Citrus Sinensis ID: 048750

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340----

MQTKADYDKECKICTRPFTVFRWRPGRDARFKKTEICQTCSKLKNVCQVCLLDLEYGLPVQVRDTALSINSNDAIPKSDVNREYFAEEHDRRARAGIDYESSYGKARPSDTILKLQRTQPYYKRNRAHVCSFYVRGECTRGAECPYRHEMPVTGELSQQNIKDRYYGVNDPVALKLLNKAGEMPSLEPPEDESIKTLYVGGVDARITEQDLRDNFYAHGEIESIKMHPQKAFAFVTYTTREGAEKAAEELSNKLVIKGLRLKLMWGKPQTQRPEGESSDEVRQQAAIAHSGMLPRSLISQQQNQYQQPGAQDQAAPTPYFNIPPPPQQDRAYYPSMDPQRMGAL

ccccccccccccccccccEEEEEccccccccEEEEEccccccccccHHHccccccccccHHHcHHHHHcccccccccccHHHHHHHHHHHHHHccccccccccccccccHHHHHHHccccHHccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccEEEEccccccccHHHHHHHHcccccEEEEEEEccccEEEEEcccHHHHHHHHHHHccccEEccEEEEEEEcccccccccccccHHHHHHHHHHHcccccccccHHHccccccccccccccccccccccccccccccccccccccccccc

cccccccccEEEEEcccEEEEEEcccccccEEEEEEHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHccccccccHccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccEEEEEEEcccccccHHHHHHHHHHcccEEEEEEEccccEEEEEEccHHHHHHHHHHHcccEEEccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccc

mqtkadydkeckictrpftvfrwrpgrdarfkkTEICQTCSKLKNVCQVCLldleyglpvqvrdtalsinsndaipksdvnreyfaEEHDRRARAGidyessygkarpsdtilklqrtqpyykrnrahvcsfyvrgectrgaecpyrhempvtgelsqqnikdryygvndPVALKLLNkagempsleppedesiktlyvggvdariteqdlrdnfyahgeiesikmhpqkAFAFVTYTTREGAEKAAEELSNKLVIKGLRLKlmwgkpqtqrpegessdEVRQQAAIAhsgmlprslisqqqnqyqqpgaqdqaaptpyfnippppqqdrayypsmdpqrmgal

mqtkadydkeckictrpftvfrwrpgrDARFKKTEICQTCSKLKNVCQVCLLDLEYGLPVQVRDTAlsinsndaipksdvnreyFAEEHdrraragidyessygkarpsdtilklqrtqpyykrnrahVCSFYVRGECTRGaecpyrhempvtgelSQQNIKDRYYGVNDPVALKLLNKAGempsleppedesiKTLYVGGVDARITEQDLRDNFYAHGeiesikmhpqKAFAFVTYTTREGAEKAAEELSNKLVIKGLRLklmwgkpqtqrpegessdEVRQQAAIAHSGMLPRSLISQQQNQYQQPGAQDQAAPTPYFNIPPPPQQDRAYYPSMDPQRMGAL

********KECKICTRPFTVFRWRPGRDARFKKTEICQTCSKLKNVCQVCLLDLEYGLPVQVRDTALSIN****************************************TILKLQRTQPYYKRNRAHVCSFYVRGECTRGAECPYRHEMPVTGELSQQNIKDRYYGVNDPVALKLLN***************IKTLYVGGVDARITEQDLRDNFYAHGEIESIKMHPQKAFAFVTYTTREGAEKAAEELSNKLVIKGLRLKLMWG******************************************************************************

*******DKECKICTRPFTVFRWRPGRDARFKKTEICQTCSKLKNVCQVCLLDLEYGLPVQVRDTALSINSN**IPKSDVNREYFAEEHDRR*************************************CSFYVRGECTRGA***********************************************EDESIKTLYVGGVDARITEQDLRDNFYAHGEIESIKMHPQKAFAFVTYTTREGAEKAAEELSNKLVIKGLRLKLMW************************************************************************PQR*G**

MQTKADYDKECKICTRPFTVFRWRPGRDARFKKTEICQTCSKLKNVCQVCLLDLEYGLPVQVRDTALSINSNDAIPKSDVNREYFAEEHDRRARAGIDYESSYGKARPSDTILKLQRTQPYYKRNRAHVCSFYVRGECTRGAECPYRHEMPVTGELSQQNIKDRYYGVNDPVALKLLNKAGEMPSLEPPEDESIKTLYVGGVDARITEQDLRDNFYAHGEIESIKMHPQKAFAFVTYTTREGAEKAAEELSNKLVIKGLRLKLMWGK*****************AAIAHSGMLPRSLI***************AAPTPYFNIPPPPQQDRAYYPSMDPQRMGAL

*****DYDKECKICTRPFTVFRWRPGRDARFKKTEICQTCSKLKNVCQVCLLDLEYGLPVQVRDTALSINSNDAIPKSDVNREYFAEEHDRRARAGIDYESSYGKARPSDTILKLQRTQPYYKRNRAHVCSFYVRGECTRGAECPYRHEMPVTGELSQQNIKDRYYGVNDPVALKLLNKAGEMPSLEPPEDESIKTLYVGGVDARITEQDLRDNFYAHGEIESIKMHPQKAFAFVTYTTREGAEKAAEELSNKLVIKGLRLKLMWGKP**************************************************YFNIP***************QRMGA*

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		344	2.2.26 [Sep-21-2011]
Q6Z358		486	Zinc finger CCCH domain-c	yes	no	0.982	0.695	0.806	1e-164
Q5SNN4		482	Zinc finger CCCH domain-c	no	no	0.982	0.701	0.812	1e-164
Q9LNV5		481	Zinc finger CCCH domain-c	yes	no	0.953	0.681	0.760	1e-155
Q9ZW36		483	Zinc finger CCCH domain-c	no	no	0.933	0.664	0.712	1e-149
Q9FL40		363	Zinc finger CCCH domain-c	no	no	0.825	0.782	0.571	1e-102
Q6NZZ9		425	Pre-mRNA-splicing factor	yes	no	0.962	0.778	0.460	6e-91
Q5RAY5		420	Pre-mRNA-splicing factor	yes	no	0.965	0.790	0.488	9e-91
Q8BHS3		420	Pre-mRNA-splicing factor	yes	no	0.965	0.790	0.488	1e-90
Q4R4J1		420	Pre-mRNA-splicing factor	N/A	no	0.965	0.790	0.488	1e-90
Q9NW64		420	Pre-mRNA-splicing factor	yes	no	0.965	0.790	0.488	1e-90

>sp\|Q6Z358\|C3H49_ORYSJ Zinc finger CCCH domain-containing protein 49 OS=Oryza sativa subsp. japonica GN=Os07g0281000 PE=2 SV=1	Back alignment and function desciption

 Score =  577 bits (1488), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 279/346 (80%), Positives = 305/346 (88%), Gaps = 8/346 (2%)

Query: 4   KADYDKECKICTRPFTVFRWRPGRDARFKKTEICQTCSKLKNVCQVCLLDLEYGLPVQVR 63
           +A+YDKECKIC RPFTVFRWRPGRDAR+KKTEICQTC KLKNVCQVCLLDLEYGLPVQVR
Sbjct: 37  RAEYDKECKICARPFTVFRWRPGRDARYKKTEICQTCCKLKNVCQVCLLDLEYGLPVQVR 96

Query: 64  DTALSINSNDAIPKSDVNREYFAEEHDRRARAGIDYESSYGKARPSDTILKLQRTQPYYK 123
           DTALS NSNDAIP+SDVNREYFAEEHDRRARAGIDY+SS GKAR +DTILKLQRT PYYK
Sbjct: 97  DTALSTNSNDAIPRSDVNREYFAEEHDRRARAGIDYDSSNGKARANDTILKLQRTAPYYK 156

Query: 124 RNRAHVCSFYVRGECTRGAECPYRHEMPVTGELSQQNIKDRYYGVNDPVALKLLNKAGEM 183
           RNRAHVCSFYVRGECTRGAECPYRHEMP TGELSQQNIKDRYYGVNDPVALKLL+KAGEM
Sbjct: 157 RNRAHVCSFYVRGECTRGAECPYRHEMPETGELSQQNIKDRYYGVNDPVALKLLSKAGEM 216

Query: 184 PSLEPPEDESIKTLYVGGVDARITEQDLRDNFYAHGEIESIKMHPQKAFAFVTYTTREGA 243
           PSL PP+DESI+TLY+GG+D+R+TEQDLRD FYAHGEIE+I+M  Q+A AFVTYTTREGA
Sbjct: 217 PSLTPPDDESIRTLYIGGLDSRVTEQDLRDQFYAHGEIETIRMVLQRACAFVTYTTREGA 276

Query: 244 EKAAEELSNKLVIKGLRLKLMWGKPQTQRPEGESSDEVRQQAAIAHSGMLPRSLISQQQ- 302
           EKAAEEL+NKLVIKG+RLKLMWGKPQ  +PE    DE  +Q  +AH GMLPR++ISQQQ 
Sbjct: 277 EKAAEELANKLVIKGVRLKLMWGKPQAPKPE---EDEAGRQGHVAHGGMLPRAVISQQQS 333

Query: 303 -NQYQQPGAQDQAAPTP---YFNIPPPPQQDRAYYPSMDPQRMGAL 344
            +Q Q PG + Q  P     YFNIP PP  +R  YPSMDPQRMGAL
Sbjct: 334 GDQPQPPGMEGQQQPASASYYFNIPAPPAAERTLYPSMDPQRMGAL 379

Oryza sativa subsp. japonica (taxid: 39947)

>sp\|Q5SNN4\|C3H40_ORYSJ Zinc finger CCCH domain-containing protein 40 OS=Oryza sativa subsp. japonica GN=Os06g0170500 PE=2 SV=1	Back alignment and function description

>sp\|Q9LNV5\|C3H4_ARATH Zinc finger CCCH domain-containing protein 4 OS=Arabidopsis thaliana GN=At1g07360 PE=2 SV=1	Back alignment and function description

