWAPEEDRKLIAYIRRYGIWNWSEMPKYAGLLRCGKSCRLRWMNY 60
          MV+ P  +K  +RKG+W PEED KLIAY+ RYG WNW ++PK+AGL RCGKSCRLRWMNY
Sbjct: 1  MVRTPSCDKSGMRKGTWTPEEDMKLIAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY 60

Query: 61 LRPDIRRGNFTQEEDETIIKLHEQLGN 87
          LRP+I+RGNFTQ+E+E II++H++LGN
Sbjct: 61 LRPNIKRGNFTQQEEECIIRMHKKLGN 87

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356544870|ref|XP_003540870.1| PREDICTED: transcription repressor MYB4 [Glycine max] Back     alignment and taxonomy information
>gi|357453601|ref|XP_003597081.1| MYB transcription factor [Medicago truncatula] gi|355486129|gb|AES67332.1| MYB transcription factor [Medicago truncatula] Back     alignment and taxonomy information
>gi|110931846|gb|ABH02922.1| MYB transcription factor MYB122 [Glycine max] Back     alignment and taxonomy information
>gi|356515228|ref|XP_003526303.1| PREDICTED: transcription repressor MYB4 [Glycine max] Back     alignment and taxonomy information
>gi|147837078|emb|CAN72480.1| hypothetical protein VITISV_019320 [Vitis vinifera] Back     alignment and taxonomy information
>gi|302398929|gb|ADL36759.1| MYB domain class transcription factor [Malus x domestica] Back     alignment and taxonomy information
>gi|225447697|ref|XP_002272704.1| PREDICTED: myb-related protein Myb4 [Vitis vinifera] gi|296081257|emb|CBI18001.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224126823|ref|XP_002319935.1| predicted protein [Populus trichocarpa] gi|222858311|gb|EEE95858.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255544351|ref|XP_002513237.1| r2r3-myb transcription factor, putative [Ricinus communis] gi|223547611|gb|EEF49105.1| r2r3-myb transcription factor, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query87
TAIR|locus:2042526 249 MYB14 "myb domain protein 14" 1.0 0.349 0.655 7.1e-29
TAIR|locus:2207330 294 MYB63 "myb domain protein 63" 0.977 0.289 0.623 1.9e-28
TAIR|locus:2121259 282 MYB4 "myb domain protein 4" [A 1.0 0.308 0.632 1e-27
TAIR|locus:2086233 285 MYB15 "myb domain protein 15" 1.0 0.305 0.620 1.3e-27
TAIR|locus:2009452 257 MYB3 "myb domain protein 3" [A 1.0 0.338 0.620 3.5e-27
TAIR|locus:2075387 321 MYB107 "myb domain protein 107 1.0 0.271 0.620 3.5e-27
TAIR|locus:2141231 350 MYB102 "MYB-like 102" [Arabido 1.0 0.248 0.620 4.5e-27
TAIR|locus:2171845 310 MYB53 "myb domain protein 53" 1.0 0.280 0.620 5.7e-27
TAIR|locus:2059883 269 MYB7 "myb domain protein 7" [A 1.0 0.323 0.597 7.3e-27
TAIR|locus:2038520 246 MYB13 "myb domain protein 13" 1.0 0.353 0.643 9.4e-27
TAIR|locus:2042526 MYB14 "myb domain protein 14" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 321 (118.1 bits), Expect = 7.1e-29, P = 7.1e-29
 Identities = 57/87 (65%), Positives = 69/87 (79%)

Query:     1 MVKAPGSEKPSLRKGSWAPEEDRKLIAYIRRYGIWNWSEMPKYAGLLRCGKSCRLRWMNY 60
             M +AP  EK  +++G W PEED+ LI YI  YG  NW  +PK+AGLLRCGKSCRLRW+NY
Sbjct:     1 MGRAPCCEKMGVKRGPWTPEEDQILINYIHLYGHSNWRALPKHAGLLRCGKSCRLRWINY 60

