Citrus Sinensis ID: 048614


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-----
MAFTEFRPLDDKSLLEYIKATPSLSSKIGNKFDALTIKEVGDGNLNFVYIVVGSSGSFVIKQALPYVRCIGESWPMTKERAYFEALALKEHGQLCPDHVPEVYHFDRTMSLIGMRYLEPPHIILRKGLIAGIKYPLLAEHMSEFMAKTLFYTSLLYRTTTEHKRN
ccccccccccHHHHHHHHHHccccccccccccccEEEEEcccccEEEEEEEEcccccEEEECcccHHHHccccccccHHHHHHHHHHHHHHHccccccccEEEECcccccEEEEEccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccccccHHHHcc
***TEFRPLDDKSLLEYIKATPSLSSKIGNKFDALTIKEVGDGNLNFVYIVVGSSGSFVIKQALPYVRCIGESWPMTKERAYFEALALKEHGQLCPDHVPEVYHFDRTMSLIGMRYLEPPHIILRKGLIAGIKYPLLAEHMSEFMAKTLFYTSLLYRT*******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAFTEFRPLDDKSLLEYIKATPSLSSKIGNKFDALTIKEVGDGNLNFVYIVVGSSGSFVIKQALPYVRCIGESWPMTKERAYFEALALKEHGQLCPDHVPEVYHFDRTMSLIGMRYLEPPHIILRKGLIAGIKYPLLAEHMSEFMAKTLFYTSLLYRTTTEHKRN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Methylthioribose kinase Catalyzes the phosphorylation of methylthioribose into methylthioribose-1-phosphate in the methionine cycle. Contributes to the maintenance of AdoMet homeostasis and is required to sustain high rates of ethylene synthesis.probableQ9C6D2
Methylthioribose kinase 2 Catalyzes the phosphorylation of methylthioribose into methylthioribose-1-phosphate.probableQ7XR60
Methylthioribose kinase 1 Catalyzes the phosphorylation of methylthioribose into methylthioribose-1-phosphate.probableQ7XR61

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.1.-Phosphotransferases with an alcohol group as acceptor.probable
2.7.1.100S-methyl-5-thioribose kinase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2PYW, chain A
Confidence level:very confident
Coverage over the Query: 3-160
View the alignment between query and template
View the model in PyMOL