>sp\|Q9ZW36\|C3H25_ARATH Zinc finger CCCH domain-containing protein 25 OS=Arabidopsis thaliana GN=At2g29580 PE=2 SV=1	Back alignment and function description

>sp\|Q9FL40\|C3H53_ARATH Zinc finger CCCH domain-containing protein 53 OS=Arabidopsis thaliana GN=At5g07060 PE=2 SV=1	Back alignment and function description

>sp\|Q6NZZ9\|RBM22_DANRE Pre-mRNA-splicing factor RBM22 OS=Danio rerio GN=rbm22 PE=2 SV=1	Back alignment and function description

>sp\|Q5RAY5\|RBM22_PONAB Pre-mRNA-splicing factor RBM22 OS=Pongo abelii GN=RBM22 PE=2 SV=1	Back alignment and function description

>sp\|Q8BHS3\|RBM22_MOUSE Pre-mRNA-splicing factor RBM22 OS=Mus musculus GN=Rbm22 PE=2 SV=1	Back alignment and function description

>sp\|Q4R4J1\|RBM22_MACFA Pre-mRNA-splicing factor RBM22 OS=Macaca fascicularis GN=RBM22 PE=2 SV=1	Back alignment and function description

>sp\|Q9NW64\|RBM22_HUMAN Pre-mRNA-splicing factor RBM22 OS=Homo sapiens GN=RBM22 PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		344
225434698		474	PREDICTED: zinc finger CCCH domain-conta	0.994	0.721	0.892	0.0
224106323		531	predicted protein [Populus trichocarpa]	0.994	0.644	0.877	0.0
224106319		531	predicted protein [Populus trichocarpa]	0.994	0.644	0.877	0.0
449453956		517	PREDICTED: zinc finger CCCH domain-conta	0.991	0.659	0.871	1e-177
133711805		479	putative RNA-binding protein [Solanum ly	0.994	0.713	0.857	1e-172
356549608		467	PREDICTED: zinc finger CCCH domain-conta	0.973	0.717	0.842	1e-171
356574477		481	PREDICTED: zinc finger CCCH domain-conta	0.973	0.696	0.853	1e-170
357462041		492	Zinc finger CCCH domain-containing prote	0.973	0.680	0.845	1e-169
82400164		462	RRM-containing RNA-binding protein-like	0.994	0.740	0.845	1e-169
83283985		487	RRM-containing RNA-binding protein-like	0.994	0.702	0.845	1e-169

>gi\|225434698\|ref\|XP_002280897.1\| PREDICTED: zinc finger CCCH domain-containing protein 49-like [Vitis vinifera]	Back alignment and taxonomy information

 Score =  643 bits (1658), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/344 (89%), Positives = 325/344 (94%), Gaps = 2/344 (0%)

Query: 3   TKADYDKECKICTRPFTVFRWRPGRDARFKKTEICQTCSKLKNVCQVCLLDLEYGLPVQV 62
           TKADYDKECKICTRPFTVFRWRPGRDARFKKTE+CQTCSKLKNVCQVCLLDLEYGLPVQV
Sbjct: 36  TKADYDKECKICTRPFTVFRWRPGRDARFKKTEVCQTCSKLKNVCQVCLLDLEYGLPVQV 95

Query: 63  RDTALSINSNDAIPKSDVNREYFAEEHDRRARAGIDYESSYGKARPSDTILKLQRTQPYY 122
           RDTALSINSNDAIPKSDVNREYFAEEHDRRARAGIDYESS+GK RP+DTILKLQRT PYY
Sbjct: 96  RDTALSINSNDAIPKSDVNREYFAEEHDRRARAGIDYESSFGKVRPNDTILKLQRTTPYY 155

Query: 123 KRNRAHVCSFYVRGECTRGAECPYRHEMPVTGELSQQNIKDRYYGVNDPVALKLLNKAGE 182
           KRNRAHVCSFYVRGECTRGAECPYRHEMP+TGELSQQNIKDRYYGVNDPVALKLLNKAGE
Sbjct: 156 KRNRAHVCSFYVRGECTRGAECPYRHEMPITGELSQQNIKDRYYGVNDPVALKLLNKAGE 215

Query: 183 MPSLEPPEDESIKTLYVGGVDARITEQDLRDNFYAHGEIESIKMHPQKAFAFVTYTTREG 242
           MPSLEPPEDESIKTLYVGG+DAR+TEQDLRD+FYAHGEIES++M  Q+A AFVTYTTREG
Sbjct: 216 MPSLEPPEDESIKTLYVGGLDARVTEQDLRDHFYAHGEIESVRMVLQRACAFVTYTTREG 275

Query: 243 AEKAAEELSNKLVIKGLRLKLMWGKPQTQRPEGESSDEVRQQAAIAHSGMLPRSLISQQQ 302
           AEKAAEELSNKLVIKGLRLKLMWG+PQ  +PEGESS+E RQQAA+AH GMLPR++ISQQQ
Sbjct: 276 AEKAAEELSNKLVIKGLRLKLMWGRPQAPKPEGESSEEARQQAALAHGGMLPRAVISQQQ 335

Query: 303 NQY-QQPGAQDQ-AAPTPYFNIPPPPQQDRAYYPSMDPQRMGAL 344
           NQ  Q PG QDQ   P  YFNIPPPPQQ+R +YPSMDPQRMGAL
Sbjct: 336 NQVIQPPGTQDQPPPPMHYFNIPPPPQQERTFYPSMDPQRMGAL 379

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|224106323\|ref\|XP_002314129.1\| predicted protein [Populus trichocarpa] gi\|222850537\|gb\|EEE88084.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|224106319\|ref\|XP_002314127.1\| predicted protein [Populus trichocarpa] gi\|222850535\|gb\|EEE88082.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|449453956\|ref\|XP_004144722.1\| PREDICTED: zinc finger CCCH domain-containing protein 40-like [Cucumis sativus] gi\|449525922\|ref\|XP_004169965.1\| PREDICTED: zinc finger CCCH domain-containing protein 40-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|133711805\|gb\|ABO36623.1\| putative RNA-binding protein [Solanum lycopersicum]	Back alignment and taxonomy information

>gi\|356549608\|ref\|XP_003543184.1\| PREDICTED: zinc finger CCCH domain-containing protein 40-like [Glycine max]	Back alignment and taxonomy information

>gi\|356574477\|ref\|XP_003555373.1\| PREDICTED: zinc finger CCCH domain-containing protein 40-like [Glycine max]	Back alignment and taxonomy information

>gi\|357462041\|ref\|XP_003601302.1\| Zinc finger CCCH domain-containing protein [Medicago truncatula] gi\|355490350\|gb\|AES71553.1\| Zinc finger CCCH domain-containing protein [Medicago truncatula]	Back alignment and taxonomy information

>gi\|82400164\|gb\|ABB72821.1\| RRM-containing RNA-binding protein-like protein [Solanum tuberosum]	Back alignment and taxonomy information

>gi\|83283985\|gb\|ABC01900.1\| RRM-containing RNA-binding protein-like protein [Solanum tuberosum]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		344
TAIR\|locus:2025077		481	MAC5A "MOS4-associated complex	0.953	0.681	0.745	8.3e-138
TAIR\|locus:2043157		483	MAC5B "MOS4-associated complex	0.962	0.685	0.727	2.2e-137
TAIR\|locus:2169429		363	MAC5C "MOS4-associated complex	0.651	0.617	0.75	4.6e-101
UNIPROTKB\|F1NMD7		420	RBM22 "Pre-mRNA-splicing facto	0.915	0.75	0.525	8e-91
UNIPROTKB\|Q5ZM16		420	RBM22 "Pre-mRNA-splicing facto	0.915	0.75	0.522	2.7e-90
UNIPROTKB\|F2Z4G3		420	RBM22 "Pre-mRNA-splicing facto	0.799	0.654	0.581	3.4e-90
UNIPROTKB\|Q9NW64		420	RBM22 "Pre-mRNA-splicing facto	0.799	0.654	0.581	3.4e-90
UNIPROTKB\|Q4R4J1		420	RBM22 "Pre-mRNA-splicing facto	0.799	0.654	0.581	3.4e-90
UNIPROTKB\|Q5RAY5		420	RBM22 "Pre-mRNA-splicing facto	0.799	0.654	0.581	3.4e-90
MGI\|MGI:1914060		420	Rbm22 "RNA binding motif prote	0.799	0.654	0.581	3.4e-90

TAIR\|locus:2025077 MAC5A "MOS4-associated complex subunit 5A" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1349 (479.9 bits), Expect = 8.3e-138, P = 8.3e-138
 Identities = 255/342 (74%), Positives = 290/342 (84%)

Query:     3 TKADYDKECKICTRPFTVFRWRPGRDARFKKTEICQTCSKLKNVCQVCLLDLEYGLPVQV 62
             TKA+YDKECKICTRPFTVFRWRPGRDAR+KKTEICQTC KLKNVCQVCLLDLEYGLPVQV
Sbjct:    36 TKANYDKECKICTRPFTVFRWRPGRDARYKKTEICQTCCKLKNVCQVCLLDLEYGLPVQV 95

Query:    63 RDTALSINSNDAIPKSDVNREYFAEEHDRRARAGIDYESSYGKARPSDTILKLQRTQPYY 122
             RDTAL+I+++D+IPKSDVNREYFAEEHDR+ARAG+DYESS+GK RP+DTILKLQRT PYY
Sbjct:    96 RDTALNISTHDSIPKSDVNREYFAEEHDRKARAGLDYESSFGKMRPNDTILKLQRTTPYY 155

Query:   123 KRNRAHVCSFYVRGECTRGAECPYRHEMPVTGELSQQNIKDRYYGVNDPVALKLLNKAGE 182
             KRNRAHVCSF++RGECTRGAECPYRHEMP TGELSQQNIKDRYYGVNDPVA+KLL KAGE
Sbjct:   156 KRNRAHVCSFFIRGECTRGAECPYRHEMPETGELSQQNIKDRYYGVNDPVAMKLLGKAGE 215

