Citrus Sinensis ID: 048750

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340----

MQTKADYDKECKICTRPFTVFRWRPGRDARFKKTEICQTCSKLKNVCQVCLLDLEYGLPVQVRDTALSINSNDAIPKSDVNREYFAEEHDRRARAGIDYESSYGKARPSDTILKLQRTQPYYKRNRAHVCSFYVRGECTRGAECPYRHEMPVTGELSQQNIKDRYYGVNDPVALKLLNKAGEMPSLEPPEDESIKTLYVGGVDARITEQDLRDNFYAHGEIESIKMHPQKAFAFVTYTTREGAEKAAEELSNKLVIKGLRLKLMWGKPQTQRPEGESSDEVRQQAAIAHSGMLPRSLISQQQNQYQQPGAQDQAAPTPYFNIPPPPQQDRAYYPSMDPQRMGAL

ccccccccccccccccccEEEEEccccccccEEEEEccccccccccHHHccccccccccHHHcHHHHHcccccccccccHHHHHHHHHHHHHHccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccEEEEccccccccHHHHHHHHcccccEEEEEEEccccEEEEEcccHHHHHHHHHHHccccEEccEEEEEEEccccccccccccccHHHHHHHHHcccccccccccHcccccccccccccccccccccccccccccccccccccccccccc

*******DKECKICTRPFTVFRWRPGRDARFKKTEICQTCSKLKNVCQVCLLDLEYGLPVQVRDTALSINSN**IPKSDVNREYFAEEHDRR******************TILKLQRTQPYYKRNRAHVCSFYVRGECTRGAECPYRHEMPVTGELSQQNIKDRYYGVNDPVALKLLN***********EDESIKTLYVGGVDARITEQDLRDNFYAHGEIESIKMHPQKAFAFVTYTTREGAEKAAEELSNKLVIKGLRLKLMWG***********************************************************************PQR*G**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Zinc finger CCCH domain-containing protein 49		probable	Q6Z358
Zinc finger CCCH domain-containing protein 4		probable	Q9LNV5
Pre-mRNA-splicing factor SLT11	Involved in pre-mRNA splicing. Facilitates the cooperative formation of U2/U6 helix II in association with stem II in the spliceosome. Binds to RNA.	probable	Q6C3L4

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3U1L, chain A
Confidence level:very confident
Coverage over the Query: 111-180,191-267
View the alignment between query and template
View the model in PyMOL

Template: 1Y02, chain A
Confidence level:probable
Coverage over the Query: 9-69
View the alignment between query and template
View the model in PyMOL