Query:    61 LRPDIRRGNFTQEEDETIIKLHEQLGN 87
             LRPDI+RGNFT +E++TII LHE LGN
Sbjct:    61 LRPDIKRGNFTPQEEQTIINLHESLGN 87
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0009651 "response to salt stress" evidence=IEP
GO:0009723 "response to ethylene stimulus" evidence=IEP
GO:0009733 "response to auxin stimulus" evidence=IEP
GO:0009751 "response to salicylic acid stimulus" evidence=IEP
GO:0009753 "response to jasmonic acid stimulus" evidence=IEP
TAIR|locus:2207330 MYB63 "myb domain protein 63" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2121259 MYB4 "myb domain protein 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086233 MYB15 "myb domain protein 15" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2009452 MYB3 "myb domain protein 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075387 MYB107 "myb domain protein 107" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2141231 MYB102 "MYB-like 102" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2171845 MYB53 "myb domain protein 53" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2059883 MYB7 "myb domain protein 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2038520 MYB13 "myb domain protein 13" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00029221001
SubName- Full=Chromosome chr12 scaffold_47, whole genome shotgun sequence; (257 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query87
PLN03091 459 PLN03091, PLN03091, hypothetical protein; Provisio 2e-35
PLN03212 249 PLN03212, PLN03212, Transcription repressor MYB5; 5e-28
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 7e-12
COG5147 512 COG5147, REB1, Myb superfamily proteins, including 9e-11
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 4e-10
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 9e-09
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 5e-08
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 0.002
>gnl|CDD|215570 PLN03091, PLN03091, hypothetical protein; Provisional Back     alignment and domain information 
 Score =  124 bits (312), Expect = 2e-35
 Identities = 50/79 (63%), Positives = 62/79 (78%)

Query: 9  KPSLRKGSWAPEEDRKLIAYIRRYGIWNWSEMPKYAGLLRCGKSCRLRWMNYLRPDIRRG 68
          K  LRKG W+PEED KL+ +I +YG   WS +PK AGL RCGKSCRLRW+NYLRPD++RG
Sbjct: 9  KQKLRKGLWSPEEDEKLLRHITKYGHGCWSSVPKQAGLQRCGKSCRLRWINYLRPDLKRG 68

