Citrus Sinensis ID: 048634


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-----
VVPKDHDDSNYKLAYDGFLSQVPITTGNVYAINDALSAEGAAEDYETCLKHLTKSNILATSAATGFPKFDLMLLGMGPDGHIASLFPGHPLLKENEKWVTFIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGKSSAVQTALGNNQNSDLLPVQMALAEEEFTWFLDKDATSKL
cccccccccHHHHHHHHHccccccccccCEEccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEcccccccccccccccccccccccEEEEEccccccccccEEEcHHHHHccccEEEEEccccHHHHHHHHHcccccccccccccccccccEEEEECHHHHccc
****DHDDSNYKLAYDGFLSQVPITTGNVYAINDALSAEGAAEDYETCLKHLTKSNILATSAATGFPKFDLMLLGMGPDGHIASLFPGHPLLKENEKWVTFIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGKSSAVQTALGNNQNSDLLPVQMALAEEEFTWFLDKDATSKL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VVPKDHDDSNYKLAYDGFLSQVPITTGNVYAINDALSAEGAAEDYETCLKHLTKSNILATSAATGFPKFDLMLLGMGPDGHIASLFPGHPLLKENEKWVTFIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGKSSAVQTALGNNQNSDLLPVQMALAEEEFTWFLDKDATSKL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable 6-phosphogluconolactonase 5, chloroplastic Hydrolysis of 6-phosphogluconolactone to 6-phosphogluconate.probableQ84WW2
Probable 6-phosphogluconolactonase 4, chloroplastic Hydrolysis of 6-phosphogluconolactone to 6-phosphogluconate.probableQ69NG5

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3CSS, chain A
Confidence level:very confident
Coverage over the Query: 1-175
View the alignment between query and template
View the model in PyMOL