Query:   183 MPSLEPPEDESIKTLYVGGVDARITEQDLRDNFYAHGEIESIKMHPQKAFAFVTYTTREG 242
             M +LE P+DESIKTLYVGG+++RI EQD+RD FYAHGEIESI++   KA AFVTYT+REG
Sbjct:   216 MGTLESPDDESIKTLYVGGLNSRILEQDIRDQFYAHGEIESIRILADKACAFVTYTSREG 275

Query:   243 AEKAAEELSNKLVIKGLRLKLMWGKPQTQRPEGESSDEVRQQAAIAHSGMLPRSLISXXX 302
             AEKAA+ELSN+LVI G RLKL WG+P   +P+    D   QQ  +AHSG+LPR++IS   
Sbjct:   276 AEKAAQELSNRLVINGQRLKLTWGRP---KPD---QDGANQQGGVAHSGLLPRAVISQQH 329

Query:   303 XXXXXXXXXXXXXXXXYFNIPPPPQQDRAYYPSMDPQRMGAL 344
                             Y+  PPP  QD+ YYPSMDPQRMGA+
Sbjct:   330 NQPPPMQQ--------YYMHPPPANQDKPYYPSMDPQRMGAV 363

GO:0000166 "nucleotide binding" evidence=IEA

GO:0003676 "nucleic acid binding" evidence=IEA

GO:0003723 "RNA binding" evidence=ISS

GO:0005634 "nucleus" evidence=ISM;IDA

GO:0008270 "zinc ion binding" evidence=IEA

GO:0042742 "defense response to bacterium" evidence=IGI

TAIR\|locus:2043157 MAC5B "MOS4-associated complex subunit 5B" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2169429 MAC5C "MOS4-associated complex subunit 5C" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|F1NMD7 RBM22 "Pre-mRNA-splicing factor RBM22" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5ZM16 RBM22 "Pre-mRNA-splicing factor RBM22" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|F2Z4G3 RBM22 "Pre-mRNA-splicing factor RBM22" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9NW64 RBM22 "Pre-mRNA-splicing factor RBM22" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|Q4R4J1 RBM22 "Pre-mRNA-splicing factor RBM22" [Macaca fascicularis (taxid:9541)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5RAY5 RBM22 "Pre-mRNA-splicing factor RBM22" [Pongo abelii (taxid:9601)]	Back alignment and assigned GO terms

MGI\|MGI:1914060 Rbm22 "RNA binding motif protein 22" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q6Z358	C3H49_ORYSJ	No assigned EC number	0.8063	0.9825	0.6954	yes	no
Q6C3L4	SLT11_YARLI	No assigned EC number	0.3144	0.8459	0.8174	yes	no
Q9LNV5	C3H4_ARATH	No assigned EC number	0.7602	0.9534	0.6819	yes	no
O59800	SLT11_SCHPO	No assigned EC number	0.3083	0.8895	0.8644	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		344
cd12224		74	cd12224, RRM_RBM22, RNA recognition motif (RRM) fo	3e-42
smart00360		73	smart00360, RRM, RNA recognition motif	1e-15
cd12354		73	cd12354, RRM3_TIA1_like, RNA recognition motif 2 i	7e-14
cd00590		72	cd00590, RRM_SF, RNA recognition motif (RRM) super	3e-13
cd12346		72	cd12346, RRM3_NGR1_NAM8_like, RNA recognition moti	5e-13
cd12265		86	cd12265, RRM_SLT11, RNA recognition motif of pre-m	5e-13
pfam00076		70	pfam00076, RRM_1, RNA recognition motif	2e-12
cd12305		75	cd12305, RRM_NELFE, RNA recognition motif in negat	2e-11
cd12399		78	cd12399, RRM_HP0827_like, RNA recognition motif in	3e-11
cd12227		77	cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in	4e-11
cd12332		71	cd12332, RRM1_p54nrb_like, RNA recognition motif 1	4e-11
cd12223		84	cd12223, RRM_SR140, RNA recognition motif (RRM) in	4e-11
pfam14259		69	pfam14259, RRM_6, RNA recognition motif (a	1e-10
cd12355		80	cd12355, RRM_RBM18, RNA recognition motif in eukar	2e-10
cd12620		73	cd12620, RRM3_TIAR, RNA recognition motif 3 in nuc	3e-10
cd12382		80	cd12382, RRM_RBMX_like, RNA recognition motif in h	7e-10
cd12360		78	cd12360, RRM_cwf2, RNA recognition motif in yeast	1e-09
cd12621		74	cd12621, RRM3_TIA1, RNA recognition motif 3 in nuc	2e-09
cd12622		74	cd12622, RRM3_PUB1, RNA recognition motif 3 in yea	3e-09
cd12454		80	cd12454, RRM2_RIM4_like, RNA recognition motif 2 i	4e-09
cd12284		73	cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2	8e-09
cd12251		72	cd12251, RRM3_hnRNPR_like, RNA recognition motif 3	1e-08
cd12298		78	cd12298, RRM3_Prp24, RNA recognition motif 3 in fu	2e-08
cd12462		79	cd12462, RRM_SCAF8, RNA recognition motif in SR-re	2e-08
COG0724		306	COG0724, COG0724, RNA-binding proteins (RRM domain	2e-08
cd12361		77	cd12361, RRM1_2_CELF1-6_like, RNA recognition moti	3e-08
cd12414		76	cd12414, RRM2_RBM28_like, RNA recognition motif 2	3e-08
cd12384		76	cd12384, RRM_RBM24_RBM38_like, RNA recognition mot	8e-08
cd12522		79	cd12522, RRM4_MRN1, RNA recognition motif 4 of RNA	9e-08
cd12347		73	cd12347, RRM_PPIE, RNA recognition motif in cyclop	2e-07
cd12378		80	cd12378, RRM1_I_PABPs, RNA recognition motif 1 in	2e-07
cd12407		76	cd12407, RRM_FOX1_like, RNA recognition motif in v	2e-07
cd12380		80	cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou	2e-07
cd12341		68	cd12341, RRM_hnRNPC_like, RNA recognition motif in	3e-07
cd12412		80	cd12412, RRM_DAZL_BOULE, RNA recognition motif in	3e-07
cd12431		80	cd12431, RRM_ALKBH8, RNA recognition motif in alky	4e-07
cd12529		71	cd12529, RRM2_MEI2_like, RNA recognition motif 2 i	4e-07
cd12226		78	cd12226, RRM_NOL8, RNA recognition motif in nucleo	4e-07
cd12373		73	cd12373, RRM_SRSF3_like, RNA recognition motif in	4e-07
cd12309		79	cd12309, RRM2_Spen, RNA recognition motif 2 in the	1e-06
cd12614		74	cd12614, RRM1_PUB1, RNA recognition motif 1 in yea	1e-06
cd12381		79	cd12381, RRM4_I_PABPs, RNA recognition motif 4 in	1e-06
cd12225		77	cd12225, RRM1_2_CID8_like, RNA recognition motif 1	1e-06
cd12363		78	cd12363, RRM_TRA2, RNA recognition motif in transf	2e-06
cd12673		81	cd12673, RRM_BOULE, RNA recognition motif in prote	2e-06
TIGR01622		457	TIGR01622, SF-CC1, splicing factor, CC1-like famil	2e-06
cd12262		82	cd12262, RRM2_4_MRN1, RNA recognition motif 2 and	2e-06
cd12461		81	cd12461, RRM_SCAF4, RNA recognition motif found in	3e-06
cd12524		77	cd12524, RRM1_MEI2_like, RNA recognition motif 1 i	3e-06
cd12588		71	cd12588, RRM1_p54nrb, RNA recognition motif 1 in v	4e-06
cd12389		77	cd12389, RRM2_RAVER, RNA recognition motif 2 in ri	4e-06
cd12310		72	cd12310, RRM3_Spen, RNA recognition motif 3 in the	4e-06
cd12357		89	cd12357, RRM_PPARGC1A_like, RNA recognition motif	5e-06
cd12370		76	cd12370, RRM1_PUF60, RNA recognition motif 1 in (U	6e-06
cd12585		75	cd12585, RRM2_hnRPDL, RNA recognition motif 2 in h	6e-06
cd12495		72	cd12495, RRM3_hnRNPQ, RNA recognition motif 3 in v	6e-06
pfam13893		56	pfam13893, RRM_5, RNA recognition motif	7e-06
cd12521		74	cd12521, RRM3_MRN1, RNA recognition motif 3 of RNA	7e-06
cd12297		78	cd12297, RRM2_Prp24, RNA recognition motif 2 in fu	8e-06
TIGR01648		578	TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonu	8e-06
cd12328		73	cd12328, RRM2_hnRNPA_like, RNA recognition motif 2	9e-06
cd12291		72	cd12291, RRM1_La, RNA recognition motif 1 in La au	9e-06
cd12520		74	cd12520, RRM1_MRN1, RNA recognition motif 1 of RNA	9e-06
cd12632		87	cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1	1e-05
cd12608		69	cd12608, RRM1_CoAA, RNA recognition motif 1 in ver	1e-05
cd12584		80	cd12584, RRM2_hnRNPAB, RNA recognition motif 2 in	1e-05
cd12329		75	cd12329, RRM2_hnRNPD_like, RNA recognition motif 2	2e-05
smart00356		27	smart00356, ZnF_C3H1, zinc finger	2e-05
cd12322		71	cd12322, RRM2_TDP43, RNA recognition motif 2 in TA	2e-05
cd12336		75	cd12336, RRM_RBM7_like, RNA recognition motif in R	2e-05
cd12413		79	cd12413, RRM1_RBM28_like, RNA recognition motif 1	3e-05
cd12271		72	cd12271, RRM1_PHIP1, RNA recognition motif 1 in Ar	3e-05
cd12523		78	cd12523, RRM2_MRN1, RNA recognition motif 2 of RNA	3e-05
cd12311		73	cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in	4e-05
cd12320		76	cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition mot	4e-05
TIGR01628		562	TIGR01628, PABP-1234, polyadenylate binding protei	4e-05
TIGR01628		562	TIGR01628, PABP-1234, polyadenylate binding protei	5e-05
cd12323		74	cd12323, RRM2_MSI, RNA recognition motif 2 in RNA-	5e-05
cd12325		72	cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition	5e-05
cd12415		82	cd12415, RRM3_RBM28_like, RNA recognition motif 3	5e-05
cd12408		77	cd12408, RRM_eIF3G_like, RNA recognition motif in	6e-05
cd12236		91	cd12236, RRM_snRNP70, RNA recognition motif in U1	6e-05
cd12633		80	cd12633, RRM1_FCA, RNA recognition motif 1 in plan	7e-05
cd12331		79	cd12331, RRM_NRD1_SEB1_like, RNA recognition motif	7e-05
cd12448		73	cd12448, RRM2_gar2, RNA recognition motif 2 in yea	7e-05
cd12290		80	cd12290, RRM1_LARP7, RNA recognition motif 1 in La	8e-05
cd12447		76	cd12447, RRM1_gar2, RNA recognition motif 1 in yea	8e-05
cd12353		75	cd12353, RRM2_TIA1_like, RNA recognition motif 2 i	9e-05
cd12467		78	cd12467, RRM_Srp1p_like, RNA recognition motif 1 i	9e-05
cd12571		79	cd12571, RRM6_RBM19, RNA recognition motif 6 in RN	9e-05
TIGR01628		562	TIGR01628, PABP-1234, polyadenylate binding protei	1e-04
cd12494		72	cd12494, RRM3_hnRNPR, RNA recognition motif 3 in v	1e-04
cd12756		74	cd12756, RRM1_hnRNPD, RNA recognition motif 1 in h	1e-04
cd12233		70	cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition m	1e-04
cd12350		74	cd12350, RRM3_SHARP, RNA recognition motif 3 in SM	1e-04
cd12674		79	cd12674, RRM1_Nop4p, RNA recognition motif 1 in ye	1e-04
TIGR01645		612	TIGR01645, half-pint, poly-U binding splicing fact	3e-04
cd12624		91	cd12624, RRM_PRC, RNA recognition motif in peroxis	3e-04
cd12247		72	cd12247, RRM2_U1A_like, RNA recognition motif 2 in	3e-04
PLN03120		260	PLN03120, PLN03120, nucleic acid binding protein;	3e-04
cd12340		67	cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in	3e-04
cd12352		72	cd12352, RRM1_TIA1_like, RNA recognition motif 1 i	3e-04
cd12276		71	cd12276, RRM2_MEI2_EAR1_like, RNA recognition moti	3e-04
cd12366		81	cd12366, RRM1_RBM45, RNA recognition motif 1 in RN	4e-04
cd12324		88	cd12324, RRM_RBM8, RNA recognition motif in RNA-bi	4e-04
cd12636		81	cd12636, RRM2_Bruno_like, RNA recognition motif 2	4e-04
cd12375		77	cd12375, RRM1_Hu_like, RNA recognition motif 1 in	4e-04
cd12406		78	cd12406, RRM4_NCL, RNA recognition motif 4 in vert	5e-04
cd12237		93	cd12237, RRM_snRNP35, RNA recognition motif found	5e-04
cd12556		85	cd12556, RRM2_RBM15B, RNA recognition motif 2 in p	5e-04
cd12450		77	cd12450, RRM1_NUCLs, RNA recognition motif 1 found	6e-04
cd12573		79	cd12573, RRM2_MSI2, RNA recognition motif 2 in RNA	7e-04
cd12397		73	cd12397, RRM2_Nop13p_fungi, RNA recognition motif	9e-04
cd12672		82	cd12672, RRM_DAZL, RNA recognition motif in verteb	0.001
cd12321		77	cd12321, RRM1_TDP43, RNA recognition motif 1 in TA	0.001
cd12344		81	cd12344, RRM1_SECp43_like, RNA recognition motif 1	0.001
TIGR01661		352	TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f	0.001
cd12318		82	cd12318, RRM5_RBM19_like, RNA recognition motif 5	0.001
cd12598		72	cd12598, RRM1_SRSF9, RNA recognition motif 1 in ve	0.001
cd12362		73	cd12362, RRM3_CELF1-6, RNA recognition motif 3 in	0.001
cd12757		75	cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in	0.001
cd12246		78	cd12246, RRM1_U1A_like, RNA recognition motif 1 in	0.001
cd12449		80	cd12449, RRM_CIRBP_RBM3, RNA recognition motif in	0.001
cd12587		71	cd12587, RRM1_PSF, RNA recognition motif 1 in vert	0.002
cd12338		72	cd12338, RRM1_SRSF1_like, RNA recognition motif 1	0.002
cd12580		77	cd12580, RRM2_hnRNPA1, RNA recognition motif 2 in	0.002
cd12358		73	cd12358, RRM1_VICKZ, RNA recognition motif 1 in th	0.002
cd12343		66	cd12343, RRM1_2_CoAA_like, RNA recognition motif 1	0.002
cd12269		69	cd12269, RRM_Vip1_like, RNA recognition motif in a	0.002
cd12586		71	cd12586, RRM1_PSP1, RNA recognition motif 1 in ver	0.002
cd12395		73	cd12395, RRM2_RBM34, RNA recognition motif 2 in RN	0.002
cd12634		81	cd12634, RRM2_CELF1_2, RNA recognition motif 2 in	0.002
cd12273		71	cd12273, RRM1_NEFsp, RNA recognition motif 1 in ve	0.002
cd12609		68	cd12609, RRM2_CoAA, RNA recognition motif 2 in ver	0.003
cd12326		79	cd12326, RRM1_hnRNPA0, RNA recognition motif 1 fou	0.003
cd12393		78	cd12393, RRM_ZCRB1, RNA recognition motif in Zinc	0.003
cd12261		73	cd12261, RRM1_3_MRN1, RNA recognition motif 1 and	0.003
cd12369		68	cd12369, RRM4_RBM45, RNA recognition motif 4 in RN	0.003
cd12583		75	cd12583, RRM2_hnRNPD, RNA recognition motif 2 in h	0.003
cd12570		76	cd12570, RRM5_MRD1, RNA recognition motif 5 in yea	0.003
cd12581		80	cd12581, RRM2_hnRNPA2B1, RNA recognition motif 2 i	0.004
cd12335		83	cd12335, RRM2_SF3B4, RNA recognition motif 2 in sp	0.004
cd12582		80	cd12582, RRM2_hnRNPA3, RNA recognition motif 2 in	0.004