Query: 69 NFTQEEDETIIKLHEQLGN 87
           F+Q+E+  II+LH  LGN
Sbjct: 69 TFSQQEENLIIELHAVLGN 87

Length = 459
>gnl|CDD|178751 PLN03212, PLN03212, Transcription repressor MYB5; Provisional Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|227476 COG5147, REB1, Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 87
PLN03091 459 hypothetical protein; Provisional 99.98
PLN03212 249 Transcription repressor MYB5; Provisional 99.97
KOG0048 238 consensus Transcription factor, Myb superfamily [T 99.96
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.89
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.84
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.77
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.7
PLN03212249 Transcription repressor MYB5; Provisional 99.61
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.59
PLN03091 459 hypothetical protein; Provisional 99.58
KOG0051 607 consensus RNA polymerase I termination factor, Myb 99.53
COG5147 512 REB1 Myb superfamily proteins, including transcrip 99.51
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 99.5
KOG0048 238 consensus Transcription factor, Myb superfamily [T 99.47
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 99.47
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 98.85
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 98.84
COG5147 512 REB1 Myb superfamily proteins, including transcrip 98.76
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 98.45
KOG0051607 consensus RNA polymerase I termination factor, Myb 98.33
COG5259 531 RSC8 RSC chromatin remodeling complex subunit RSC8 98.3
KOG1279 506 consensus Chromatin remodeling factor subunit and 98.19
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 98.08
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 98.02
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 97.97
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 97.95
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 97.85
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 97.56
PRK13923170 putative spore coat protein regulator protein YlbO 97.37
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 97.16
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 96.8
PF13325 199 MCRS_N: N-terminal region of micro-spherule protei 96.79
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 96.47
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 96.16
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 95.97
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 95.54
KOG4282 345 consensus Transcription factor GT-2 and related pr 95.48
PF1340442 HTH_AsnC-type: AsnC-type helix-turn-helix domain; 94.53
PLN031421033 Probable chromatin-remodeling complex ATPase chain 94.19
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 93.78
KOG2656 445 consensus DNA methyltransferase 1-associated prote 93.7
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 93.55
PRK11179153 DNA-binding transcriptional regulator AsnC; Provis 92.82
PF1162687 Rap1_C: TRF2-interacting telomeric protein/Rap1 - 91.98
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 91.81
KOG4167 907 consensus Predicted DNA-binding protein, contains 91.6
PRK11169164 leucine-responsive transcriptional regulator; Prov 91.44
PLN031421033 Probable chromatin-remodeling complex ATPase chain 90.86
PF0828154 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013 89.69
PF1162687 Rap1_C: TRF2-interacting telomeric protein/Rap1 - 88.64
PF09197105 Rap1-DNA-bind: Rap1, DNA-binding; InterPro: IPR015 88.12
PF13325199 MCRS_N: N-terminal region of micro-spherule protei 85.52
smart0059589 MADF subfamily of SANT domain. 84.67
KOG2009 584 consensus Transcription initiation factor TFIIIB, 84.27
smart00344108 HTH_ASNC helix_turn_helix ASNC type. AsnC: an auto 83.34
PF1054585 MADF_DNA_bdg: Alcohol dehydrogenase transcription 83.34
KOG4468 782 consensus Polycomb-group transcriptional regulator 82.79
KOG1194 534 consensus Predicted DNA-binding protein, contains 82.78
PF09420164 Nop16: Ribosome biogenesis protein Nop16; InterPro 82.07
PF0138892 ARID: ARID/BRIGHT DNA binding domain; InterPro: IP 80.71
COG1522154 Lrp Transcriptional regulators [Transcription] 80.61
PF07750162 GcrA: GcrA cell cycle regulator; InterPro: IPR0116 80.31
smart0050193 BRIGHT BRIGHT, ARID (A/T-rich interaction domain) 80.26
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information 
Probab=99.98  E-value=2e-32  Score=197.46  Aligned_cols=87  Identities=59%  Similarity=1.082  Sum_probs=84.4

Q ss_pred             CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHhCCCCccchhHHhCCCCChhhHHHHHHhhcCCCCCCCCCCHHHHHHHHH
Q 048610            1 MVKAPGSEKPSLRKGSWAPEEDRKLIAYIRRYGIWNWSEMPKYAGLLRCGKSCRLRWMNYLRPDIRRGNFTQEEDETIIK   80 (87)
Q Consensus         1 m~r~~~~~~p~~~k~~WT~eED~~L~~~v~~~g~~~W~~Ia~~~~~~Rt~~qc~~rw~~~l~~~~~~~~wt~eEd~~L~~   80 (87)
                      |||++||.++.++|++||+|||++|+++|.+||..+|..||..++.+|+++|||+||.++|+|.+++++||.|||.+|++
T Consensus         1 mgr~~Cc~KqklrKg~WTpEEDe~L~~~V~kyG~~nWs~IAk~~g~gRT~KQCRERW~NyLdP~IkKgpWT~EED~lLLe   80 (459)
T PLN03091          1 MGRHSCCYKQKLRKGLWSPEEDEKLLRHITKYGHGCWSSVPKQAGLQRCGKSCRLRWINYLRPDLKRGTFSQQEENLIIE   80 (459)
T ss_pred             CCCCccCcCCCCcCCCCCHHHHHHHHHHHHHhCcCCHHHHhhhhccCcCcchHhHHHHhccCCcccCCCCCHHHHHHHHH
Confidence            99999999999999999999999999999999998999999998744999999999999999999999999999999999


