Citrus Sinensis ID: 048833


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------63
MTKIINFVTGENQSNLDQLQKVLRYSLKGKRYLLVMDDVWNEDPEAWCKLKSLLLGGANGSKILVTTRSRKVASIMGTRGGTTGFNLQGLPFEDCLSLFMKCAFKEERDKHPNLVKIGVEIVKKCGGIPLAVRTLGSLLYDSTDEHFWEYVRDNEIWQLEQKESGILPALRLSYDQLPPRLKQCVAYCSIFPKDFKFDSYDLVQFWMAHGLLQSHNKKEDLEDIGMRYLKELLSRSFFQDLTFGMFGLEVLTFKMHDLMHDLAMLVAKDEFLVVNSDCQSIPKSVRHLSFAAANASRNDFSSLLSDLGRVRTICFSTDDDEKTSQSFVESCISKSQFLRVLNLSESSIEVCSRKMGNLKHMRYLDLSRNSKIKKLPKSICELQSLETLDLAGCLELEELPKDIKYLVNLRVLVLTTKQKSLQESGIRSLGSLRSLKIFGCRDLEHLFEEIDQLSVLRTLSIESCPRLISLPPAIKYLSSLENLYLARCESLDLNLNMEIEGEGSHHDRKNTRPHLRRVFIMEITQLLELPQWLLQGSTDTLRDLFIVSCPNFMALPRSLKDLEALETLVIARCPKLSSLPEGMHHVTTLKLLTIGGCPALSERCKPPTGEDWPKISHIPQVYLDGEMIK
cHHHHccccccccccHHHHHHHHHHHHcccEEEEEEcccccccHHHHHHHHHHHcccccccEEEEEcccHHHHcccccccccccEEcccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHcccccHHHHHHHHHccccccccccccccHHHHccccccccccHHHHHcccccccccCCcHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccccccccccccccEEEEEEccHHHHHHHHHHcccEEEECccccccccccEEEEEEcccccccccccccccccccEEEECccccccccHHHHHHHHHHccccccEEEcccccccHHcccccccccccccccccccccccccHHHcccccccEEccccccccccccccccccccccEEEEcccccccccccccccccccEEcEEECccccccHHHHccccccccEEcccccccccccHHHccccccccccccccccccccccccccccccccccccccccccEEEEEEEcccccccccccccccccccEEEEccccccccccccccccccccEEEEccccccCCccccccccccccEEEEccccHHHHHccccccccccccccccEEECccCEcc
MTKIINFVTGEN*SNLDQLQKVLRYSLKGKRYLLVMDDVWNEDPEAWCKLKSLLLGGANGSKILVTTRSRKVASIMGTRGGTTGFNLQGLPFEDCLSLFMKCAFKEERDKHPNLVKIGVEIVKKCGGIPLAVRTLGSLLYDSTDEHFWEYVRDNEIWQLEQKESGILPALRLSYDQLPPRLKQCVAYCSIFPKDFKFDSYDLVQFWMAHGLLQSHNKKEDLEDIGMRYLKELLSRSFFQDLTFGMFGLEVLTFKMHDLMHDLAMLVAKDEFLVVNSDCQSIPKSVRHLSFAAANASRNDFSSLLSDLGRVRTICFSTDDDEKTSQSFVESCISKSQFLRVLNLSESSIEVCSRKMGNLKHMRYLDLSRNSKIKKLPKSICELQSLETLDLAGCLELEELPKDIKYLVNLRVLVLTTKQKSLQESGIRSLGSLRSLKIFGCRDLEHLFEEIDQLSVLRTLSIESCPRLISLPPAIKYLSSLENLYLARCESLDLNLNMEI********RKNTRPHLRRVFIMEITQLLELPQWLLQGSTDTLRDLFIVSCPNFMALPRSLKDLEALETLVIARCPKLSSLPEGMHHVTTLKLLTIGGCPALSERCKPPTGEDWPKISHIPQVYLDGEMIK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTKIINFVTGENQSNLDQLQKVLRYSLKGKRYLLVMDDVWNEDPEAWCKLKSLLLGGANGSKILVTTRSRKVASIMGTRGGTTGFNLQGLPFEDCLSLFMKCAFKEERDKHPNLVKIGVEIVKKCGGIPLAVRTLGSLLYDSTDEHFWEYVRDNEIWQLEQKESGILPALRLSYDQLPPRLKQCVAYCSIFPKDFKFDSYDLVQFWMAHGLLQSHNKKEDLEDIGMRYLKELLSRSFFQDLTFGMFGLEVLTFKMHDLMHDLAMLVAKDEFLVVNSDCQSIPKSVRHLSFAAANASRNDFSSLLSDLGRVRTICFSTDDDEKTSQSFVESCISKSQFLRVLNLSESSIEVCSRKMGNLKHMRYLDLSRNSKIKKLPKSICELQSLETLDLAGCLELEELPKDIKYLVNLRVLVLTTKQKSLQESGIRSLGSLRSLKIFGCRDLEHLFEEIDQLSVLRTLSIESCPRLISLPPAIKYLSSLENLYLARCESLDLNLNMEIEGEGSHHDRKNTRPHLRRVFIMEITQLLELPQWLLQGSTDTLRDLFIVSCPNFMALPRSLKDLEALETLVIARCPKLSSLPEGMHHVTTLKLLTIGGCPALSERCKPPTGEDWPKISHIPQVYLDGEMIK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4FCG, chain A
Confidence level:very confident
Coverage over the Query: 306-491,527-573
View the alignment between query and template
View the model in PyMOL
Template: 4FCG, chain A
Confidence level:very confident
Coverage over the Query: 335-491,527-597
View the alignment between query and template
View the model in PyMOL
Template: 4ECN, chain A
Confidence level:very confident
Coverage over the Query: 283-628
View the alignment between query and template
View the model in PyMOL
Template: 3SFZ, chain A
Confidence level:very confident
Coverage over the Query: 14-209,222-270
View the alignment between query and template
View the model in PyMOL
Template: 2A5Y, chain B
Confidence level:very confident
Coverage over the Query: 15-271
View the alignment between query and template
View the model in PyMOL