>gnl\|CDD\|240670 cd12224, RRM_RBM22, RNA recognition motif (RRM) found in Pre-mRNA-splicing factor RBM22 and similar proteins	Back alignment and domain information

 Score =  140 bits (356), Expect = 3e-42
 Identities = 48/74 (64%), Positives = 58/74 (78%)

Query: 194 IKTLYVGGVDARITEQDLRDNFYAHGEIESIKMHPQKAFAFVTYTTREGAEKAAEELSNK 253
           I TLYVGG+  R+TE+DLRD+FY  GEI SI + P++  AFVT+TTRE AEKAAE L NK
Sbjct: 1   ITTLYVGGLGERVTEKDLRDHFYQFGEIRSITVVPRQQCAFVTFTTREAAEKAAERLFNK 60

Query: 254 LVIKGLRLKLMWGK 267
           L+I G RLKL WG+
Sbjct: 61  LIINGRRLKLKWGR 74

This subgroup corresponds to the RRM of RBM22 (also known as RNA-binding motif protein 22, or Zinc finger CCCH domain-containing protein 16), a newly discovered RNA-binding motif protein which belongs to the SLT11 gene family. SLT11 gene encoding protein (Slt11p) is a splicing factor in yeast, which is required for spliceosome assembly. Slt11p has two distinct biochemical properties: RNA-annealing and RNA-binding activities. RBM22 is the homolog of SLT11 in vertebrate. It has been reported to be involved in pre-splicesome assembly and to interact with the Ca2+-signaling protein ALG-2. It also plays an important role in embryogenesis. RBM22 contains a conserved RNA recognition motif (RRM), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), a zinc finger of the unusual type C-x8-C-x5-C-x3-H, and a C-terminus that is unusually rich in the amino acids Gly and Pro, including sequences of tetraprolines. Length = 74

>gnl\|CDD\|214636 smart00360, RRM, RNA recognition motif	Back alignment and domain information

>gnl\|CDD\|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1	Back alignment and domain information

>gnl\|CDD\|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily	Back alignment and domain information

>gnl\|CDD\|240792 cd12346, RRM3_NGR1_NAM8_like, RNA recognition motif 3 in yeast negative growth regulatory protein NGR1 (RBP1), yeast protein NAM8 and similar proteins	Back alignment and domain information

>gnl\|CDD\|240711 cd12265, RRM_SLT11, RNA recognition motif of pre-mRNA-splicing factor SLT11 and similar proteins	Back alignment and domain information

>gnl\|CDD\|215696 pfam00076, RRM_1, RNA recognition motif	Back alignment and domain information

>gnl\|CDD\|240751 cd12305, RRM_NELFE, RNA recognition motif in negative elongation factor E (NELF-E) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins	Back alignment and domain information

>gnl\|CDD\|240673 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in SR-related and CTD-associated factor 4 (SCAF4), SR-related and CTD-associated factor 8 (SCAF8) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family	Back alignment and domain information

>gnl\|CDD\|240669 cd12223, RRM_SR140, RNA recognition motif (RRM) in U2-associated protein SR140 and similar proteins	Back alignment and domain information

>gnl\|CDD\|222631 pfam14259, RRM_6, RNA recognition motif (a	Back alignment and domain information

>gnl\|CDD\|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins	Back alignment and domain information

>gnl\|CDD\|241064 cd12620, RRM3_TIAR, RNA recognition motif 3 in nucleolysin TIAR and similar proteins	Back alignment and domain information

>gnl\|CDD\|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240806 cd12360, RRM_cwf2, RNA recognition motif in yeast pre-mRNA-splicing factor Cwc2 and similar proteins	Back alignment and domain information

>gnl\|CDD\|241065 cd12621, RRM3_TIA1, RNA recognition motif 3 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins	Back alignment and domain information

>gnl\|CDD\|241066 cd12622, RRM3_PUB1, RNA recognition motif 3 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins	Back alignment and domain information