Q ss_pred             HHHHhCC
Q 048610           81 LHEQLGN   87 (87)
Q Consensus        81 ~v~~~Gn   87 (87)
                      ++.+||+
T Consensus        81 L~k~~Gn   87 (459)
T PLN03091         81 LHAVLGN   87 (459)
T ss_pred             HHHHhCc
Confidence            9999996

>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>PF13325 MCRS_N: N-terminal region of micro-spherule protein Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>PF13404 HTH_AsnC-type: AsnC-type helix-turn-helix domain; PDB: 2ZNY_E 2ZNZ_G 1RI7_A 2CYY_A 2E1C_A 2VC1_B 2QZ8_A 2W29_C 2IVM_B 2VBX_B Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>KOG2656 consensus DNA methyltransferase 1-associated protein-1 [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>PRK11179 DNA-binding transcriptional regulator AsnC; Provisional Back     alignment and domain information
>PF11626 Rap1_C: TRF2-interacting telomeric protein/Rap1 - C terminal domain; InterPro: IPR021661 This family of proteins represents the C-terminal domain of the protein Rap-1, which plays a distinct role in silencing at the silent mating-type loci and telomeres [] Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription] Back     alignment and domain information
>PRK11169 leucine-responsive transcriptional regulator; Provisional Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>PF08281 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PF11626 Rap1_C: TRF2-interacting telomeric protein/Rap1 - C terminal domain; InterPro: IPR021661 This family of proteins represents the C-terminal domain of the protein Rap-1, which plays a distinct role in silencing at the silent mating-type loci and telomeres [] Back     alignment and domain information
>PF09197 Rap1-DNA-bind: Rap1, DNA-binding; InterPro: IPR015280 Members of this entry, which are predominantly found in the yeast protein Rap1, assume a secondary structure consisting of a three-helix bundle and an N-terminal arm Back     alignment and domain information
>PF13325 MCRS_N: N-terminal region of micro-spherule protein Back     alignment and domain information
>smart00595 MADF subfamily of SANT domain Back     alignment and domain information
>KOG2009 consensus Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>smart00344 HTH_ASNC helix_turn_helix ASNC type Back     alignment and domain information
>PF10545 MADF_DNA_bdg: Alcohol dehydrogenase transcription factor Myb/SANT-like; InterPro: IPR006578 The MADF (myb/SANT-like domain in Adf-1) domain is an approximately 80-amino-acid module that directs sequence specific DNA binding to a site consisting of multiple tri-nucleotide repeats Back     alignment and domain information
>KOG4468 consensus Polycomb-group transcriptional regulator [Transcription] Back     alignment and domain information
>KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] Back     alignment and domain information
>PF09420 Nop16: Ribosome biogenesis protein Nop16; InterPro: IPR019002 Nucleolar protein 16 (Nop16) is a protein involved in the biogenesis of the 60S ribosomal subunit Back     alignment and domain information
>PF01388 ARID: ARID/BRIGHT DNA binding domain; InterPro: IPR001606 Members of the recently discovered ARID (AT-rich interaction domain; also known as BRIGHT domain)) family of DNA-binding proteins are found in fungi and invertebrate and vertebrate metazoans Back     alignment and domain information
>COG1522 Lrp Transcriptional regulators [Transcription] Back     alignment and domain information
>PF07750 GcrA: GcrA cell cycle regulator; InterPro: IPR011681 GcrA, together with CtrA (see IPR001789 from INTERPRO and IPR001867 from INTERPRO), form a master cell cycle regulator Back     alignment and domain information
>smart00501 BRIGHT BRIGHT, ARID (A/T-rich interaction domain) domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query87
1h8a_C128 Crystal Structure Of Ternary Protein-Dna Complex3 L 1e-14
1a5j_A110 Chicken B-Myb Dna Binding Domain, Repeat 2 And Repe 3e-14
1h88_C159 Crystal Structure Of Ternary Protein-Dna Complex1 L 2e-13
1mse_C105 Solution Structure Of A Specific Dna Complex Of The 1e-12
1gv2_A105 Crystal Structure Of C-Myb R2r3 Length = 105 1e-12
3zqc_A131 Structure Of The Trichomonas Vaginalis Myb3 Dna-Bin 4e-07
1gvd_A52 Crystal Structure Of C-Myb R2 V103l Mutant Length = 2e-06
1mbg_A53 Mouse C-Myb Dna-Binding Domain Repeat 2 Length = 53 4e-06
1gv5_A52 Crystal Structure Of C-Myb R2 Length = 52 4e-06
2k9n_A107 Solution Nmr Structure Of The R2r3 Dna Binding Doma 2e-04
3osf_A126 The Structure Of Protozoan Parasite Trichomonas Vag 3e-04
>pdb|1H8A|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex3 Length = 128 Back     alignment and structure 
Iteration: 1

