Citrus Sinensis ID: 048709


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200---
MNKEMSGDGTDHRHQQQDKMIPDKIDYVFKVVVIGDSAVGKSQILSRFTKNEFCFDSKSTIGVEFQTRTVTINSKIIKAQIWDTAGQERYRAVTSAYYRGALGAVVVYDITKRQSFDHVARGVEELRAHADSSIRIILIGNKSDLVDMWAVSAEDVVEFAEDQGLFFSEASALNGDNVDTAFFRLLQEIYALSKKELECGNGK
ccccccccccccccccccccccccccEEEEEEEEccccccHHHHHHHHHcccccccccccccEEEEEEEEEEccEEEEEEEEcccccHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHHHHHHcccccEEEEEEEcccccccccccHHHHHHHHHHccccEEEccccccccHHHHHHHHHHHHHHHHHHcHHccccc
*********************PDKIDYVFKVVVIGDSAVGKSQILSRFTKNEFCFDSKSTIGVEFQTRTVTINSKIIKAQIWDTAGQERYRAVTSAYYRGALGAVVVYDITKRQSFDHVARGVEELRAHADSSIRIILIGNKSDLVDMWAVSAEDVVEFAEDQGLFFSEASALNGDNVDTAFFRLLQEIYALS**********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNKEMSGDGTDHRHQQQDKMIPDKIDYVFKVVVIGDSAVGKSQILSRFTKNEFCFDSKSTIGVEFQTRTVTINSKIIKAQIWDTAGQERYRAVTSAYYRGALGAVVVYDITKRQSFDHVARGVEELRAHADSSIRIILIGNKSDLVDMWAVSAEDVVEFAEDQGLFFSEASALNGDNVDTAFFRLLQEIYALSKKELECGNGK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ras-related protein RABA3 Intracellular vesicle trafficking and protein transport.confidentQ9LNK1
Ras-related protein Rab-11A Regulates endocytic recycling. May exert its functions by interacting with multiple effector proteins in different complexes. Acts as a major regulator of membrane delivery during cytokinesis. Together with MYO5B and RAB8A participates in epithelial cell polarization. Together with RAB3IP, RAB8A, the exocyst complex, PARD3, PRKCI, ANXA2, CDC42 and DNMBP promotes transcytosis of PODXL to the apical membrane initiation sites (AMIS), apical surface formation and lumenogenesis. Together with MYO5B participates in CFTR trafficking to the plasma membrane and TF (Transferrin) recycling in nonpolarized cells. Required in a complex with MYO5B and RAB11FIP2 for the transport of NPC1L1 to the plasma membrane. Participates in the sorting and basolateral transport of CDH1 from the Golgi apparatus to the plasma membrane. Regulates the recycling of FCGRT (receptor of Fc region of monomeric Ig G) to basolateral membranes.probableP62493
Ras-related protein Rab-11A Regulates endocytic recycling. May exert its functions by interacting with multiple effector proteins in different complexes. Acts as a major regulator of membrane delivery during cytokinesis. Together with MYO5B and RAB8A participates in epithelial cell polarization. Together with RAB3IP, RAB8A, the exocyst complex, PARD3, PRKCI, ANXA2, CDC42 and DNMBP promotes transcytosis of PODXL to the apical membrane initiation sites (AMIS), apical surface formation and lumenogenesis. Together with MYO5B participates in CFTR trafficking to the plasma membrane and TF (Transferrin) recycling in nonpolarized cells. Required in a complex with MYO5B and RAB11FIP2 for the transport of NPC1L1 to the plasma membrane. Participates in the sorting and basolateral transport of CDH1 from the Golgi apparatus to the plasma membrane. Regulates the recycling of FCGRT (receptor of Fc region of monomeric Ig G) to basolateral membranes.probableQ2TA29

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2HUP, chain A
Confidence level:very confident
Coverage over the Query: 25-53,64-194
View the alignment between query and template
View the model in PyMOL