>gnl\|CDD\|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic activator RIM4 and similar proteins	Back alignment and domain information

>gnl\|CDD\|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins	Back alignment and domain information

>gnl\|CDD\|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240908 cd12462, RRM_SCAF8, RNA recognition motif in SR-related and CTD-associated factor 8 (SCAF8) and similar proteins	Back alignment and domain information

>gnl\|CDD\|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA	Back alignment and domain information

>gnl\|CDD\|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins	Back alignment and domain information

>gnl\|CDD\|240966 cd12522, RRM4_MRN1, RNA recognition motif 4 of RNA-binding protein MRN1 and similar proteins	Back alignment and domain information

>gnl\|CDD\|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins	Back alignment and domain information

>gnl\|CDD\|240853 cd12407, RRM_FOX1_like, RNA recognition motif in vertebrate RNA binding protein fox-1 homologs and similar proteins	Back alignment and domain information

>gnl\|CDD\|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins	Back alignment and domain information

>gnl\|CDD\|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein C (hnRNP C)-related proteins	Back alignment and domain information

>gnl\|CDD\|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia (DAZ) autosomal homologs, DAZL (DAZ-like) and BOULE	Back alignment and domain information

>gnl\|CDD\|240877 cd12431, RRM_ALKBH8, RNA recognition motif in alkylated DNA repair protein alkB homolog 8 (ALKBH8) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240973 cd12529, RRM2_MEI2_like, RNA recognition motif 2 in plant Mei2-like proteins	Back alignment and domain information

>gnl\|CDD\|240672 cd12226, RRM_NOL8, RNA recognition motif in nucleolar protein 8 (NOL8) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240755 cd12309, RRM2_Spen, RNA recognition motif 2 in the Spen (split end) protein family	Back alignment and domain information

>gnl\|CDD\|241058 cd12614, RRM1_PUB1, RNA recognition motif 1 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins	Back alignment and domain information

>gnl\|CDD\|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I polyadenylate-binding proteins	Back alignment and domain information

>gnl\|CDD\|240671 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 and 2 (RRM1, RRM2) in Arabidopsis thaliana CTC-interacting domain protein CID8, CID9, CID10, CID11, CID12, CID 13 and similar proteins	Back alignment and domain information

>gnl\|CDD\|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins	Back alignment and domain information

>gnl\|CDD\|241117 cd12673, RRM_BOULE, RNA recognition motif in protein BOULE	Back alignment and domain information

>gnl\|CDD\|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family	Back alignment and domain information

>gnl\|CDD\|240708 cd12262, RRM2_4_MRN1, RNA recognition motif 2 and 4 in RNA-binding protein MRN1 and similar proteins	Back alignment and domain information

>gnl\|CDD\|240907 cd12461, RRM_SCAF4, RNA recognition motif found in SR-related and CTD-associated factor 4 (SCAF4) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240968 cd12524, RRM1_MEI2_like, RNA recognition motif 1 in plant Mei2-like proteins	Back alignment and domain information

>gnl\|CDD\|241032 cd12588, RRM1_p54nrb, RNA recognition motif 1 in vertebrate 54 kDa nuclear RNA- and DNA-binding protein (p54nrb)	Back alignment and domain information

>gnl\|CDD\|240835 cd12389, RRM2_RAVER, RNA recognition motif 2 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins	Back alignment and domain information

>gnl\|CDD\|240756 cd12310, RRM3_Spen, RNA recognition motif 3 in the Spen (split end) protein family	Back alignment and domain information

>gnl\|CDD\|240803 cd12357, RRM_PPARGC1A_like, RNA recognition motif in the peroxisome proliferator-activated receptor gamma coactivator 1A (PGC-1alpha) family of regulated coactivators	Back alignment and domain information

>gnl\|CDD\|240816 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U)-binding-splicing factor PUF60 and similar proteins	Back alignment and domain information

>gnl\|CDD\|241029 cd12585, RRM2_hnRPDL, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein D-like (hnRNP DL) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240939 cd12495, RRM3_hnRNPQ, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein Q (hnRNP Q)	Back alignment and domain information

>gnl\|CDD\|206064 pfam13893, RRM_5, RNA recognition motif	Back alignment and domain information

>gnl\|CDD\|240965 cd12521, RRM3_MRN1, RNA recognition motif 3 of RNA-binding protein MRN1 and similar proteins	Back alignment and domain information

>gnl\|CDD\|240743 cd12297, RRM2_Prp24, RNA recognition motif 2 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins	Back alignment and domain information

>gnl\|CDD\|233507 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonucleoprotein R, Q family	Back alignment and domain information

>gnl\|CDD\|240774 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A subfamily	Back alignment and domain information

>gnl\|CDD\|240737 cd12291, RRM1_La, RNA recognition motif 1 in La autoantigen (La or LARP3) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240964 cd12520, RRM1_MRN1, RNA recognition motif 1 of RNA-binding protein MRN1 and similar proteins	Back alignment and domain information

>gnl\|CDD\|241076 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins	Back alignment and domain information

>gnl\|CDD\|241052 cd12608, RRM1_CoAA, RNA recognition motif 1 in vertebrate RRM-containing coactivator activator/modulator (CoAA)	Back alignment and domain information

>gnl\|CDD\|241028 cd12584, RRM2_hnRNPAB, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240775 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins	Back alignment and domain information

>gnl\|CDD\|214632 smart00356, ZnF_C3H1, zinc finger	Back alignment and domain information

>gnl\|CDD\|240768 cd12322, RRM2_TDP43, RNA recognition motif 2 in TAR DNA-binding protein 43 (TDP-43) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240782 cd12336, RRM_RBM7_like, RNA recognition motif in RNA-binding protein 7 (RBM7) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240717 cd12271, RRM1_PHIP1, RNA recognition motif 1 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240967 cd12523, RRM2_MRN1, RNA recognition motif 2 of RNA-binding protein MRN1 and similar proteins	Back alignment and domain information

>gnl\|CDD\|240757 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in serine/arginine-rich splicing factor SRSF2, SRSF8 and similar proteins	Back alignment and domain information

>gnl\|CDD\|240766 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition motif 6 in RNA-binding protein 19 (RBM19 or RBD-1) and RNA recognition motif 5 in multiple RNA-binding domain-containing protein 1 (MRD1)	Back alignment and domain information

>gnl\|CDD\|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family	Back alignment and domain information

>gnl\|CDD\|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family	Back alignment and domain information

>gnl\|CDD\|240769 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA-binding protein Musashi homologs Musashi-1, Musashi-2 and similar proteins	Back alignment and domain information

>gnl\|CDD\|240771 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP A and hnRNP D subfamilies and similar proteins	Back alignment and domain information

>gnl\|CDD\|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins	Back alignment and domain information

>gnl\|CDD\|241077 cd12633, RRM1_FCA, RNA recognition motif 1 in plant flowering time control protein FCA and similar proteins	Back alignment and domain information

>gnl\|CDD\|240777 cd12331, RRM_NRD1_SEB1_like, RNA recognition motif in Saccharomyces cerevisiae protein Nrd1, Schizosaccharomyces pombe Rpb7-binding protein seb1 and similar proteins	Back alignment and domain information

>gnl\|CDD\|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins	Back alignment and domain information

>gnl\|CDD\|240736 cd12290, RRM1_LARP7, RNA recognition motif 1 in La-related protein 7 (LARP7) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins	Back alignment and domain information

>gnl\|CDD\|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins p40-TIA-1 and TIAR	Back alignment and domain information

>gnl\|CDD\|240913 cd12467, RRM_Srp1p_like, RNA recognition motif 1 in fission yeast pre-mRNA-splicing factor Srp1p and similar proteins	Back alignment and domain information

>gnl\|CDD\|241015 cd12571, RRM6_RBM19, RNA recognition motif 6 in RNA-binding protein 19 (RBM19) and similar proteins	Back alignment and domain information

>gnl\|CDD\|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family	Back alignment and domain information

>gnl\|CDD\|240938 cd12494, RRM3_hnRNPR, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein R (hnRNP R)	Back alignment and domain information

>gnl\|CDD\|241200 cd12756, RRM1_hnRNPD, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240679 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition motif found in fission yeast pre-mRNA-splicing factor Srp1p, Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins	Back alignment and domain information

>gnl\|CDD\|240796 cd12350, RRM3_SHARP, RNA recognition motif 3 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins	Back alignment and domain information

>gnl\|CDD\|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar protein 4 (Nop4p) and similar proteins	Back alignment and domain information

>gnl\|CDD\|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family	Back alignment and domain information

>gnl\|CDD\|241068 cd12624, RRM_PRC, RNA recognition motif in peroxisome proliferator-activated receptor gamma coactivator-related protein 1 (PRC) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240693 cd12247, RRM2_U1A_like, RNA recognition motif 2 in the U1A/U2B"/SNF protein family	Back alignment and domain information

>gnl\|CDD\|215588 PLN03120, PLN03120, nucleic acid binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|240786 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in yeast nucleolar protein 3 (Npl3p) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240798 cd12352, RRM1_TIA1_like, RNA recognition motif 1 in granule-associated RNA binding proteins p40-TIA-1 and TIAR	Back alignment and domain information

>gnl\|CDD\|240722 cd12276, RRM2_MEI2_EAR1_like, RNA recognition motif 2 in Mei2-like proteins and terminal EAR1-like proteins	Back alignment and domain information

>gnl\|CDD\|240812 cd12366, RRM1_RBM45, RNA recognition motif 1 in RNA-binding protein 45 (RBM45) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240770 cd12324, RRM_RBM8, RNA recognition motif in RNA-binding protein RBM8A, RBM8B nd similar proteins	Back alignment and domain information

>gnl\|CDD\|241080 cd12636, RRM2_Bruno_like, RNA recognition motif 2 in Drosophila melanogaster Bruno protein and similar proteins	Back alignment and domain information

>gnl\|CDD\|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins	Back alignment and domain information

>gnl\|CDD\|240852 cd12406, RRM4_NCL, RNA recognition motif 4 in vertebrate nucleolin	Back alignment and domain information