 Score = 74.3 bits (181), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 54/78 (69%), Gaps = 1/78 (1%)
Query: 10 PSLRKGSWAPEEDRKLIAYIRRYGIWNWSEMPKYAGLLRCGKSCRLRWMNYLRPDIRRGN 69
          P L KG W  EED+++I ++++YG   WS++ K+    R GK CR RW N+L P++++ +
Sbjct: 23 PELNKGPWTKEEDQRVIEHVQKYGPKRWSDIAKHLKG-RIGKQCRERWHNHLNPEVKKTS 81
Query: 70 FTQEEDETIIKLHEQLGN 87
          +T+EED  I + H++LGN
Sbjct: 82 WTEEEDRIIYQAHKRLGN 99
>pdb|1A5J|A Chain A, Chicken B-Myb Dna Binding Domain, Repeat 2 And Repeat3, Nmr, 32 Structures Length = 110 Back     alignment and structure
>pdb|1H88|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex1 Length = 159 Back     alignment and structure
>pdb|1MSE|C Chain C, Solution Structure Of A Specific Dna Complex Of The Myb Dna- Binding Domain With Cooperative Recognition Helices Length = 105 Back     alignment and structure
>pdb|1GV2|A Chain A, Crystal Structure Of C-Myb R2r3 Length = 105 Back     alignment and structure
>pdb|3ZQC|A Chain A, Structure Of The Trichomonas Vaginalis Myb3 Dna-Binding Domain Bound To A Promoter Sequence Reveals A Unique C- Terminal Beta-Hairpin Conformation Length = 131 Back     alignment and structure
>pdb|1GVD|A Chain A, Crystal Structure Of C-Myb R2 V103l Mutant Length = 52 Back     alignment and structure
>pdb|1MBG|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 2 Length = 53 Back     alignment and structure
>pdb|1GV5|A Chain A, Crystal Structure Of C-Myb R2 Length = 52 Back     alignment and structure
>pdb|2K9N|A Chain A, Solution Nmr Structure Of The R2r3 Dna Binding Domain Of Myb1 Protein From Protozoan Parasite Trichomonas Vaginalis Length = 107 Back     alignment and structure
>pdb|3OSF|A Chain A, The Structure Of Protozoan Parasite Trichomonas Vaginalis Myb2 In Complex With Mre-2f-13 Dna Length = 126 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query87
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 1e-40
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 1e-40
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 5e-14
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 3e-39
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 5e-34
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 1e-33
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 1e-25
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 2e-06
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 3e-32
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 6e-25
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 3e-24
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 3e-18
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 1e-13
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 1e-09
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 2e-07
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 4e-07
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 6e-07
1ign_A 246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 7e-06
1vf9_A64 Telomeric repeat binding factor 2; MYB, helix-turn 2e-05
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 3e-05
1w0u_A55 Telomeric repeat binding factor 2; telomere, DNA-b 4e-05
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 9e-05
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 6e-04
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 7e-04
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Length = 105 Back     alignment and structure
 Score =  128 bits (324), Expect = 1e-40
 Identities = 32/76 (42%), Positives = 51/76 (67%), Gaps = 1/76 (1%)