>gnl\|CDD\|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins	Back alignment and domain information

>gnl\|CDD\|241000 cd12556, RRM2_RBM15B, RNA recognition motif 2 in putative RNA binding motif protein 15B (RBM15B) from vertebrate	Back alignment and domain information

>gnl\|CDD\|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants	Back alignment and domain information

>gnl\|CDD\|241017 cd12573, RRM2_MSI2, RNA recognition motif 2 in RNA-binding protein Musashi homolog 2 (Musashi-2) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240843 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 2 in yeast nucleolar protein 13 (Nop13p) and similar proteins	Back alignment and domain information

>gnl\|CDD\|241116 cd12672, RRM_DAZL, RNA recognition motif in vertebrate deleted in azoospermia-like (DAZL) proteins	Back alignment and domain information

>gnl\|CDD\|240767 cd12321, RRM1_TDP43, RNA recognition motif 1 in TAR DNA-binding protein 43 (TDP-43) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240790 cd12344, RRM1_SECp43_like, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins	Back alignment and domain information

>gnl\|CDD\|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor	Back alignment and domain information

>gnl\|CDD\|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins	Back alignment and domain information

>gnl\|CDD\|241042 cd12598, RRM1_SRSF9, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 9 (SRSF9)	Back alignment and domain information

>gnl\|CDD\|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins	Back alignment and domain information

>gnl\|CDD\|241201 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240692 cd12246, RRM1_U1A_like, RNA recognition motif 1 in the U1A/U2B"/SNF protein family	Back alignment and domain information

>gnl\|CDD\|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins	Back alignment and domain information

>gnl\|CDD\|241031 cd12587, RRM1_PSF, RNA recognition motif 1 in vertebrate polypyrimidine tract-binding protein (PTB)-associated-splicing factor (PSF)	Back alignment and domain information

>gnl\|CDD\|240784 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 1 (SRSF1) and similar proteins	Back alignment and domain information

>gnl\|CDD\|241024 cd12580, RRM2_hnRNPA1, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240804 cd12358, RRM1_VICKZ, RNA recognition motif 1 in the VICKZ family proteins	Back alignment and domain information

>gnl\|CDD\|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in RRM-containing coactivator activator/modulator (CoAA) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240715 cd12269, RRM_Vip1_like, RNA recognition motif in a group of uncharacterized plant proteins similar to fission yeast Vip1	Back alignment and domain information

>gnl\|CDD\|241030 cd12586, RRM1_PSP1, RNA recognition motif 1 in vertebrate paraspeckle protein 1 (PSP1)	Back alignment and domain information

>gnl\|CDD\|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins	Back alignment and domain information

>gnl\|CDD\|241078 cd12634, RRM2_CELF1_2, RNA recognition motif 2 in CUGBP Elav-like family member CELF-1, CELF-2 and similar proteins	Back alignment and domain information

>gnl\|CDD\|240719 cd12273, RRM1_NEFsp, RNA recognition motif 1 in vertebrate putative RNA exonuclease NEF-sp	Back alignment and domain information

>gnl\|CDD\|241053 cd12609, RRM2_CoAA, RNA recognition motif 2 in vertebrate RRM-containing coactivator activator/modulator (CoAA)	Back alignment and domain information

>gnl\|CDD\|240772 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 found in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240707 cd12261, RRM1_3_MRN1, RNA recognition motif 1 and 3 in RNA-binding protein MRN1 and similar proteins	Back alignment and domain information

>gnl\|CDD\|240815 cd12369, RRM4_RBM45, RNA recognition motif 4 in RNA-binding protein 45 (RBM45) and similar proteins	Back alignment and domain information

>gnl\|CDD\|241027 cd12583, RRM2_hnRNPD, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) and similar proteins	Back alignment and domain information

>gnl\|CDD\|241014 cd12570, RRM5_MRD1, RNA recognition motif 5 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins	Back alignment and domain information

>gnl\|CDD\|241025 cd12581, RRM2_hnRNPA2B1, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A2/B1 (hnRNP A2/B1) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240781 cd12335, RRM2_SF3B4, RNA recognition motif 2 in splicing factor 3B subunit 4 (SF3B4) and similar proteins	Back alignment and domain information