Query: 12 LRKGSWAPEEDRKLIAYIRRYGIWNWSEMPKYAGLLRCGKSCRLRWMNYLRPDIRRGNFT 71
          L KG W  EED+++I  +++YG   WS + K+    R GK CR RW N+L P++++ ++T
Sbjct: 2  LIKGPWTKEEDQRVIKLVQKYGPKRWSVIAKHLKG-RIGKQCRERWHNHLNPEVKKTSWT 60

Query: 72 QEEDETIIKLHEQLGN 87
          +EED  I + H++LGN
Sbjct: 61 EEEDRIIYQAHKRLGN 76
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Length = 131 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Length = 126 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Length = 107 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Length = 52 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Length = 246 Back     alignment and structure
>1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 Back     alignment and structure
>1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Length = 83 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Length = 105 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Length = 122 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query87
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.97
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.97
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.97
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.97
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.97
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.96
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.96
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.95
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.91
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.9
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.9
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.9
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.89
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.89
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.87
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.87
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.86
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.85
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.85
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.84
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.84
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.83
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.81
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.79
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.79
1ign_A 246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.79
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.75
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.74
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 99.58
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.72
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.71
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.71
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.7
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.55
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 99.46
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 99.44
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 99.27
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 99.17
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.16
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 99.13
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 99.08
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 98.76
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 98.75
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 98.72
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 98.63
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 98.58
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 98.48
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 98.46
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 98.42
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 98.38
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 98.36
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 98.35
2crg_A70 Metastasis associated protein MTA3; transcription 98.28
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 97.58
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 98.25
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 98.23
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 98.23
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 98.21
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 98.2
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 98.16
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 98.13
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 98.13
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 98.11
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 97.28
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 97.91
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 97.89
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 97.79
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 97.78
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 97.66
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 97.63
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 97.6
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 97.53
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 97.49
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 97.31
4b4c_A 211 Chromodomain-helicase-DNA-binding protein 1; chrom 97.3
2y9y_A 374 Imitation switch protein 1 (DEL_ATPase); transcrip 96.97
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 96.88
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 96.82
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 96.6
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 96.49
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 96.45
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 96.44
2xag_B 482 REST corepressor 1; amine oxidase, chromatin regul 95.69
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 94.57
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 94.02
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 94.0
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 93.35
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 92.4
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 90.87
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 90.07
2rq5_A121 Protein jumonji; developmental protein, nucleus, r 90.39
2li6_A116 SWI/SNF chromatin-remodeling complex subunit SWI1; 90.18
1ig6_A107 MRF-2, modulator recognition factor 2; DNA binding 85.49
2xb0_X 270 Chromo domain-containing protein 1; hydrolase, DNA 84.79
2crg_A70 Metastasis associated protein MTA3; transcription 84.68
2jrz_A117 Histone demethylase jarid1C; bright/ARID domain, h 83.21
3i4p_A162 Transcriptional regulator, ASNC family; PSI, struc 82.53
1c20_A128 DEAD ringer protein; DNA-binding domain, ARID, AT- 81.77
2p1m_A160 SKP1-like protein 1A; F-BOX, leucine rich repeat, 81.49
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 81.04
1kkx_A123 Transcription regulatory protein ADR6; ARID, DNA-b 80.8
2lm1_A107 Lysine-specific demethylase LID; structural genomi 80.34
2kk0_A145 AT-rich interactive domain-containing protein 3A; 80.24
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
Probab=99.97  E-value=2.7e-31  Score=165.48  Aligned_cols=84  Identities=39%  Similarity=0.787  Sum_probs=76.4

Q ss_pred             CCCCCCCCCCCCCCCCHHHHHHHHHHHHHhCCCCccchhHHhCCCCChhhHHHHHHhhcCCCCCCCCCCHHHHHHHHHHH
Q 048610            3 KAPGSEKPSLRKGSWAPEEDRKLIAYIRRYGIWNWSEMPKYAGLLRCGKSCRLRWMNYLRPDIRRGNFTQEEDETIIKLH   82 (87)
Q Consensus         3 r~~~~~~p~~~k~~WT~eED~~L~~~v~~~g~~~W~~Ia~~~~~~Rt~~qc~~rw~~~l~~~~~~~~wt~eEd~~L~~~v   82 (87)
                      |+....+|++++|+||+|||++|+++|..||.++|..||..|++ ||+.||++||.++|+|.+++++||+|||.+|+++|
T Consensus        16 Rw~~~l~p~~~k~~Wt~eED~~L~~~v~~~g~~~W~~Ia~~l~~-Rt~~qcr~Rw~~~l~p~~~~~~WT~eEd~~L~~~~   94 (128)
T 1h8a_C           16 RWQKVLNPELNKGPWTKEEDQRVIEHVQKYGPKRWSDIAKHLKG-RIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAH   94 (128)
T ss_dssp             ------CTTCCCSCCCHHHHHHHHHHHHHTCSCCHHHHHHHSSS-CCHHHHHHHHHHTTCSSSCCSCCCHHHHHHHHHHH
T ss_pred             HHHHhhCCCCCCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHhcC-CcHHHHHHHHHHhcccccccccCCHHHHHHHHHHH
Confidence            45567889999999999999999999999998789999999998 99999999999999999999999999999999999


Q ss_pred             HHhCC
Q 048610           83 EQLGN   87 (87)
Q Consensus        83 ~~~Gn   87 (87)
                      .+||+
T Consensus        95 ~~~G~   99 (128)
T 1h8a_C           95 KRLGN   99 (128)
T ss_dssp             HHHCS
T ss_pred             HHHCc
Confidence            99996
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>2rq5_A Protein jumonji; developmental protein, nucleus, repressor, transcription, transcription regulation; NMR {Mus musculus} Back     alignment and structure
>2li6_A SWI/SNF chromatin-remodeling complex subunit SWI1; ligand binding, DNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1ig6_A MRF-2, modulator recognition factor 2; DNA binding protein, DNA-binding motif, protein-DNA interaction; NMR {Homo sapiens} SCOP: a.4.3.1 PDB: 2oeh_A Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2jrz_A Histone demethylase jarid1C; bright/ARID domain, helical, structural genomics, structural genomics consortium, SGC, oxidoreductase; NMR {Homo sapiens} PDB: 2yqe_A Back     alignment and structure
>3i4p_A Transcriptional regulator, ASNC family; PSI, structural genom protein structure initiative, midwest center for structural genomics; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>1c20_A DEAD ringer protein; DNA-binding domain, ARID, AT-rich interaction domain, DNA- binding protein; NMR {Drosophila melanogaster} SCOP: a.4.3.1 PDB: 1kqq_A Back     alignment and structure
>2p1m_A SKP1-like protein 1A; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_A* 2p1o_A* 2p1p_A* 2p1q_A* 3c6n_A* 3c6o_A* 3c6p_A* 3ogk_A* 3ogl_A* 3ogm_A* Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>1kkx_A Transcription regulatory protein ADR6; ARID, DNA-binding domain, DNA binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.4.3.1 PDB: 1kn5_A Back     alignment and structure
>2lm1_A Lysine-specific demethylase LID; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Drosophila melanogaster} Back     alignment and structure
>2kk0_A AT-rich interactive domain-containing protein 3A; DEAD ringer, AT-rich interaction domain, NESG, ARID, cytopla binding, nucleus, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 87
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 1e-18
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 0.003
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 2e-17
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 2e-17
d2ckxa183 a.4.1.3 (A:578-660) Telomere binding protein TBP1 9e-14
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 8e-13
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 1e-12
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 2e-11
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 6e-10
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 9e-10
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 1e-08
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 2e-06
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 4e-06
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: c-Myb, DNA-binding domain
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 70.1 bits (172), Expect = 1e-18
 Identities = 24/53 (45%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 12 LRKGSWAPEEDRKLIAYIRRYGIWNWSEMPKYAGLLRCGKSCRLRWMNYLRPD 64
          L KG W  EED++LI  +++YG   WS + K+    R GK CR RW N+L P+
Sbjct: 1  LIKGPWTKEEDQRLIKLVQKYGPKRWSVIAKHLK-GRIGKQCRERWHNHLNPE 52
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 83 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query87
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.92
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.91
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.9
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.84
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.83
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.82
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.81
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.8
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.74
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.73
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.66
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.54
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.54
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 99.49
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.75
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 98.75
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 98.44
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 98.42
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 98.37
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 98.23
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 98.14
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 98.07
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 97.9
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 97.79
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 97.71
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 97.66
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 97.54
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 97.45
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 97.39
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 97.19
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 96.93
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 96.85
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 95.95
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 95.46
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 95.35
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 93.13
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 92.79
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 92.07
d2cyya160 Putative transcriptional regulator PH1519 {Archaeo 90.97
d2cfxa163 Transcriptional regulator LrpC {Bacillus subtilis 90.53
d2cg4a163 Regulatory protein AsnC {Escherichia coli [TaxId: 90.22
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 89.71
d1kkxa_102 Transcription regulator Adr6 (Swi1) {Baker's yeast 88.35
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 87.98
d1i1ga160 LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} 87.87
d1nexa170 Centromere DNA-binding protein complex Cbf3 subuni 87.08
d1ig6a_107 MRF-2 DNA-binding domain {Human (Homo sapiens) [Ta 85.17
d1igna2149 DNA-binding domain of rap1 {Baker's yeast (Sacchar 82.61
d1ryua_120 SWI-SNF complex protein p270, SMARCF1 {Human (Homo 81.69
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: c-Myb, DNA-binding domain
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.92  E-value=5.4e-26  Score=120.99  Aligned_cols=52  Identities=46%  Similarity=0.884  Sum_probs=49.8