>gnl\|CDD\|241026 cd12582, RRM2_hnRNPA3, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A3 (hnRNP A3) and similar proteins	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		344
KOG0153		377	consensus Predicted RNA-binding protein (RRM super	100.0
KOG0148		321	consensus Apoptosis-promoting RNA-binding protein	99.68
PLN03134		144	glycine-rich RNA-binding protein 4; Provisional	99.64
TIGR01628		562	PABP-1234 polyadenylate binding protein, human typ	99.55
KOG0122		270	consensus Translation initiation factor 3, subunit	99.54
KOG0132		894	consensus RNA polymerase II C-terminal domain-bind	99.52
TIGR01661		352	ELAV_HUD_SF ELAV/HuD family splicing factor. These	99.51
KOG0149		247	consensus Predicted RNA-binding protein SEB4 (RRM	99.5
PF00076		70	RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or	99.46
TIGR01659		346	sex-lethal sex-lethal family splicing factor. This	99.45
TIGR01661		352	ELAV_HUD_SF ELAV/HuD family splicing factor. These	99.45
KOG0125		376	consensus Ataxin 2-binding protein (RRM superfamil	99.45
TIGR01645		612	half-pint poly-U binding splicing factor, half-pin	99.44
PLN03120		260	nucleic acid binding protein; Provisional	99.41
KOG0107		195	consensus Alternative splicing factor SRp20/9G8 (R	99.38
KOG0144		510	consensus RNA-binding protein CUGBP1/BRUNO (RRM su	99.36
TIGR01659		346	sex-lethal sex-lethal family splicing factor. This	99.34
TIGR01648		578	hnRNP-R-Q heterogeneous nuclear ribonucleoprotein	99.33
PF14259		70	RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or	99.33
PLN03213		759	repressor of silencing 3; Provisional	99.31
TIGR01649		481	hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor	99.31
KOG4207		256	consensus Predicted splicing factor, SR protein su	99.31
KOG0117		506	consensus Heterogeneous nuclear ribonucleoprotein	99.3
KOG0121		153	consensus Nuclear cap-binding protein complex, sub	99.29
PF13893		56	RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or	99.29
smart00362		72	RRM_2 RNA recognition motif.	99.29
TIGR01628		562	PABP-1234 polyadenylate binding protein, human typ	99.28
KOG0111		298	consensus Cyclophilin-type peptidyl-prolyl cis-tra	99.25
TIGR01645		612	half-pint poly-U binding splicing factor, half-pin	99.24
TIGR01649		481	hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor	99.24
PLN03121		243	nucleic acid binding protein; Provisional	99.23
KOG0148		321	consensus Apoptosis-promoting RNA-binding protein	99.22
KOG0144		510	consensus RNA-binding protein CUGBP1/BRUNO (RRM su	99.22
KOG0145		360	consensus RNA-binding protein ELAV/HU (RRM superfa	99.21
KOG0113		335	consensus U1 small nuclear ribonucleoprotein (RRM	99.21
KOG0105		241	consensus Alternative splicing factor ASF/SF2 (RRM	99.19
TIGR01622		457	SF-CC1 splicing factor, CC1-like family. A homolog	99.19
TIGR01648		578	hnRNP-R-Q heterogeneous nuclear ribonucleoprotein	99.18
TIGR01642		509	U2AF_lg U2 snRNP auxilliary factor, large subunit,	99.17
KOG0114		124	consensus Predicted RNA-binding protein (RRM super	99.17
cd00590		74	RRM RRM (RNA recognition motif), also known as RBD	99.16
TIGR01622		457	SF-CC1 splicing factor, CC1-like family. A homolog	99.11
COG0724		306	RNA-binding proteins (RRM domain) [General functio	99.1
smart00360		71	RRM RNA recognition motif.	99.08
KOG0130		170	consensus RNA-binding protein RBM8/Tsunagi (RRM su	99.07
KOG0146		371	consensus RNA-binding protein ETR-3 (RRM superfami	99.04
KOG0109		346	consensus RNA-binding protein LARK, contains RRM a	99.04
KOG0131		203	consensus Splicing factor 3b, subunit 4 [RNA proce	99.02
KOG0126		219	consensus Predicted RNA-binding protein (RRM super	98.99
KOG0108		435	consensus mRNA cleavage and polyadenylation factor	98.99
KOG0117		506	consensus Heterogeneous nuclear ribonucleoprotein	98.99
TIGR01642		509	U2AF_lg U2 snRNP auxilliary factor, large subunit,	98.96
KOG0145		360	consensus RNA-binding protein ELAV/HU (RRM superfa	98.96
KOG0127		678	consensus Nucleolar protein fibrillarin NOP77 (RRM	98.91
KOG0131		203	consensus Splicing factor 3b, subunit 4 [RNA proce	98.89
KOG0151		877	consensus Predicted splicing regulator, contains R	98.89
KOG4206		221	consensus Spliceosomal protein snRNP-U1A/U2B [RNA	98.88
KOG0127		678	consensus Nucleolar protein fibrillarin NOP77 (RRM	98.86
KOG0146		371	consensus RNA-binding protein ETR-3 (RRM superfami	98.82
KOG0124		544	consensus Polypyrimidine tract-binding protein PUF	98.82
smart00361		70	RRM_1 RNA recognition motif.	98.81
KOG0109		346	consensus RNA-binding protein LARK, contains RRM a	98.79
KOG4212		608	consensus RNA-binding protein hnRNP-M [RNA process	98.76
KOG0147		549	consensus Transcriptional coactivator CAPER (RRM s	98.76
KOG0123		369	consensus Polyadenylate-binding protein (RRM super	98.72
KOG0415		479	consensus Predicted peptidyl prolyl cis-trans isom	98.69
KOG4208		214	consensus Nucleolar RNA-binding protein NIFK [Gene	98.68
KOG0123		369	consensus Polyadenylate-binding protein (RRM super	98.64
KOG0124		544	consensus Polypyrimidine tract-binding protein PUF	98.58
KOG1457		284	consensus RNA binding protein (contains RRM repeat	98.57
KOG0110		725	consensus RNA-binding protein (RRM superfamily) [G	98.54
KOG0110		725	consensus RNA-binding protein (RRM superfamily) [G	98.52
KOG2202		260	consensus U2 snRNP splicing factor, small subunit,	98.51
KOG4661		940	consensus Hsp27-ERE-TATA-binding protein/Scaffold	98.42
KOG4205		311	consensus RNA-binding protein musashi/mRNA cleavag	98.42
KOG0116		419	consensus RasGAP SH3 binding protein rasputin, con	98.4
KOG4212		608	consensus RNA-binding protein hnRNP-M [RNA process	98.35
KOG0533		243	consensus RRM motif-containing protein [RNA proces	98.32
KOG0106		216	consensus Alternative splicing factor SRp55/B52/SR	98.32
KOG4205		311	consensus RNA-binding protein musashi/mRNA cleavag	98.29
KOG2135		526	consensus Proteins containing the RNA recognition	98.26
KOG4660		549	consensus Protein Mei2, essential for commitment t	98.2
KOG1548		382	consensus Transcription elongation factor TAT-SF1	98.07
KOG4454		267	consensus RNA binding protein (RRM superfamily) [G	98.0
KOG4209		231	consensus Splicing factor RNPS1, SR protein superf	97.98
KOG1190		492	consensus Polypyrimidine tract-binding protein [RN	97.97
PF14605		53	Nup35_RRM_2: Nup53/35/40-type RNA recognition moti	97.89
PF04059		97	RRM_2: RNA recognition motif 2; InterPro: IPR00720	97.87
PF11608		90	Limkain-b1: Limkain b1; InterPro: IPR024582 This e	97.85
PF08777		105	RRM_3: RNA binding motif; InterPro: IPR014886 This	97.85
KOG0226		290	consensus RNA-binding proteins [General function p	97.75
KOG4206		221	consensus Spliceosomal protein snRNP-U1A/U2B [RNA	97.6
KOG1457		284	consensus RNA binding protein (contains RRM repeat	97.52
PF05172		100	Nup35_RRM: Nup53/35/40-type RNA recognition motif;	97.47
KOG0106		216	consensus Alternative splicing factor SRp55/B52/SR	97.46
KOG1456		494	consensus Heterogeneous nuclear ribonucleoprotein	97.42
COG5175		480	MOT2 Transcriptional repressor [Transcription]	97.39
KOG4849		498	consensus mRNA cleavage factor I subunit/CPSF subu	97.36
smart00356		27	ZnF_C3H1 zinc finger.	97.27
KOG1365		508	consensus RNA-binding protein Fusilli, contains RR	97.24
PF00642		27	zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and si	97.02
KOG1190		492	consensus Polypyrimidine tract-binding protein [RN	97.02
KOG4211		510	consensus Splicing factor hnRNP-F and related RNA-	96.96
KOG1855		484	consensus Predicted RNA-binding protein [General f	96.88
KOG2193		584	consensus IGF-II mRNA-binding protein IMP, contain	96.83
KOG1548		382	consensus Transcription elongation factor TAT-SF1	96.82
KOG0112		975	consensus Large RNA-binding protein (RRM superfami	96.76
KOG0147		549	consensus Transcriptional coactivator CAPER (RRM s	96.69
KOG0120		500	consensus Splicing factor U2AF, large subunit (RRM	96.67
KOG4211		510	consensus Splicing factor hnRNP-F and related RNA-	96.58
KOG4676		479	consensus Splicing factor, arginine/serine-rich [R	96.58
KOG1924		1102	consensus RhoA GTPase effector DIA/Diaphanous [Sig	96.5
KOG0120		500	consensus Splicing factor U2AF, large subunit (RRM	96.5
KOG4210		285	consensus Nuclear localization sequence binding pr	96.49
KOG0105		241	consensus Alternative splicing factor ASF/SF2 (RRM	96.45
KOG2416		718	consensus Acinus (induces apoptotic chromatin cond	96.24
PF08952		146	DUF1866: Domain of unknown function (DUF1866) ; In	96.18
KOG3152		278	consensus TBP-binding protein, activator of basal	96.1
KOG1456		494	consensus Heterogeneous nuclear ribonucleoprotein	96.09
PF15023		166	DUF4523: Protein of unknown function (DUF4523)	96.04
KOG1995		351	consensus Conserved Zn-finger protein [General fun	95.93
KOG2314		698	consensus Translation initiation factor 3, subunit	95.87
KOG0129		520	consensus Predicted RNA-binding protein (RRM super	95.64
PF14608		19	zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type	95.56
KOG0129		520	consensus Predicted RNA-binding protein (RRM super	95.48
KOG4285		350	consensus Mitotic phosphoprotein [Cell cycle contr	94.62
KOG0112		975	consensus Large RNA-binding protein (RRM superfami	94.33
KOG1996		378	consensus mRNA splicing factor [RNA processing and	94.08
KOG4307		944	consensus RNA binding protein RBM12/SWAN [General	93.9
PF04847		184	Calcipressin: Calcipressin; InterPro: IPR006931 Ca	93.82
PF10309		62	DUF2414: Protein of unknown function (DUF2414); In	93.39
KOG0115		275	consensus RNA-binding protein p54nrb (RRM superfam	93.33
PF08675		87	RNA_bind: RNA binding domain; InterPro: IPR014789	92.63
KOG0128		881	consensus RNA-binding protein SART3 (RRM superfami	92.38
KOG0128		881	consensus RNA-binding protein SART3 (RRM superfami	91.8
KOG4307		944	consensus RNA binding protein RBM12/SWAN [General	91.28
KOG2068		327	consensus MOT2 transcription factor [Transcription	91.1
PF03467		176	Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120	90.81
KOG1040		325	consensus Polyadenylation factor I complex, subuni	89.73
KOG1365		508	consensus RNA-binding protein Fusilli, contains RR	89.61
KOG4574		1007	consensus RNA-binding protein (contains RRM and Pu	89.57
PF03880		74	DbpA: DbpA RNA binding domain ; InterPro: IPR00558	88.96
KOG2591		684	consensus c-Mpl binding protein, contains La domai	88.58
PF07576		110	BRAP2: BRCA1-associated protein 2; InterPro: IPR01	87.09
KOG2494		331	consensus C3H1-type Zn-finger protein [Transcripti	86.9
PF01363		69	FYVE: FYVE zinc finger; InterPro: IPR000306 Zinc f	86.61
PF10013		42	DUF2256: Uncharacterized protein conserved in bact	84.36
KOG1040		325	consensus Polyadenylation factor I complex, subuni	83.65
PF09963		56	DUF2197: Uncharacterized protein conserved in bact	83.18
PF10650		23	zf-C3H1: Putative zinc-finger domain; InterPro: IP	82.45
smart00064		68	FYVE Protein present in Fab1, YOTB, Vac1, and EEA1	81.05

>KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

Probab=100.00  E-value=6.8e-95  Score=661.67  Aligned_cols=264  Identities=69%  Similarity=1.206  Sum_probs=256.0

Q ss_pred             cccccccccccCCCCceeeeecCCCCCCccceeeehhccccccccccccccCCCCCcHHHHHhhhccCCCCCCCcchhhH
Q 048750            3 TKADYDKECKICTRPFTVFRWRPGRDARFKKTEICQTCSKLKNVCQVCLLDLEYGLPVQVRDTALSINSNDAIPKSDVNR   82 (344)
Q Consensus         3 ~k~~~g~eckic~rpft~f~w~~~~~~~~~~t~ic~~ca~~kn~cq~c~~dl~~~~p~~~rd~~l~~~~~~~~~~~~~n~   82 (344)
                      ||++||+||||||||||+|||+||+++|||||+||||||++|||||||||||+|||||||||++|+++  |++|++|+||
T Consensus        36 tK~~~gkECKICtrPfT~Frw~pgr~~r~kKTeICqtCaklKNvCQ~CmLDle~glPiqvRD~~l~l~--dn~p~~dvnr  113 (377)
T KOG0153|consen   36 TKEPYGKECKICTRPFTIFRWCPGRGARFKKTEICQTCAKLKNVCQTCMLDLEYGLPIQVRDAALSLV--DNVPTSDVNR  113 (377)
T ss_pred             eccccCCccceecCcceEEEeccccccccccchHHHHHHHHHhHHHHhhhhhccCCcceehhhhhhhh--hccchhhhhH
Confidence            89999999999999999999999999999999999999999999999999999999999999999997  7999999999


Q ss_pred             HHHHHHHHHHHHcCCCcccccCCCC---chhHHHHhhhcCcccccCCccccccccCCcCCCCCCCCCCCCCCCCCccccc
Q 048750           83 EYFAEEHDRRARAGIDYESSYGKAR---PSDTILKLQRTQPYYKRNRAHVCSFYVRGECTRGAECPYRHEMPVTGELSQQ  159 (344)
Q Consensus        83 ~~~~~~~~~~~~~g~~~~~~~~~~~---~~~~l~~lar~~py~~~~~~~~C~ff~~G~C~rG~~Cpy~H~~p~~~~~~~~  159 (344)
                      |||+|++++++.+|.++....++.+   ++|+|++|+|+.|||++|+++||+||++|+|+||++|+|+|++|.+++++.|
T Consensus       114 e~f~qn~~r~l~~G~~~q~~~~~~~a~~~~d~l~~l~rt~p~ykrn~p~Icsf~v~geckRG~ec~yrhEkp~d~~L~~q  193 (377)
T KOG0153|consen  114 EYFAQNHDRKLSNGDDTQPASAKARALAPNDMLRKLQRTTPYYKRNRPHICSFFVKGECKRGAECPYRHEKPPDDPLSLQ  193 (377)
T ss_pred             HHHHHHHHhhcccCCCcccccchhcccchHHHHHHHhccCccccCCCCccccceeeccccccccccccccCCCCcchhhc
Confidence            9999999999988876666555555   8899999999999999999999999999999999999999999988999999


Q ss_pred             cccccccCCCChHHHhhhhccCCCCCCCCCCCCCccEEEeccCCCCCCHHHHHHHhhcCCCeeEEEEeCCCCEEEEEeCC
Q 048750          160 NIKDRYYGVNDPVALKLLNKAGEMPSLEPPEDESIKTLYVGGVDARITEQDLRDNFYAHGEIESIKMHPQKAFAFVTYTT  239 (344)
Q Consensus       160 ~i~d~~~g~~~p~a~k~l~~~~~~~~~~~p~d~~~~tLfVgnL~~~~te~~L~~~F~~fG~I~~v~i~~~kg~aFV~F~~  239 (344)
                      ||+|||+|.+||++.+++.++..++.+.+|+|.++++|||++|.+.++|.+|+++|.+||+|++|++...++||||+|.+
T Consensus       194 ni~dryyg~ndPva~kil~ra~~~~~lepPeD~~I~tLyIg~l~d~v~e~dIrdhFyqyGeirsi~~~~~~~CAFv~ftT  273 (377)
T KOG0153|consen  194 NIKDRYYGLNDPVALKILNRAGSAGTLEPPEDTSIKTLYIGGLNDEVLEQDIRDHFYQYGEIRSIRILPRKGCAFVTFTT  273 (377)
T ss_pred             ccccccccccChHHHHHHhhcccccccCCCcccceeEEEecccccchhHHHHHHHHhhcCCeeeEEeecccccceeeehh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhCCCeEECCeEEEEEEcCC
Q 048750          240 REGAEKAAEELSNKLVIKGLRLKLMWGKP  268 (344)
Q Consensus       240 ~~~A~~A~~~l~~~~~i~g~~l~V~~ak~  268 (344)
                      +++|+.|++...+.++|+|++|+|.|+++
T Consensus       274 R~aAE~Aae~~~n~lvI~G~Rl~i~Wg~~  302 (377)
T KOG0153|consen  274 REAAEKAAEKSFNKLVINGFRLKIKWGRP  302 (377)
T ss_pred             hHHHHHHHHhhcceeeecceEEEEEeCCC
Confidence            99999999999999999999999999999

>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PLN03134 glycine-rich RNA-binding protein 4; Provisional	Back alignment and domain information

>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family	Back alignment and domain information

>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription]	Back alignment and domain information

>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor	Back alignment and domain information

>KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only]	Back alignment and domain information

>PF00076 RRM_1: RNA recognition motif	Back alignment and domain information

>TIGR01659 sex-lethal sex-lethal family splicing factor	Back alignment and domain information

>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor	Back alignment and domain information

>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>TIGR01645 half-pint poly-U binding splicing factor, half-pint family	Back alignment and domain information

>PLN03120 nucleic acid binding protein; Provisional	Back alignment and domain information

>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>TIGR01659 sex-lethal sex-lethal family splicing factor	Back alignment and domain information

>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family	Back alignment and domain information

>PF14259 RRM_6: RNA recognition motif (a	Back alignment and domain information

>PLN03213 repressor of silencing 3; Provisional	Back alignment and domain information

>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family	Back alignment and domain information

>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification]	Back alignment and domain information

>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>PF13893 RRM_5: RNA recognition motif	Back alignment and domain information

>smart00362 RRM_2 RNA recognition motif	Back alignment and domain information

>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family	Back alignment and domain information

>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR01645 half-pint poly-U binding splicing factor, half-pint family	Back alignment and domain information

>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family	Back alignment and domain information

>PLN03121 nucleic acid binding protein; Provisional	Back alignment and domain information

>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>TIGR01622 SF-CC1 splicing factor, CC1-like family	Back alignment and domain information

>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family	Back alignment and domain information

>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor	Back alignment and domain information

>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability	Back alignment and domain information

>TIGR01622 SF-CC1 splicing factor, CC1-like family	Back alignment and domain information

>COG0724 RNA-binding proteins (RRM domain) [General function prediction only]	Back alignment and domain information

>smart00360 RRM RNA recognition motif	Back alignment and domain information

>KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only]	Back alignment and domain information

>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification]	Back alignment and domain information

>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification]	Back alignment and domain information

>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor	Back alignment and domain information

>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification]	Back alignment and domain information

>KOG0151 consensus Predicted splicing regulator, contains RRM, SWAP and RPR domains [General function prediction only]	Back alignment and domain information

>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification]	Back alignment and domain information

>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>smart00361 RRM_1 RNA recognition motif	Back alignment and domain information

>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only]	Back alignment and domain information

>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification]	Back alignment and domain information

>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription]	Back alignment and domain information

>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only]	Back alignment and domain information

>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only]	Back alignment and domain information

>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification]	Back alignment and domain information

>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription]	Back alignment and domain information

>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification]	Back alignment and domain information

>KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms]	Back alignment and domain information

>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification]	Back alignment and domain information

>KOG0533 consensus RRM motif-containing protein [RNA processing and modification]	Back alignment and domain information

>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification]	Back alignment and domain information

>KOG2135 consensus Proteins containing the RNA recognition motif [General function prediction only]	Back alignment and domain information

>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription]	Back alignment and domain information

>KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification]	Back alignment and domain information

>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification]	Back alignment and domain information

>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif	Back alignment and domain information

>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2	Back alignment and domain information

>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes	Back alignment and domain information

>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation	Back alignment and domain information

>KOG0226 consensus RNA-binding proteins [General function prediction only]	Back alignment and domain information

>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification]	Back alignment and domain information

>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only]	Back alignment and domain information

>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT []	Back alignment and domain information

>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification]	Back alignment and domain information

>COG5175 MOT2 Transcriptional repressor [Transcription]	Back alignment and domain information

>KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification]	Back alignment and domain information

>smart00356 ZnF_C3H1 zinc finger	Back alignment and domain information

>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only]	Back alignment and domain information

>PF00642 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and similar); InterPro: IPR000571 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification]	Back alignment and domain information

>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification]	Back alignment and domain information

>KOG1855 consensus Predicted RNA-binding protein [General function prediction only]	Back alignment and domain information

>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only]	Back alignment and domain information

>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription]	Back alignment and domain information

>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription]	Back alignment and domain information

>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification]	Back alignment and domain information

>KOG4676 consensus Splicing factor, arginine/serine-rich [RNA processing and modification]	Back alignment and domain information

>KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG4210 consensus Nuclear localization sequence binding protein [Transcription]	Back alignment and domain information

>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG2416 consensus Acinus (induces apoptotic chromatin condensation) [Chromatin structure and dynamics]	Back alignment and domain information

>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function	Back alignment and domain information

>KOG3152 consensus TBP-binding protein, activator of basal transcription (contains rrm motif) [Transcription]	Back alignment and domain information

>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification]	Back alignment and domain information

>PF15023 DUF4523: Protein of unknown function (DUF4523)	Back alignment and domain information

>KOG1995 consensus Conserved Zn-finger protein [General function prediction only]	Back alignment and domain information

>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PF14608 zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type	Back alignment and domain information

>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG4285 consensus Mitotic phosphoprotein [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG1996 consensus mRNA splicing factor [RNA processing and modification]	Back alignment and domain information

>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only]	Back alignment and domain information

>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells	Back alignment and domain information

>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function	Back alignment and domain information

>KOG0115 consensus RNA-binding protein p54nrb (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN)	Back alignment and domain information

>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only]	Back alignment and domain information

>KOG2068 consensus MOT2 transcription factor [Transcription]	Back alignment and domain information

>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons	Back alignment and domain information

>KOG1040 consensus Polyadenylation factor I complex, subunit, Yth1 (CPSF subunit) [RNA processing and modification]	Back alignment and domain information

>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only]	Back alignment and domain information

>KOG4574 consensus RNA-binding protein (contains RRM and Pumilio-like repeats) [General function prediction only]	Back alignment and domain information

>PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins []	Back alignment and domain information

>KOG2591 consensus c-Mpl binding protein, contains La domain [Signal transduction mechanisms]	Back alignment and domain information

>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening []	Back alignment and domain information

>KOG2494 consensus C3H1-type Zn-finger protein [Transcription]	Back alignment and domain information

>PF01363 FYVE: FYVE zinc finger; InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>PF10013 DUF2256: Uncharacterized protein conserved in bacteria (DUF2256); InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function	Back alignment and domain information

>KOG1040 consensus Polyadenylation factor I complex, subunit, Yth1 (CPSF subunit) [RNA processing and modification]	Back alignment and domain information

>PF09963 DUF2197: Uncharacterized protein conserved in bacteria (DUF2197); InterPro: IPR019241 This family represents various hypothetical bacterial proteins with no known function	Back alignment and domain information

>PF10650 zf-C3H1: Putative zinc-finger domain; InterPro: IPR019607 This domain is conserved in fungi and might be a zinc-finger domain as it contains three conserved Cs and an H in the C-x8-C-x5-C-x3-H conformation typical of a zinc-finger	Back alignment and domain information

>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		344
2ytc_A		85	Solution Structure Of Rna Binding Domain In Pre-Mrn		1e-16
1x4g_A		109	Solution Structure Of Rrm Domain In Nucleolysin Tia		2e-08
3tp2_A		229	Crystal Structure Of The Splicing Factor Cwc2 From		7e-06
3u1l_A		240	Structure Of The Mrna Splicing Complex Component Cw		8e-06
2dgu_A		103	Solution Structure Of The Rna Binding Domain In Het		1e-04
3sde_B		261	Crystal Structure Of A Paraspeckle-Protein Heterodi		2e-04
1x5p_A		97	Solution Structure Of Rrm Domain In Parp14 Length =		2e-04
2cpj_A		99	Solution Structure Of The N-Terminal Rna Recognitio		2e-04
1wf0_A		88	Solution Structure Of Rrm Domain In Tar Dna-Binding		5e-04
2cph_A		107	Solution Structure Of The C-Terminal Rna Recognitio		6e-04
2jrs_A		108	Solution Nmr Structure Of Caper Rrm2 Domain. Northe		8e-04
2jx2_A		121	Solution Structure Of Nelf E Rrm Length = 121		8e-04

>pdb|2YTC|A Chain A, Solution Structure Of Rna Binding Domain In Pre-Mrna- Splicing Factor Rbm22 Length = 85