Q ss_pred             CCCCCCCHHHHHHHHHHHHHhCCCCccchhHHhCCCCChhhHHHHHHhhcCCC
Q 048610           12 LRKGSWAPEEDRKLIAYIRRYGIWNWSEMPKYAGLLRCGKSCRLRWMNYLRPD   64 (87)
Q Consensus        12 ~~k~~WT~eED~~L~~~v~~~g~~~W~~Ia~~~~~~Rt~~qc~~rw~~~l~~~   64 (87)
                      ++||+||+|||++|+++|.+||.++|+.||+.|++ ||+.||++||.++|+|.
T Consensus         1 l~rg~WT~eED~~L~~~v~~~g~~~W~~Ia~~l~~-Rt~~qc~~Rw~~~L~P~   52 (52)
T d1gvda_           1 LIKGPWTKEEDQRLIKLVQKYGPKRWSVIAKHLKG-RIGKQCRERWHNHLNPE   52 (52)
T ss_dssp             CCCCSCCHHHHHHHHHHHHHHCTTCHHHHHTTSTT-CCHHHHHHHHHHTTSCC
T ss_pred             CCCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHCC-CCHHHHHHHHHhhCCCC
Confidence            57999999999999999999998899999999998 99999999999999984
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cyya1 a.4.5.32 (A:5-64) Putative transcriptional regulator PH1519 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2cfxa1 a.4.5.32 (A:1-63) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2cg4a1 a.4.5.32 (A:4-66) Regulatory protein AsnC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1kkxa_ a.4.3.1 (A:) Transcription regulator Adr6 (Swi1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1i1ga1 a.4.5.32 (A:2-61) LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1nexa1 a.157.1.1 (A:116-185) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ig6a_ a.4.3.1 (A:) MRF-2 DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1igna2 a.4.1.6 (A:446-594) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ryua_ a.4.3.1 (A:) SWI-SNF complex protein p270, SMARCF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure