Citrus Sinensis ID: 048833

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------63

MTKIINFVTGENQSNLDQLQKVLRYSLKGKRYLLVMDDVWNEDPEAWCKLKSLLLGGANGSKILVTTRSRKVASIMGTRGGTTGFNLQGLPFEDCLSLFMKCAFKEERDKHPNLVKIGVEIVKKCGGIPLAVRTLGSLLYDSTDEHFWEYVRDNEIWQLEQKESGILPALRLSYDQLPPRLKQCVAYCSIFPKDFKFDSYDLVQFWMAHGLLQSHNKKEDLEDIGMRYLKELLSRSFFQDLTFGMFGLEVLTFKMHDLMHDLAMLVAKDEFLVVNSDCQSIPKSVRHLSFAAANASRNDFSSLLSDLGRVRTICFSTDDDEKTSQSFVESCISKSQFLRVLNLSESSIEVCSRKMGNLKHMRYLDLSRNSKIKKLPKSICELQSLETLDLAGCLELEELPKDIKYLVNLRVLVLTTKQKSLQESGIRSLGSLRSLKIFGCRDLEHLFEEIDQLSVLRTLSIESCPRLISLPPAIKYLSSLENLYLARCESLDLNLNMEIEGEGSHHDRKNTRPHLRRVFIMEITQLLELPQWLLQGSTDTLRDLFIVSCPNFMALPRSLKDLEALETLVIARCPKLSSLPEGMHHVTTLKLLTIGGCPALSERCKPPTGEDWPKISHIPQVYLDGEMIK

cHHHHccccccccccHHHHHHHHHHHHcccEEEEEEcccccccHHHHHHHHHHHcccccccEEEEEcccHHHHcccccccccccEEcccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHcccccHHHHHHHHHccccccccccccccHHHHccccccccccHHHHHcccccccccEEcHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccccccccccccccEEEEEEccHHHHHHHHHHHccEEEEEccccccccccEEEEEEcccccccccccccccccccEEEEEccccccccHHHHHHHHHHccccccEEEcccccccHHcccccccccccccccccccccccccHHHHccccccEEccccccccccccccccccccccEEEEcccccccccccccccccccEEcEEEEccccccHHHHccccccccEEccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccEEEEEEEcccccccccccccccccccEEEEccccccccccccccccccccEEEEccccccEEccccccccccccEEEEccccHHHHHccccccccccccccccEEEEccEEcc

cHHHHHHccccccccHHHHHHHHHHHHcccEEEEEEEccccccHHHHHHHHHHHHccccccEEEEEEccHHHHHHHccccccccEEcccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHHccHccccccccccHHHHHEcHHcccHHHHHHHHHHHcccccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccEEEEHHHHHHHHHHHccccEEEEccccccccccEEEEEEEEcccccccccccHHHHHccEEEEccccccccccHHHHHHHcccccccEEEEEccccccccccccccccccEEEEcccccccccccccccccccccEEEEcccccHccccHHccccccccEEEEccccccccccccccccccEEEEEEccccccccHHHHcccccccEEEEccccccccccHHccccccccEEEEEccccHccccccccHHHHHHHHHccccccccEEEEEcccccccccHHHccccccccEEEEEccccccccccHcccccccccEEEEccccccccccHHccccccccEEEEcccHHHHHHcccccccccccHccccEEEccccEcc

MTKIINFvtgenqsnLDQLQKVLRYSLKGKRYLLVMDDVWNEDPEAWCKLKSLllggangskILVTTRSRKVASImgtrggttgfnlqglpfedCLSLFMKCAfkeerdkhpnlVKIGVEIVKKCGGIPLAVRTLgsllydstDEHFWEYVRDNEIWQleqkesgilpalrlsydqlpprlKQCVAYCSifpkdfkfdsyDLVQFWMAHgllqshnkkedLEDIGMRYLKELLSrsffqdltfGMFGLEVLTFKMHDLMHDLAMLVAkdeflvvnsdcqsipksVRHLSFAAANASRNDFSSLLSDlgrvrticfstdddektSQSFVESCISKSQFLRVLNLSESSIEVCSRKmgnlkhmryldlsrnskikkLPKSIcelqsletldlagcleleelpKDIKYLVNLRVLVLTTKQKSLqesgirslgslrslkifgcRDLEHLFEEIDQLSVLrtlsiescprlislppAIKYLSSLENLYLARCEsldlnlnmeiegegshhdrkntrphLRRVFIMEITQLLELPQWLLQGSTDTLRDLFIvscpnfmalprsLKDLEALETLVIArcpklsslpegmhhvTTLKLLtiggcpalserckpptgedwpkishipqvyldgemik

mtkiinfvtgenqsnldqLQKVLRYSLKGKRYLLVMDDVWNEDPEAWCKLKSLllggangskilvttrsrkvasimgtrggttgfnlqGLPFEDCLSLFMKCAFKeerdkhpnlvKIGVEIVKKCGGIPLAVRTLGSLLYDSTDEHFWEYVRDNEIWQLEQKESGILPALRLSYDQLPPRLKQCVAYCSIFPKDFKFDSYDLVQFWMAHGLLQSHNKKEDLEDIGMRYLKELLSRSFFQDLTFGMFGLEVLTFKMHDLMHDLAMLVAKDEFLVVNSDCQSIPKSVRHLSFAAANASRNDFSSLLSDLGRVRTICFSTDDDEKTSQSFVEScisksqflrvlnLSESSIEVCSrkmgnlkhmrylDLSRNSKIKKLPKSICELQSLETLDLAGCLELEELPKDIKYLVNLRVLVLTtkqkslqesgirslgslrsLKIFGCRDLEHLFEEIDQLSVLRTLSIESCPRLISLPPAIKYLSSLENLYLARCESLDLNLNMEIEgegshhdrkntrpHLRRVFIMEITQLLELPQWLLQGSTDTLRDLFIVSCPNFMALPRSLKDLEALETLVIARCPklsslpegmHHVTTLKLLTIGGCPALSERCkpptgedwpkishipqvyldgemik

MTKIINFVTGENQSNLDQLQKVLRYSLKGKRYLLVMDDVWNEDPEAWCKLKSLLLGGANGSKILVTTRSRKVASIMGTRGGTTGFNLQGLPFEDCLSLFMKCAFKEERDKHPNLVKIGVEIVKKCGGIPLAVRTLGSLLYDSTDEHFWEYVRDNEIWQLEQKESGILPALRLSYDQLPPRLKQCVAYCSIFPKDFKFDSYDLVQFWMAHGLLQSHNKKEDLEDIGMRYLKELLSRSFFQDLTFGMFGLEVLTFKMHDLMHDLAMLVAKDEFLVVNSDCQSIPKSVRHLSFAAANASRNDFSSLLSDLGRVRTICFSTDDDEKTSQSFVESCISKSQFLRVLNLSESSIEVCSRKMGNLKHMRYLDLSRNSKIKKLPKSICELQSLETLDLAGCLELEELPKDIKYLVNLRVLVLTTKQKSLQEsgirslgslrslKIFGCRDLEHLFEEIDQLSVLRTLSIESCPRLISLPPAIKYLSSLENLYLARCESLDLNLNMEIEGEGSHHDRKNTRPHLRRVFIMEITQLLELPQWLLQGSTDTLRDLFIVSCPNFMALPRSLKDLEALETLVIARCPKLSSLPEGMHHVTTLKLLTIGGCPALSERCKPPTGEDWPKISHIPQVYLDGEMIK

****INFVTGEN*SNLDQLQKVLRYSLKGKRYLLVMDDVWNEDPEAWCKLKSLLLGGANGSKILVTTRSRKVASIMGTRGGTTGFNLQGLPFEDCLSLFMKCAFKEERDKHPNLVKIGVEIVKKCGGIPLAVRTLGSLLYDSTDEHFWEYVRDNEIWQLEQKESGILPALRLSYDQLPPRLKQCVAYCSIFPKDFKFDSYDLVQFWMAHGLLQSHNKKEDLEDIGMRYLKELLSRSFFQDLTFGMFGLEVLTFKMHDLMHDLAMLVAKDEFLVVNSDCQSIPKSVRHLSFAAANASRNDFSSLLSDLGRVRTICFST********SFVESCISKSQFLRVLNLSESSIEVCSRKMGNLKHMRYLDLSRNSKIKKLPKSICELQSLETLDLAGCLELEELPKDIKYLVNLRVLVLTTKQKSLQESGIRSLGSLRSLKIFGCRDLEHLFEEIDQLSVLRTLSIESCPRLISLPPAIKYLSSLENLYLARCESLDLNLNMEI**************HLRRVFIMEITQLLELPQWLLQGSTDTLRDLFIVSCPNFMALPRSLKDLEALETLVIARCPKLSSLPEGMHHVTTLKLLTIGGCPALSERCKP*TGEDWPKISHIPQVYL******

MTKIINFV*******LDQLQKVLRYSLKGKRYLLVMDDVWNEDPEAWCKLKSLLLGGANGSKILVTTRSRKVASIMGTRGGTTGFNLQGLPFEDCLSLFMKCAF**********VKIGVEIVKKCGGIPLAVRTLGSLLYDSTDEHFWEYVRDNEIWQLEQKESGILPALRLSYDQLPPRLKQCVAYCSIFPKDFKFDSYDLVQFWMAHGLLQSHNKKEDLEDIGMRYLKELLSRSFFQDLTFGMFGLEVLTFKMHDLMHDLAMLVAKDEFLVVNSDCQSIPKSVRHLSFAAANASRNDFSSLLSDLGRVRTICFSTDDDEKTSQSFVESCISKSQFLRVLNLSESSIEVCSRKMGNLKHMRYLDLSRNSKIKKLPKSICELQSLETLDLAGCLELEELPKDIKYLVNLRVLVLTTKQKSLQESGIRSLGSLRSLKIFGCRD***********SVLRTLSIESCPRLISLPPAIKYLSSLENLYLARCESLDLNL************RKNTRPHLRRVFIMEITQLLELPQWLLQGSTDTLRDLFIVSCPNFMALPRSLKDLEALETLVIARCPKLSSLPEGMHHVTTLKLLTIGGCPALSERCKPPTGEDWPKISHIPQVYLDGEMIK

MTKIINFVTGENQSNLDQLQKVLRYSLKGKRYLLVMDDVWNEDPEAWCKLKSLLLGGANGSKILVTTRSRKVASIMGTRGGTTGFNLQGLPFEDCLSLFMKCAFKEERDKHPNLVKIGVEIVKKCGGIPLAVRTLGSLLYDSTDEHFWEYVRDNEIWQLEQKESGILPALRLSYDQLPPRLKQCVAYCSIFPKDFKFDSYDLVQFWMAHGLLQSHNKKEDLEDIGMRYLKELLSRSFFQDLTFGMFGLEVLTFKMHDLMHDLAMLVAKDEFLVVNSDCQSIPKSVRHLSFAAANASRNDFSSLLSDLGRVRTICFSTD**********ESCISKSQFLRVLNLSESSIEVCSRKMGNLKHMRYLDLSRNSKIKKLPKSICELQSLETLDLAGCLELEELPKDIKYLVNLRVLVLTTKQKSLQESGIRSLGSLRSLKIFGCRDLEHLFEEIDQLSVLRTLSIESCPRLISLPPAIKYLSSLENLYLARCESLDLNLNMEIE*********NTRPHLRRVFIMEITQLLELPQWLLQGSTDTLRDLFIVSCPNFMALPRSLKDLEALETLVIARCPKLSSLPEGMHHVTTLKLLTIGGCPALSERCKPPTGEDWPKISHIPQVYLDGEMIK

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		629	2.2.26 [Sep-21-2011]
Q7XA42		979	Putative disease resistan	N/A	no	0.821	0.528	0.389	4e-86
Q7XA39		988	Putative disease resistan	N/A	no	0.807	0.514	0.381	4e-84
Q7XBQ9		970	Disease resistance protei	N/A	no	0.608	0.394	0.447	5e-80
Q7XA40		992	Putative disease resistan	N/A	no	0.839	0.532	0.369	1e-79
Q9LRR5		1424	Putative disease resistan	yes	no	0.856	0.378	0.331	4e-62
Q9LRR4		1054	Putative disease resistan	no	no	0.647	0.386	0.374	1e-59
Q39214		926	Disease resistance protei	no	no	0.635	0.431	0.287	2e-35
Q8W474		907	Probable disease resistan	no	no	0.925	0.641	0.259	8e-34
Q38834		852	Disease resistance RPP13-	no	no	0.688	0.508	0.298	9e-34
Q9SX38		857	Putative disease resistan	no	no	0.573	0.421	0.312	1e-33

>sp\|Q7XA42\|RGA1_SOLBU Putative disease resistance protein RGA1 OS=Solanum bulbocastanum GN=RGA1 PE=2 SV=2	Back alignment and function desciption

 Score =  319 bits (818), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 225/577 (38%), Positives = 310/577 (53%), Gaps = 60/577 (10%)

Query: 4   IINFVTGENQSNLD--QLQKVLRYSLKGKRYLLVMDDVWNEDPEAWCKLKSLLLGGANGS 61
           I+  + G++ S++D   LQK L+  L GKRY LV+DDVWNED   W  L+++L  GA+G+
Sbjct: 226 IVESIEGKSLSDMDLAPLQKKLQELLNGKRYFLVLDDVWNEDQHKWANLRAVLKVGASGA 285

Query: 62  KILVTTRSRKVASIMGTRGGTTGFNLQGLPFEDCLSLFMKCAFKEERDKHPNLVKIGVEI 121
            +L TTR  KV SIMGT      + L  L  EDC  LFM+ AF  + + +PNL+ IG EI
Sbjct: 286 FVLTTTRLEKVGSIMGT---LQPYELSNLSPEDCWFLFMQRAFGHQEEINPNLMAIGKEI 342

Query: 122 VKKCGGIPLAVRTLGSLLYDSTDEHFWEYVRDNEIWQLEQKESGILPALRLSYDQLPPRL 181
           VKKCGG+PLA +TLG +L    +E  WE+VRD+ IW L Q ES ILPALRLSY  LP  L
Sbjct: 343 VKKCGGVPLAAKTLGGILRFKREEREWEHVRDSPIWNLPQDESSILPALRLSYHHLPLDL 402

Query: 182 KQCVAYCSIFPKDFKFDSYDLVQFWMAHGLLQSHNKKEDLEDIGMRYLKELLSRSFFQDL 241
           +QC  YC++FPKD K    +L+ FWMAHG L S    E LED+G     EL  RSFFQ+ 
Sbjct: 403 RQCFVYCAVFPKDTKMAKENLIAFWMAHGFLLSKGNLE-LEDVGNEVWNELYLRSFFQE- 460

Query: 242 TFGMFGLEVLT----FKMHDLMHDLAMLVAKDEFLVVNSDCQSIPKSVRHLSFAAANASR 297
                 +EV +    FKMHDL+HDLA                         S  +AN S 
Sbjct: 461 ------IEVESGKTYFKMHDLIHDLAT------------------------SLFSANTSS 490

Query: 298 NDFSSLLSDL-GRVRTICFSTDDDEKTSQSFVESCISKSQFLRVLNLSESSIEVCSRKMG 356
           ++   + ++  G + +I F+     +   S+  S + K   LRVLNL  S++      +G
Sbjct: 491 SNIREINANYDGYMMSIGFA-----EVVSSYSPSLLQKFVSLRVLNLRNSNLNQLPSSIG 545

Query: 357 NLKHMRYLDLSRNSKIKKLPKSICELQSLETLDLAGCLELEELPKDIKYLVNLRVLVLTT 416
           +L H+RYLDLS N +I+ LPK +C+LQ+L+TLDL  C  L  LPK    L +LR L+L  
Sbjct: 546 DLVHLRYLDLSGNFRIRNLPKRLCKLQNLQTLDLHYCDSLSCLPKQTSKLGSLRNLLLDG 605

Query: 417 KQKSLQESGIRSLGSLRSLKIF--GCRDLEHLFEEIDQLSVLRTLSIESCPRLISLPPAI 474
              +     I  L  L+SL  F  G R   H   E+  L++  ++SI    R+     A 
Sbjct: 606 CSLTSTPPRIGLLTCLKSLSCFVIGKRK-GHQLGELKNLNLYGSISITKLDRVKKDTDAK 664

Query: 475 KY-LSSLENLYLARCESLDLNLNMEIEGEGSHHDRKNTRPHLRRVFIMEITQL--LELPQ 531
           +  LS+  NL+ + C S DL+     + E      +  +PH    + +EI     + LP 
Sbjct: 665 EANLSAKANLH-SLCLSWDLDGKHRYDSEV----LEALKPHSNLKY-LEINGFGGIRLPD 718

Query: 532 WLLQGSTDTLRDLFIVSCPNFMALPRSLKDLEALETL 568
           W+ Q     +  + I  C N   LP    +L  LE+L
Sbjct: 719 WMNQSVLKNVVSIRIRGCENCSCLP-PFGELPCLESL 754

Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via a direct or indirect interaction with this avirulence protein. That triggers a defense system which restricts the pathogen growth.
Solanum bulbocastanum (taxid: 147425)

>sp\|Q7XA39\|RGA4_SOLBU Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1	Back alignment and function description

>sp\|Q7XBQ9\|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1	Back alignment and function description

>sp\|Q7XA40\|RGA3_SOLBU Putative disease resistance protein RGA3 OS=Solanum bulbocastanum GN=RGA3 PE=2 SV=2	Back alignment and function description

>sp\|Q9LRR5\|DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=3 SV=1	Back alignment and function description

>sp\|Q9LRR4\|R13L1_ARATH Putative disease resistance RPP13-like protein 1 OS=Arabidopsis thaliana GN=RPPL1 PE=3 SV=1	Back alignment and function description

>sp\|Q39214\|RPM1_ARATH Disease resistance protein RPM1 OS=Arabidopsis thaliana GN=RPM1 PE=1 SV=1	Back alignment and function description

>sp\|Q8W474\|DRL7_ARATH Probable disease resistance protein At1g58390 OS=Arabidopsis thaliana GN=At1g58390 PE=2 SV=4	Back alignment and function description

>sp\|Q38834\|R13L4_ARATH Disease resistance RPP13-like protein 4 OS=Arabidopsis thaliana GN=RPP13L4 PE=2 SV=2	Back alignment and function description

>sp\|Q9SX38\|DRL4_ARATH Putative disease resistance protein At1g50180 OS=Arabidopsis thaliana GN=At1g50180 PE=3 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		629
255577491		860	leucine-rich repeat containing protein,	0.960	0.702	0.502	1e-162
225441815		874	PREDICTED: putative disease resistance p	0.936	0.673	0.475	1e-155
224120592		836	nbs-lrr resistance protein [Populus tric	0.930	0.699	0.462	1e-151
225456043		848	PREDICTED: putative disease resistance p	0.925	0.686	0.468	1e-149
359491491		845	PREDICTED: disease resistance protein RG	0.942	0.701	0.457	1e-147
225456045		851	PREDICTED: putative disease resistance p	0.933	0.689	0.463	1e-146
225456092		849	PREDICTED: putative disease resistance p	0.930	0.689	0.458	1e-144
225456041		853	PREDICTED: disease resistance protein RG	0.925	0.682	0.456	1e-144
356570458		857	PREDICTED: disease resistance protein RG	0.963	0.707	0.456	1e-141
356571981		754	PREDICTED: disease resistance protein RG	0.963	0.803	0.457	1e-139

>gi\|255577491\|ref\|XP_002529624.1\| leucine-rich repeat containing protein, putative [Ricinus communis] gi\|223530909\|gb\|EEF32769.1\| leucine-rich repeat containing protein, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  578 bits (1491), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 315/627 (50%), Positives = 425/627 (67%), Gaps = 23/627 (3%)

Query: 5   INFVT-GENQSNL--DQLQKVLRYSLKGKRYLLVMDDVWNEDPEAWCKLKSLLLGGANGS 61
           IN  T GEN S+L  DQLQ+V+R  +  K+Y LV+DDVWN+D   W +LK LL G A GS
Sbjct: 248 INSTTFGENYSSLELDQLQRVMREQISEKKYFLVLDDVWNDDRTKWNELKELLRGCAYGS 307

Query: 62  KILVTTRSRKVASIMGTRGGTTGFNLQGLPFEDCLSLFMKCAFKEERDK-HPNLVKIGVE 120
           KI+VTTRS+ VASI+GT      +NL GLP + CLSLF++CAF E ++K +PNLVKIG E
Sbjct: 308 KIMVTTRSKVVASIVGT---APAYNLSGLPDDKCLSLFLRCAFNEGQEKLYPNLVKIGSE 364

Query: 121 IVKKCGGIPLAVRTLGSLLYDSTDEHFWEYVRDNEIWQLEQKESGILPALRLSYDQLPPR 180
           IVKKCGG+PLAVRT+G+ L+  TDE  W  V++++IW+L+Q  + ILPALR+SY QLP  
Sbjct: 365 IVKKCGGVPLAVRTVGTQLFLKTDEADWNLVKESDIWELDQNPNDILPALRISYQQLPSY 424

Query: 181 LKQCVAYCSIFPKDFKFDSYDLVQFWMAHGLLQSHNKKEDLEDIGMRYLKELLSRSFFQD 240
           LKQC A CS+FPKD++F+S  L+QFWMAHGLLQS ++ +  E +G++YLKEL SR FFQD
Sbjct: 425 LKQCFASCSVFPKDYEFNSLKLIQFWMAHGLLQSPDQVQLPEYLGLKYLKELFSRCFFQD 484

Query: 241 LTFGMFGLEVLTFKMHDLMHDLAMLVAKDEFLVVNSDCQSIPKSVRHLSFAAANASRNDF 300
           +    F      FKMHDL+HDLA  VA+ E L+  S      K VRHL+F        D 
Sbjct: 485 IEDCSF---YFVFKMHDLVHDLAQSVAQRESLIPKSGRHYSCKRVRHLTFFDPEVLSKDP 541

Query: 301 SSLLSDLGRVRTICFSTDDDEKTSQSFVESCISKSQFLRVLNLSESSIEVCSRKMGNLKH 360
             L  DL  V+TI  +       S+S  + CIS  Q LRVL+L+ S+ EV  R +G LKH
Sbjct: 542 RKLFHDLDHVQTILIAG-----VSKSLAQVCISGFQNLRVLDLAWSTFEVLPRSIGTLKH 596

Query: 361 MRYLDLSRNSKIKKLPKSICELQSLETLDLAGCLELEELPKDIKYLVNLRVLVLTTKQKS 420
           +RYLDL+ N KI++LP SIC LQSL+TL L+GC ELE LP+++K +++L  L +T K + 
Sbjct: 597 LRYLDLTNNVKIRRLPSSICNLQSLQTLILSGCEELEGLPRNMKCMISLSFLWITAKLRF 656

Query: 421 LQESGIRSLGSLRSLKIFGCRDLEHLFEEIDQLSV--LRTLSIESCPRLISLPPAIKYLS 478
           L  + I  L SLR+L I GC +LEHLF+++  L++  LRTL +  C  LI LP  IKYL+
Sbjct: 657 LPSNRIGCLQSLRTLGIGGCGNLEHLFDDMIGLNLIALRTLVVGGCRNLIYLPHDIKYLT 716

Query: 479 SLENLYLARCESLDLNLNMEIEGEGSHHDRKNTRPHLRRVFIMEITQLLELPQWLLQGST 538
           +LENL +A CE+LDL +      +G+  D ++    L+ + + E+  L+ LP+WLLQ S 
Sbjct: 717 ALENLTIATCENLDLLI------DGNVVDNEHCGFKLKTLSLHELPLLVALPRWLLQWSA 770

Query: 539 DTLRDLFIVSCPNFMALPRSLKDLEALETLVIARCPKLSSLPEGMHHVTTLKLLTIGGCP 598
            +L  + I  C N + LP  L+D  +L+ L I  CP LSSLP G+H +T+L+ LT+  CP
Sbjct: 771 CSLESIAIWRCHNLVMLPEWLQDFISLQKLDILGCPGLSSLPIGLHRLTSLRKLTVEDCP 830

Query: 599 ALSERCKPPTGEDWPKISHIPQVYLDG 625
           AL+E C P TG+DWP+I+H+ ++YLDG
Sbjct: 831 ALAESCNPETGKDWPQIAHVSEIYLDG 857

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|225441815\|ref\|XP_002277987.1\| PREDICTED: putative disease resistance protein RGA3-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224120592\|ref\|XP_002318368.1\| nbs-lrr resistance protein [Populus trichocarpa] gi\|222859041\|gb\|EEE96588.1\| nbs-lrr resistance protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|225456043\|ref\|XP_002277498.1\| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359491491\|ref\|XP_003634282.1\| PREDICTED: disease resistance protein RGA2-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225456045\|ref\|XP_002277526.1\| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225456092\|ref\|XP_002278041.1\| PREDICTED: putative disease resistance protein RGA4 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225456041\|ref\|XP_002277479.1\| PREDICTED: disease resistance protein RGA2 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|356570458\|ref\|XP_003553404.1\| PREDICTED: disease resistance protein RGA2-like [Glycine max]	Back alignment and taxonomy information

>gi\|356571981\|ref\|XP_003554149.1\| PREDICTED: disease resistance protein RGA2-like [Glycine max]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		629
TAIR\|locus:2091672		1054	AT3G14470 [Arabidopsis thalian	0.874	0.521	0.332	4.7e-61
UNIPROTKB\|O48647		1802	O48647 "XA1" [Oryza sativa (ta	0.626	0.218	0.337	7.4e-61
TAIR\|locus:2091662		1424	AT3G14460 [Arabidopsis thalian	0.871	0.384	0.326	1.8e-60
TAIR\|locus:504956483		847	AT3G46730 [Arabidopsis thalian	0.602	0.447	0.312	9.3e-37
TAIR\|locus:2077572		926	RPM1 "RESISTANCE TO P. SYRINGA	0.658	0.447	0.290	7.9e-36
TAIR\|locus:2176486		908	RPP8 "RECOGNITION OF PERONOSPO	0.699	0.484	0.282	1.2e-34
TAIR\|locus:2078012		852	ZAR1 "HOPZ-ACTIVATED RESISTANC	0.602	0.444	0.306	5e-34
TAIR\|locus:504956184		1017	AT1G58807 "AT1G58807" [Arabido	0.704	0.435	0.273	1.8e-33
TAIR\|locus:2827038		1017	AT1G59124 "AT1G59124" [Arabido	0.704	0.435	0.273	1.8e-33
TAIR\|locus:2075170		835	RPP13 "RECOGNITION OF PERONOSP	0.602	0.453	0.301	4.8e-33

TAIR\|locus:2091672 AT3G14470 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 632 (227.5 bits), Expect = 4.7e-61, P = 4.7e-61
 Identities = 195/587 (33%), Positives = 286/587 (48%)

Query:    14 SNLDQLQKVLRYSLKGKR--YLLVMDDVWNEDPEAWCKLKSLLLGGANGSKILVTTRSRK 71
             ++LD LQ  L+  L G    +LLV+DD+WNE+   W  L+   +  A GS+ILVTTRS++
Sbjct:   259 TDLDVLQVKLKERLTGTGLPFLLVLDDLWNENFADWDLLRQPFIHAAQGSQILVTTRSQR 318

Query:    72 VASIMGTRGGTTGFNLQGLPFEDCLSLFMKCAF-KEERDKHPNLVKIGVEIVKKCGGIPL 130
             VASIM         NLQ L   DC SLFMK  F  +E   +  +  +   IV KC G+PL
Sbjct:   319 VASIMCA---VHVHNLQPLSDGDCWSLFMKTVFGNQEPCLNREIGDLAERIVHKCRGLPL 375

Query:   131 AVRTLGSLLYDSTDEHFWEYVRDNEIWQLEQKESGILPALRLSYDQLPPRLKQCVAYCSI 190
             AV+TLG +L        WE V  + IW L   +S +LP LR+SY  LP  LK+C AYCSI
Sbjct:   376 AVKTLGGVLRFEGKVIEWERVLSSRIWDLPADKSNLLPVLRVSYYYLPAHLKRCFAYCSI 435

Query:   191 FPKDFKFDSYDLVQFWMAHGLLQSHNKKEDLEDIGMRYLKELLSRSFFQDLTFGMFGLEV 250
             FPK   F+   +V  WMA G LQ     ++LE++G  Y  EL SRS  Q           
Sbjct:   436 FPKGHAFEKDKVVLLWMAEGFLQQTRSSKNLEELGNEYFSELESRSLLQKTK-------- 487

Query:   251 LTFKMHDLMHDLAMLVAKDEFLVVNSD-CQ-SIPKSVRHLSFAAAN-ASRNDFSSLLSDL 307
               + MHD +++LA   A  EF     D C+  + +  R+LS+   N A   +F +L  ++
Sbjct:   488 TRYIMHDFINELAQF-ASGEFSSKFEDGCKLQVSERTRYLSYLRDNYAEPMEFEAL-REV 545

Query:   308 GRVRTIC-FSTDDDEKT---SQSFVESCISKSQFLRVLNLSESSI-EVCSRKMGNLKHMR 362
               +RT    S  +  ++    Q   E  +     LRVL+LS   I  +      N+ H R
Sbjct:   546 KFLRTFLPLSLTNSSRSCCLDQMVSEKLLPTLTRLRVLSLSHYKIARLPPDFFKNISHAR 605

Query:   363 YLDLSRNSKIKKLPKSICELQSLETLDLAGCLELEELPKDIKYLVNLRVL-VLTTKQKSL 421
             +LDLSR ++++KLPKS+C + +L+TL L+ C  L+ELP DI  L+NLR L ++ TK + +
Sbjct:   606 FLDLSR-TELEKLPKSLCYMYNLQTLLLSYCSSLKELPTDISNLINLRYLDLIGTKLRQM 664

Query:   422 QEXXXXXXXXXXXXKIFGCRDLEHLFEEIDQLSVLR-TLSIESCPRLISLPPAI------ 474
                             F          E+  L  L   L I    R++ +  A       
Sbjct:   665 PRRFGRLKSLQTLTTFFVSASDGSRISELGGLHDLHGKLKIVELQRVVDVADAAEANLNS 724

Query:   475 -KYLSSLENLYLARCESLDLNLNME-IEGEGSHHDRKNTRPHLRRVFIMEITQLLELPQW 532
              K+L  ++ ++     S + N N    + E    ++     H+ ++ I E  +    P W
Sbjct:   725 KKHLREIDFVWRTGSSSSENNTNPHRTQNEAEVFEKLRPHRHIEKLAI-ERYKGRRFPDW 783

Query:   533 LLQGSTDTLRDLFIVSCPNFMALPRSLKDLEALETLVIARCPKLSSL 579
             L   S   +  + +  C    +LP SL  L  L+ L I+    L S+
Sbjct:   784 LSDPSFSRIVCIRLRECQYCTSLP-SLGQLPCLKELHISGMVGLQSI 829

GO:0005576 "extracellular region" evidence=ISM

GO:0006952 "defense response" evidence=IEA;ISS

GO:0043531 "ADP binding" evidence=IEA

GO:0005515 "protein binding" evidence=IPI

GO:0009627 "systemic acquired resistance" evidence=RCA

GO:0009697 "salicylic acid biosynthetic process" evidence=RCA

UNIPROTKB\|O48647 O48647 "XA1" [Oryza sativa (taxid:4530)]	Back alignment and assigned GO terms

TAIR\|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:504956483 AT3G46730 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2077572 RPM1 "RESISTANCE TO P. SYRINGAE PV MACULICOLA 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2176486 RPP8 "RECOGNITION OF PERONOSPORA PARASITICA 8" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2078012 ZAR1 "HOPZ-ACTIVATED RESISTANCE 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:504956184 AT1G58807 "AT1G58807" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2827038 AT1G59124 "AT1G59124" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2075170 RPP13 "RECOGNITION OF PERONOSPORA PARASITICA 13" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		629
pfam00931		285	pfam00931, NB-ARC, NB-ARC domain	4e-47
PLN03210		1153	PLN03210, PLN03210, Resistant to P	9e-13
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	7e-06
PLN03150		623	PLN03150, PLN03150, hypothetical protein; Provisio	7e-05
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	1e-04
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	4e-04
PLN03210		1153	PLN03210, PLN03210, Resistant to P	6e-04
pfam13855		60	pfam13855, LRR_8, Leucine rich repeat	0.004

>gnl\|CDD\|216202 pfam00931, NB-ARC, NB-ARC domain	Back alignment and domain information

 Score =  167 bits (424), Expect = 4e-47
 Identities = 72/204 (35%), Positives = 112/204 (54%), Gaps = 6/204 (2%)

Query: 15  NLDQLQKVLRYSLKGKRYLLVMDDVWNEDPEAWCKLKSLLLGGANGSKILVTTRSRKVAS 74
           N  +L   ++ +L  KR+LLV+DDVW +    W K+      G NGS+++VTTRS  VA 
Sbjct: 85  NESELAVKIKEALLRKRFLLVLDDVWEK--NDWDKIGVPFPDGENGSRVIVTTRSESVAG 142

Query: 75  IMGTRGGTTGFNLQGLPFEDCLSLFMKCAFKEERDKHPNLVKIGVEIVKKCGGIPLAVRT 134
            MG  G +    ++ L  E+   LF    F++E    P L ++  EIV+KC G+PLA++ 
Sbjct: 143 RMG--GTSKPHEVESLEPEESWELFSNKVFEKELPPCPELEEVAKEIVEKCKGLPLALKV 200

Query: 135 LGSLLYDSTDEHFWEYVRDNEIWQLEQKES--GILPALRLSYDQLPPRLKQCVAYCSIFP 192
           LG LL   +    WE+V +    +L  ++    +L  L LSYD LP  LK+C  Y ++FP
Sbjct: 201 LGGLLAFKSTVQEWEHVLEQLNNELAGRDGLNEVLSILSLSYDNLPMHLKRCFLYLALFP 260

Query: 193 KDFKFDSYDLVQFWMAHGLLQSHN 216
           +D+      L++ W+A G +   +
Sbjct: 261 EDYNIRKEQLIKLWIAEGFVIPSD 284

Length = 285

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|178695 PLN03150, PLN03150, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

>gnl\|CDD\|206026 pfam13855, LRR_8, Leucine rich repeat	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		629
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	100.0
PLN03210		1153	Resistant to P. syringae 6; Provisional	100.0
PF00931		287	NB-ARC: NB-ARC domain; InterPro: IPR002182 This is	99.96
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	99.91
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	99.91
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.87
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.87
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.86
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.82
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.8
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.72
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.7
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.58
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.56
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.56
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.54
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.5
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.5
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.5
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.49
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.44
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.39
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.18
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.14
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	99.02
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	98.98
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	98.98
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	98.97
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.85
KOG4341		483	consensus F-box protein containing LRR [General fu	98.85
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.76
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.76
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.74
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.71
KOG4341		483	consensus F-box protein containing LRR [General fu	98.7
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.64
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.62
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	98.58
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.45
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	98.44
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	98.42
PLN03150		623	hypothetical protein; Provisional	98.31
PLN03150		623	hypothetical protein; Provisional	98.28
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.2
KOG2982		418	consensus Uncharacterized conserved protein [Funct	98.15
PRK15386		426	type III secretion protein GogB; Provisional	98.09
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.04
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	98.01
PRK15386		426	type III secretion protein GogB; Provisional	98.01
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	97.95
PRK04841		903	transcriptional regulator MalT; Provisional	97.93
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	97.9
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	97.57
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.56
KOG1947		482	consensus Leucine rich repeat proteins, some prote	97.49
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	97.48
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.47
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	97.45
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	97.31
KOG2982		418	consensus Uncharacterized conserved protein [Funct	97.29
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	97.29
KOG1947		482	consensus Leucine rich repeat proteins, some prote	97.18
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	96.87
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	96.65
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	96.6
TIGR03015		269	pepcterm_ATPase putative secretion ATPase, PEP-CTE	96.54
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	96.35
PRK06893		229	DNA replication initiation factor; Validated	96.27
PRK00080		328	ruvB Holliday junction DNA helicase RuvB; Reviewed	96.22
PF05729		166	NACHT: NACHT domain	96.22
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	96.07
PRK00411		394	cdc6 cell division control protein 6; Reviewed	96.0
TIGR00635		305	ruvB Holliday junction DNA helicase, RuvB subunit.	95.74
COG2909		894	MalT ATP-dependent transcriptional regulator [Tran	95.61
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	95.55
KOG2123		388	consensus Uncharacterized conserved protein [Funct	95.43
KOG2123		388	consensus Uncharacterized conserved protein [Funct	94.72
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	94.51
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	94.4
PF01637		234	Arch_ATPase: Archaeal ATPase; InterPro: IPR011579	94.3
COG3899		849	Predicted ATPase [General function prediction only	94.12
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	93.82
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	93.79
PF13173		128	AAA_14: AAA domain	93.27
PRK07471		365	DNA polymerase III subunit delta'; Validated	92.77
PRK06645		507	DNA polymerase III subunits gamma and tau; Validat	92.44
TIGR00678		188	holB DNA polymerase III, delta' subunit. At positi	91.93
PRK05564		313	DNA polymerase III subunit delta'; Validated	91.65
TIGR03420		226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	91.37
PRK09087		226	hypothetical protein; Validated	91.33
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	91.3
TIGR02928		365	orc1/cdc6 family replication initiation protein. M	91.19
PRK13342		413	recombination factor protein RarA; Reviewed	91.09
KOG4308		478	consensus LRR-containing protein [Function unknown	90.78
TIGR02903		615	spore_lon_C ATP-dependent protease, Lon family. Me	90.56
PRK14961		363	DNA polymerase III subunits gamma and tau; Provisi	90.06
PRK09112		351	DNA polymerase III subunit delta'; Validated	89.2
PRK12323		700	DNA polymerase III subunits gamma and tau; Provisi	89.14
PRK08727		233	hypothetical protein; Validated	88.25
TIGR02397		355	dnaX_nterm DNA polymerase III, subunit gamma and t	88.13
KOG0989		346	consensus Replication factor C, subunit RFC4 [Repl	87.89
PRK07003		830	DNA polymerase III subunits gamma and tau; Validat	87.81
COG3903		414	Predicted ATPase [General function prediction only	87.65
PRK12402		337	replication factor C small subunit 2; Reviewed	87.65
PRK14963		504	DNA polymerase III subunits gamma and tau; Provisi	87.63
KOG3864		221	consensus Uncharacterized conserved protein [Funct	87.24
PRK05707		328	DNA polymerase III subunit delta'; Validated	87.03
PRK14959		624	DNA polymerase III subunits gamma and tau; Provisi	86.83
PLN03025		319	replication factor C subunit; Provisional	86.53
PRK14955		397	DNA polymerase III subunits gamma and tau; Provisi	86.46
PRK14960		702	DNA polymerase III subunits gamma and tau; Provisi	86.33
PRK08691		709	DNA polymerase III subunits gamma and tau; Validat	85.73
KOG0473		326	consensus Leucine-rich repeat protein [Function un	85.61
KOG3864		221	consensus Uncharacterized conserved protein [Funct	85.41
PRK14957		546	DNA polymerase III subunits gamma and tau; Provisi	84.44
PRK06620		214	hypothetical protein; Validated	84.28
smart00367		26	LRR_CC Leucine-rich repeat - CC (cysteine-containi	84.25
KOG4308		478	consensus LRR-containing protein [Function unknown	84.02
PRK14956		484	DNA polymerase III subunits gamma and tau; Provisi	83.84
PRK14954		620	DNA polymerase III subunits gamma and tau; Provisi	83.3
PRK04132		846	replication factor C small subunit; Provisional	83.23
PRK07940		394	DNA polymerase III subunit delta'; Validated	83.2
PRK08451		535	DNA polymerase III subunits gamma and tau; Validat	83.13
PRK14964		491	DNA polymerase III subunits gamma and tau; Provisi	82.78
PRK14949		944	DNA polymerase III subunits gamma and tau; Provisi	82.76
PF00308		219	Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013	82.73
PRK08084		235	DNA replication initiation factor; Provisional	81.99
PRK14971		614	DNA polymerase III subunits gamma and tau; Provisi	81.97
PRK08903		227	DnaA regulatory inactivator Hda; Validated	81.53
PRK05642		234	DNA replication initiation factor; Validated	80.92
KOG0473		326	consensus Leucine-rich repeat protein [Function un	80.41
COG2256		436	MGS1 ATPase related to the helicase subunit of the	80.35
PRK00440		319	rfc replication factor C small subunit; Reviewed	80.11

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

Probab=100.00  E-value=3.3e-64  Score=546.19  Aligned_cols=562  Identities=31%  Similarity=0.475  Sum_probs=419.2

Q ss_pred             HHHHHHHHHHHcCCceEEEEEecCCCCChhhHHHHHHhhCCCCCCcEEEEEcCChHHHHh-hcccCCCCceeCCCCChhh
Q 048833           16 LDQLQKVLRYSLKGKRYLLVMDDVWNEDPEAWCKLKSLLLGGANGSKILVTTRSRKVASI-MGTRGGTTGFNLQGLPFED   94 (629)
Q Consensus        16 ~~~~~~~l~~~L~~k~~LivlDdv~~~~~~~~~~~~~~~~~~~~gs~iivTTR~~~v~~~-~~~~~~~~~~~l~~L~~~~   94 (629)
                      .++++..|.+.|++|||+|||||||+.  .+|+.+..++|...+||||++|||++.||.. +++.   ..+++++|.++|
T Consensus       247 ~~~~~~~i~~~L~~krfllvLDDIW~~--~dw~~I~~~~p~~~~g~KvvlTTRs~~V~~~~m~~~---~~~~v~~L~~~e  321 (889)
T KOG4658|consen  247 EDELASKLLNLLEGKRFLLVLDDIWEE--VDWDKIGVPFPSRENGSKVVLTTRSEEVCGRAMGVD---YPIEVECLTPEE  321 (889)
T ss_pred             HHHHHHHHHHHhccCceEEEEeccccc--ccHHhcCCCCCCccCCeEEEEEeccHhhhhccccCC---ccccccccCccc
Confidence            368899999999999999999999986  4699999999998899999999999999998 6553   889999999999


Q ss_pred             HHHHHHHhhcccCCCCChhHHHHHHHHHHhcCCCchHHHHHHhhhcCCCCHHHHHHHhhhhccc----cccccCCcchhh
Q 048833           95 CLSLFMKCAFKEERDKHPNLVKIGVEIVKKCGGIPLAVRTLGSLLYDSTDEHFWEYVRDNEIWQ----LEQKESGILPAL  170 (629)
Q Consensus        95 a~~Lf~~~a~~~~~~~~~~~~~~~~~i~~~c~glPLal~~~g~~L~~~~~~~~w~~~~~~~~~~----~~~~~~~~~~~l  170 (629)
                      ||+||++.||......++.+..+|++|+++|+|+|||+.++|+.|+.|++..+|+++.+...+.    ..+..+.++.+|
T Consensus       322 aW~LF~~~v~~~~~~~~~~i~~lak~v~~kC~GLPLAl~viG~~ma~K~t~~eW~~~~~~l~s~~~~~~~~~~~~i~~iL  401 (889)
T KOG4658|consen  322 AWDLFQKKVGPNTLGSHPDIEELAKEVAEKCGGLPLALNVLGGLLACKKTVQEWRRALNVLKSSLAADFSGMEESILPIL  401 (889)
T ss_pred             cHHHHHHhhccccccccccHHHHHHHHHHHhCChHHHHHHHHHHhcCCCcHHHHHHHHccccccccCCCCchhhhhHHhh
Confidence            9999999999886666677999999999999999999999999999999999999988765443    233467889999


Q ss_pred             hcccccCChhhhhhhhhhccCCCCceeChHhHHHHHHHcCCcccCCCCccHHHHHHHHHHHHHhCCceeecccCCCCceE
Q 048833          171 RLSYDQLPPRLKQCVAYCSIFPKDFKFDSYDLVQFWMAHGLLQSHNKKEDLEDIGMRYLKELLSRSFFQDLTFGMFGLEV  250 (629)
Q Consensus       171 ~~sy~~L~~~~k~~fl~~~~fp~~~~~~~~~l~~~wi~eg~i~~~~~~~~~~~~~~~~l~~L~~r~ll~~~~~~~~~~~~  250 (629)
                      ++|||.||++.|.||+|||.||||+.++++.++.+|+||||+.+......+++.|..|+++|++++++......  + +.
T Consensus       402 klSyd~L~~~lK~CFLycalFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV~~~Ll~~~~~~--~-~~  478 (889)
T KOG4658|consen  402 KLSYDNLPEELKSCFLYCALFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEELVRASLLIEERDE--G-RK  478 (889)
T ss_pred             hccHhhhhHHHHHHHHhhccCCcccccchHHHHHHHHhccCcCccccccchhcchHHHHHHHHHHHHHhhcccc--c-ce
Confidence            99999999889999999999999999999999999999999988767889999999999999999999887653  3 67


Q ss_pred             EEEEeChhHHHHHHHHhc-----cceEEEecC-------CCCCCCcceEEEEEcccCCcchhhhhccCCCCceEEEEecC
Q 048833          251 LTFKMHDLMHDLAMLVAK-----DEFLVVNSD-------CQSIPKSVRHLSFAAANASRNDFSSLLSDLGRVRTICFSTD  318 (629)
Q Consensus       251 ~~~~mhd~~~~~~~~~~~-----~~~~~~~~~-------~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~L~l~~~  318 (629)
                      .+|+|||++|+||.++++     ++..+...+       ....+..+|+.++..+.....   ..-..+++|++|.+..|
T Consensus       479 ~~~kmHDvvRe~al~ias~~~~~~e~~iv~~~~~~~~~~~~~~~~~~rr~s~~~~~~~~~---~~~~~~~~L~tLll~~n  555 (889)
T KOG4658|consen  479 ETVKMHDVVREMALWIASDFGKQEENQIVSDGVGLSEIPQVKSWNSVRRMSLMNNKIEHI---AGSSENPKLRTLLLQRN  555 (889)
T ss_pred             eEEEeeHHHHHHHHHHhccccccccceEEECCcCccccccccchhheeEEEEeccchhhc---cCCCCCCccceEEEeec
Confidence            899999999999999999     666555543       122345678888888776554   33345668999999987


Q ss_pred             CCCccchHHHHHhhhcCccccEEEcCCCC-ccccccccCCCCccceeecccCCCccccchhhccCCCccEeccCCccccc
Q 048833          319 DDEKTSQSFVESCISKSQFLRVLNLSESS-IEVCSRKMGNLKHMRYLDLSRNSKIKKLPKSICELQSLETLDLAGCLELE  397 (629)
Q Consensus       319 ~~~~~~~~~~~~~~~~~~~L~~L~l~~~~-~~~l~~~~~~l~~L~~L~l~~~~~~~~lp~~~~~l~~L~~L~l~~~~~~~  397 (629)
                      ..  ........+|..++.|++||+++|. +.++|..++++.+||||+++++ .+..+|..+++|.+|.+|++..+..+.
T Consensus       556 ~~--~l~~is~~ff~~m~~LrVLDLs~~~~l~~LP~~I~~Li~LryL~L~~t-~I~~LP~~l~~Lk~L~~Lnl~~~~~l~  632 (889)
T KOG4658|consen  556 SD--WLLEISGEFFRSLPLLRVLDLSGNSSLSKLPSSIGELVHLRYLDLSDT-GISHLPSGLGNLKKLIYLNLEVTGRLE  632 (889)
T ss_pred             ch--hhhhcCHHHHhhCcceEEEECCCCCccCcCChHHhhhhhhhcccccCC-CccccchHHHHHHhhheeccccccccc
Confidence            52  1222334458889999999999764 6799999999999999999986 789999999999999999999987777


Q ss_pred             cCCccccccCcccEEEecCcccccCcccC---CCCCCCCeEeecCCCCcchhhhhCCCCCccceE----ecccCCCCccc
Q 048833          398 ELPKDIKYLVNLRVLVLTTKQKSLQESGI---RSLGSLRSLKIFGCRDLEHLFEEIDQLSVLRTL----SIESCPRLISL  470 (629)
Q Consensus       398 ~lp~~i~~l~~L~~L~l~~~~~~~~~~~~---~~l~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L----~l~~~~~~~~l  470 (629)
                      .+|..+..|++|++|.+...........+   ..+.+|+.+.......  .+...+..+++|+++    .+.+ ......
T Consensus       633 ~~~~i~~~L~~Lr~L~l~~s~~~~~~~~l~el~~Le~L~~ls~~~~s~--~~~e~l~~~~~L~~~~~~l~~~~-~~~~~~  709 (889)
T KOG4658|consen  633 SIPGILLELQSLRVLRLPRSALSNDKLLLKELENLEHLENLSITISSV--LLLEDLLGMTRLRSLLQSLSIEG-CSKRTL  709 (889)
T ss_pred             cccchhhhcccccEEEeeccccccchhhHHhhhcccchhhheeecchh--HhHhhhhhhHHHHHHhHhhhhcc-ccccee
Confidence            78777778999999999876533332233   4444444444433322  222334444555533    3222 334456


Q ss_pred             cccccCCCccceeeccccccccccccccccCCCCCCCCCCCCCceeeEeeccccCcccchhhhhcCCCCCccEEEecCCC
Q 048833          471 PPAIKYLSSLENLYLARCESLDLNLNMEIEGEGSHHDRKNTRPHLRRVFIMEITQLLELPQWLLQGSTDTLRDLFIVSCP  550 (629)
Q Consensus       471 p~~~~~l~~L~~L~l~~~~~l~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~L~~L~l~~~~  550 (629)
                      +..+..+.+|+.|.+.+|...+..........   ..  ..++.+..+...+|.....+. |.  ...++|+.|.+..|.
T Consensus       710 ~~~~~~l~~L~~L~i~~~~~~e~~~~~~~~~~---~~--~~f~~l~~~~~~~~~~~r~l~-~~--~f~~~L~~l~l~~~~  781 (889)
T KOG4658|consen  710 ISSLGSLGNLEELSILDCGISEIVIEWEESLI---VL--LCFPNLSKVSILNCHMLRDLT-WL--LFAPHLTSLSLVSCR  781 (889)
T ss_pred             ecccccccCcceEEEEcCCCchhhcccccccc---hh--hhHHHHHHHHhhccccccccc-hh--hccCcccEEEEeccc
Confidence            66788899999999999976653321100000   00  013345555555554444332 22  345788888888887


Q ss_pred             CCccCCcCCCCCCCcCe----------e----ecccCccCccCCcCCCCCCCcCeEeeeCCCccccccC
Q 048833          551 NFMALPRSLKDLEALET----------L----VIARCPKLSSLPEGMHHVTTLKLLTIGGCPALSERCK  605 (629)
Q Consensus       551 ~~~~l~~~~~~l~~L~~----------L----~l~~c~~l~~lp~~~~~l~~L~~L~l~~c~~l~~~~~  605 (629)
                      .+++.......+..+..          +    ++.+.+.+...|-   .++.|..+.+..||++.+.+.
T Consensus       782 ~~e~~i~~~k~~~~l~~~i~~f~~~~~l~~~~~l~~l~~i~~~~l---~~~~l~~~~ve~~p~l~~~P~  847 (889)
T KOG4658|consen  782 LLEDIIPKLKALLELKELILPFNKLEGLRMLCSLGGLPQLYWLPL---SFLKLEELIVEECPKLGKLPL  847 (889)
T ss_pred             ccccCCCHHHHhhhcccEEecccccccceeeecCCCCceeEeccc---CccchhheehhcCcccccCcc
Confidence            76665433332222222          2    2222222222332   223377777777777765543

>PLN03210 Resistant to P	Back alignment and domain information

>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals []	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>PRK04841 transcriptional regulator MalT; Provisional	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed	Back alignment and domain information

>PF05729 NACHT: NACHT domain	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>PRK00411 cdc6 cell division control protein 6; Reviewed	Back alignment and domain information

>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit	Back alignment and domain information

>COG2909 MalT ATP-dependent transcriptional regulator [Transcription]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP	Back alignment and domain information

>COG3899 Predicted ATPase [General function prediction only]	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>PF13173 AAA_14: AAA domain	Back alignment and domain information

>PRK07471 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK06645 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>TIGR00678 holB DNA polymerase III, delta' subunit	Back alignment and domain information

>PRK05564 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda	Back alignment and domain information

>PRK09087 hypothetical protein; Validated	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>TIGR02928 orc1/cdc6 family replication initiation protein	Back alignment and domain information

>PRK13342 recombination factor protein RarA; Reviewed	Back alignment and domain information

>KOG4308 consensus LRR-containing protein [Function unknown]	Back alignment and domain information

>TIGR02903 spore_lon_C ATP-dependent protease, Lon family	Back alignment and domain information

>PRK14961 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK09112 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK12323 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK08727 hypothetical protein; Validated	Back alignment and domain information

>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau	Back alignment and domain information

>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair]	Back alignment and domain information

>PRK07003 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>COG3903 Predicted ATPase [General function prediction only]	Back alignment and domain information

>PRK12402 replication factor C small subunit 2; Reviewed	Back alignment and domain information

>PRK14963 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK05707 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK14959 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PLN03025 replication factor C subunit; Provisional	Back alignment and domain information

>PRK14955 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14960 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK08691 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK14957 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK06620 hypothetical protein; Validated	Back alignment and domain information

>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily	Back alignment and domain information

>KOG4308 consensus LRR-containing protein [Function unknown]	Back alignment and domain information

>PRK14956 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14954 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK04132 replication factor C small subunit; Provisional	Back alignment and domain information

>PRK07940 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK08451 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14964 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14949 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication	Back alignment and domain information

>PRK08084 DNA replication initiation factor; Provisional	Back alignment and domain information

>PRK14971 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK08903 DnaA regulatory inactivator Hda; Validated	Back alignment and domain information

>PRK05642 DNA replication initiation factor; Validated	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK00440 rfc replication factor C small subunit; Reviewed	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		629
1z6t_A		591	Structure Of The Apoptotic Protease-activating Fact		2e-06
3iza_B		1263	Structure Of An Apoptosome-Procaspase-9 Card Comple		5e-06
3sfz_A		1249	Crystal Structure Of Full-Length Murine Apaf-1 Leng		6e-06
3shf_A		1256	Crystal Structure Of The R265s Mutant Of Full-Lengt		4e-05
4fcg_A		328	Structure Of The Leucine-Rich Repeat Domain Of The		6e-05

>pdb|1Z6T|A Chain A, Structure Of The Apoptotic Protease-activating Factor 1 Bound To Adp Length = 591

Back alignment and structure

Iteration: 1

Score = 50.8 bits (120), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 69/268 (25%), Positives = 117/268 (43%), Gaps = 62/268 (23%) Query: 15 NLDQLQKVLRYSL--KGKRYLLVMDDVWNEDPEAWCKLKSLLLGGANGSKILVTTRSRKV 72 N+++ + LR + K R LL++DDVW+ +W +L + +IL+TTR + V Sbjct: 219 NIEEAKDRLRILMLRKHPRSLLILDDVWD----SW-----VLKAFDSQCQILLTTRDKSV 269 Query: 73 A-SIMGTR---------GGTTGFNLQGLPFEDCLSLFMKCAFKEERDKHPNLVKIGVEIV 122 S+MG + G G + LSLF+ K +L + I+ Sbjct: 270 TDSVMGPKYVVPVESSLGKEKGLEI--------LSLFVNM-------KKADLPEQAHSII 314 Query: 123 KKCGGIPLAVRTLGSLLYDSTDEHFWEY----VRDNEIWQLEQKES----GILPALRLSY 174 K+C G PL V +G+LL D + WEY +++ + ++ + S + A+ +S Sbjct: 315 KECKGSPLVVSLIGALLRDFPNR--WEYYLKQLQNKQFKRIRKSSSYDYEALDEAMSISV 372 Query: 175 DQLPPRLKQCVAYCSIFPKDFKFDSYDLVQFWMAHGLLQSHNKKEDLEDIGMRYLKELLS 234 + L +K SI KD K + L W + E++EDI L+E ++ Sbjct: 373 EMLREDIKDYYTDLSILQKDVKVPTKVLCILW--------DMETEEVEDI----LQEFVN 420 Query: 235 RSFFQDLTFGMFGLEVLTFKMHDLMHDL 262 +S L F + + +HDL D Sbjct: 421 KS----LLFCDRNGKSFRYYLHDLQVDF 444

PyMOL of 1z6t

>pdb|3SFZ|A Chain A, Crystal Structure Of Full-Length Murine Apaf-1 Length = 1249

Back alignment and structure

>pdb|3SHF|A Chain A, Crystal Structure Of The R265s Mutant Of Full-Length Murine Apaf-1 Length = 1256

Back alignment and structure

>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		629
1z6t_A		591	APAF-1, apoptotic protease activating factor 1; ca	1e-78
2a5y_B		549	CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis	1e-65
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	7e-37
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-08
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	4e-31
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	6e-28
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	1e-24
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	3e-21
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	4e-17
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	9e-09
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-06
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	1e-22
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	4e-21
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	1e-15
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	8e-10
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	1e-04
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	2e-14
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	4e-14
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	1e-13
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	2e-13
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	5e-13
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	9e-13
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	4e-10
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	4e-14
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-13
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	9e-13
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	1e-12
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-12
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-12
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	6e-12
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	5e-13
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	1e-12
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	2e-11
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	6e-09
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	2e-12
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	1e-11
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	6e-07
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	3e-12
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	2e-09
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	3e-04
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	3e-12
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	3e-12
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	2e-10
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	3e-08
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	3e-05
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	4e-12
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	2e-11
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	2e-08
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	6e-12
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	3e-10
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	6e-12
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	1e-11
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	2e-10
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	6e-08
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	1e-07
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	1e-11
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	3e-11
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	1e-11
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	1e-11
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	1e-10
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	4e-09
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	4e-08
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	4e-11
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	5e-11
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	5e-08
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	6e-08
1o6v_A		466	Internalin A; bacterial infection, extracellular r	5e-11
1o6v_A		466	Internalin A; bacterial infection, extracellular r	2e-10
1o6v_A		466	Internalin A; bacterial infection, extracellular r	6e-10
1o6v_A		466	Internalin A; bacterial infection, extracellular r	1e-09
1o6v_A		466	Internalin A; bacterial infection, extracellular r	7e-09
1o6v_A		466	Internalin A; bacterial infection, extracellular r	3e-08
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	6e-11
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	8e-11
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	2e-10
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	1e-08
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	2e-07
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	2e-06
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	9e-11
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	9e-10
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	2e-07
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	3e-07
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	1e-10
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	5e-10
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	2e-08
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	6e-07
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	4e-10
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	5e-10
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	2e-08
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	8e-10
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	3e-08
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	3e-04
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	8e-10
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	4e-09
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	6e-08
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	4e-07
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	9e-10
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	2e-07
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	2e-07
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	3e-06
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	2e-05
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	3e-05
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	7e-04
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	1e-09
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	2e-09
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	5e-09
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	5e-09
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	6e-07
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	8e-07
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	5e-06
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	7e-09
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	2e-08
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	1e-06
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	2e-08
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	6e-06
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	2e-08
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	3e-08
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	6e-08
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	8e-08
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	1e-06
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	4e-08
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	1e-06
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	4e-08
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	2e-07
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	6e-07
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	9e-07
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	4e-08
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	8e-08
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	1e-07
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	1e-07
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	1e-04
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	4e-04
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	2e-07
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	4e-06
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	2e-05
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	3e-05
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	2e-07
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	4e-05
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	3e-04
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	2e-07
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	2e-05
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	4e-07
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	5e-07
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	6e-06
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	9e-07
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	9e-05
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	3e-06
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	4e-06
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	2e-04
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	7e-06
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	1e-05
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	9e-05
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	2e-05
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	4e-05
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	6e-05
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	7e-05
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	6e-04
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	9e-05
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	1e-04
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	1e-04
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	2e-04
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	2e-04
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	5e-04
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	7e-04
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	4e-04
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	5e-04
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	6e-04
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	8e-04
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	6e-04
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	7e-04

>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591	Back alignment and structure

 Score =  259 bits (664), Expect = 1e-78
 Identities = 62/311 (19%), Positives = 112/311 (36%), Gaps = 44/311 (14%)

Query: 9   TGENQSNLDQLQKVLRYSL--KGKRYLLVMDDVWNEDPEAWCKLKSLLLGGANGSKILVT 66
           +     N+++ +  LR  +  K  R LL++DDVW+            L    +  +IL+T
Sbjct: 213 SQRLPLNIEEAKDRLRILMLRKHPRSLLILDDVWDSWV---------LKAFDSQCQILLT 263

Query: 67  TRSRKVASIMGTRGGTTGFNLQGLPFEDCLSLFMKCAFKEERDKHPNLVKIGVEIVKKCG 126
           TR + V   +             L  E  L +       +      +L +    I+K+C 
Sbjct: 264 TRDKSVTDSVMGPKYVV-PVESSLGKEKGLEILSLFVNMK----KADLPEQAHSIIKECK 318

Query: 127 GIPLAVRTLGSLLYDSTDEHFWEYVRD---NEIWQLEQKES-----GILPALRLSYDQLP 178
           G PL V  +G+LL D  +   WEY      N+ ++  +K S      +  A+ +S + L 
Sbjct: 319 GSPLVVSLIGALLRDFPNR--WEYYLKQLQNKQFKRIRKSSSYDYEALDEAMSISVEMLR 376

Query: 179 PRLKQCVAYCSIFPKDFKFDSYDLVQFWMAHGLLQSHNKKEDLEDIGMRYLKELLSRSFF 238
             +K      SI  KD K  +  L   W                +     L+E +++S  
Sbjct: 377 EDIKDYYTDLSILQKDVKVPTKVLCILWDME------------TEEVEDILQEFVNKSLL 424

Query: 239 QDLTFGMFGLEVLTFKMHDLMHDLAMLVAKDEFLVVNSDCQSIPKSVRHLSFAAANASRN 298
                G    +   + +HDL  D        +   ++   + I +  R+      +  + 
Sbjct: 425 FCDRNG----KSFRYYLHDLQVDFLTEKNCSQLQDLHK--KIITQFQRYHQPHTLSPDQE 478

Query: 299 DFSSLLSDLGR 309
           D     + L  
Sbjct: 479 DCMYWYNFLAY 489

PyMOL of 1z6t

>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		629
2a5y_B		549	CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis	100.0
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	99.94
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	99.93
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.93
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.92
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.92
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.92
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.92
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	99.92
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	99.92
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.92
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	99.92
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.91
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.91
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.91
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	99.91
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.91
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	99.91
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.91
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.9
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.9
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.9
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.9
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.9
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.89
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.89
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	99.89
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	99.89
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.89
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.89
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.89
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.88
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.88
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.88
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.88
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.88
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.88
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.88
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.88
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.87
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.87
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.87
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.87
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.87
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.87
1z6t_A		591	APAF-1, apoptotic protease activating factor 1; ca	99.87
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.87
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.87
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.86
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.86
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	99.85
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.85
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.83
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.83
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.83
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.83
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.82
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.82
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.81
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.81
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.81
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.81
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.81
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.8
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.8
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.79
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.79
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.79
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.79
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.79
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.78
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.77
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.76
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.76
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.76
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.75
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.75
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.75
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.74
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.74
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.74
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.73
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.73
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.73
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.72
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.72
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.71
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.71
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.71
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.7
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.69
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.68
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.68
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.64
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.62
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.62
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.61
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.61
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.6
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.59
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.59
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.58
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.58
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.57
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.57
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.56
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.55
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.54
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.54
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.52
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.51
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.5
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.48
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.47
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.46
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.46
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.43
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.41
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.41
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.4
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.39
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.39
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.39
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.38
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.35
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.32
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.32
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.3
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.28
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.28
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.24
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.23
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.2
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.2
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	99.15
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.14
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	99.14
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	99.13
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.06
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	98.99
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	98.96
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	98.94
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	98.93
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	98.81
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	98.8
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	98.8
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	98.73
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.6
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	98.57
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	98.46
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	98.41
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.38
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	98.37
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	98.18
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	98.04
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	98.01
2fna_A		357	Conserved hypothetical protein; structural genomic	97.98
2qen_A		350	Walker-type ATPase; unknown function; HET: ADP; 2.	97.96
1w5s_A		412	Origin recognition complex subunit 2 ORC2; replica	97.95
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	97.85
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	97.82
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	97.74
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	97.65
1njg_A		250	DNA polymerase III subunit gamma; rossman-like fol	97.5
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	97.46
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	97.38
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	97.38
2v1u_A		387	Cell division control protein 6 homolog; DNA repli	96.96
2qby_B		384	CDC6 homolog 3, cell division control protein 6 ho	96.85
2chg_A		226	Replication factor C small subunit; DNA-binding pr	96.75
1hqc_A		324	RUVB; extended AAA-ATPase domain, complex with nuc	96.72
1fnn_A		389	CDC6P, cell division control protein 6; ORC1, AAA	96.42
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	95.99
1sxj_B		323	Activator 1 37 kDa subunit; clamp loader, processi	95.96
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	95.52
1iqp_A		327	RFCS; clamp loader, extended AAA-ATPase domain, co	94.19
2qby_A		386	CDC6 homolog 1, cell division control protein 6 ho	93.7
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	93.2
1jr3_A		373	DNA polymerase III subunit gamma; processivity, pr	93.05
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	92.94
2chq_A		319	Replication factor C small subunit; DNA-binding pr	91.25
3bos_A		242	Putative DNA replication factor; P-loop containing	89.54
1a5t_A		334	Delta prime, HOLB; zinc finger, DNA replication; 2	89.05
1sxj_E		354	Activator 1 40 kDa subunit; clamp loader, processi	88.72
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	88.01
2z4s_A		440	Chromosomal replication initiator protein DNAA; AA	86.24
1sxj_D		353	Activator 1 41 kDa subunit; clamp loader, processi	82.53
1jr3_D		343	DNA polymerase III, delta subunit; processivity, p	81.75

>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A*	Back alignment and structure

Probab=100.00  E-value=1.8e-33  Score=300.93  Aligned_cols=232  Identities=17%  Similarity=0.246  Sum_probs=181.8

Q ss_pred             cHHHHHHHHHHHcCCc-eEEEEEecCCCCChhhHHHHHHhhCCCCCCcEEEEEcCChHHHHhhcccCCCCceeCCCCChh
Q 048833           15 NLDQLQKVLRYSLKGK-RYLLVMDDVWNEDPEAWCKLKSLLLGGANGSKILVTTRSRKVASIMGTRGGTTGFNLQGLPFE   93 (629)
Q Consensus        15 ~~~~~~~~l~~~L~~k-~~LivlDdv~~~~~~~~~~~~~~~~~~~~gs~iivTTR~~~v~~~~~~~~~~~~~~l~~L~~~   93 (629)
                      +.+.+...+++.|+++ ||||||||||+.++..|..        .+|||||||||++.++..++.  ...+|+|++|+.+
T Consensus       227 ~~~~l~~~l~~~L~~~kr~LlVLDdv~~~~~~~~~~--------~~gs~ilvTTR~~~v~~~~~~--~~~~~~l~~L~~~  296 (549)
T 2a5y_B          227 TSVVLKRMICNALIDRPNTLFVFDDVVQEETIRWAQ--------ELRLRCLVTTRDVEISNAASQ--TCEFIEVTSLEID  296 (549)
T ss_dssp             CHHHHHHHHHHHHTTSTTEEEEEEEECCHHHHHHHH--------HTTCEEEEEESBGGGGGGCCS--CEEEEECCCCCHH
T ss_pred             cHHHHHHHHHHHHcCCCcEEEEEECCCCchhhcccc--------cCCCEEEEEcCCHHHHHHcCC--CCeEEECCCCCHH
Confidence            3466789999999996 9999999999754333432        279999999999999887642  1267999999999


Q ss_pred             hHHHHHHHhhcccCCCCChhHHHHHHHHHHhcCCCchHHHHHHhhhcCCCCHHHHHHHhhhhccccccccCCcchhhhcc
Q 048833           94 DCLSLFMKCAFKEERDKHPNLVKIGVEIVKKCGGIPLAVRTLGSLLYDSTDEHFWEYVRDNEIWQLEQKESGILPALRLS  173 (629)
Q Consensus        94 ~a~~Lf~~~a~~~~~~~~~~~~~~~~~i~~~c~glPLal~~~g~~L~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~l~~s  173 (629)
                      |||+||++.||....  .+++.+++++|+++|+|+||||+++|+.|+.+ ..+++..+... .+.  .....+..++++|
T Consensus       297 ea~~Lf~~~a~~~~~--~~~~~~~~~~I~~~c~GlPLAl~~~g~~l~~~-~w~~~~~l~~~-l~~--~~~~~i~~~l~~S  370 (549)
T 2a5y_B          297 ECYDFLEAYGMPMPV--GEKEEDVLNKTIELSSGNPATLMMFFKSCEPK-TFEKMAQLNNK-LES--RGLVGVECITPYS  370 (549)
T ss_dssp             HHHHHHHHTSCCCC----CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSS-SHHHHHHHHHH-HHH--HCSSTTCCCSSSS
T ss_pred             HHHHHHHHHhcCCCC--chhHHHHHHHHHHHhCCChHHHHHHHHHhccc-hHHHHHHhHHH-hhc--ccHHHHHHHHhcc
Confidence            999999999986532  36888999999999999999999999999866 33333222221 111  1356788999999


Q ss_pred             cccCChhhhhhhh-----------hhccCCCCceeChHhHHHHHHHc--CCcccCCCCccHHHHHHHHHHHHHhCCceee
Q 048833          174 YDQLPPRLKQCVA-----------YCSIFPKDFKFDSYDLVQFWMAH--GLLQSHNKKEDLEDIGMRYLKELLSRSFFQD  240 (629)
Q Consensus       174 y~~L~~~~k~~fl-----------~~~~fp~~~~~~~~~l~~~wi~e--g~i~~~~~~~~~~~~~~~~l~~L~~r~ll~~  240 (629)
                      |++||++.|.||+           |||+||+++.++    ++.|+++  ||+........+++.+. ++.+|+++++++.
T Consensus       371 y~~L~~~lk~~f~~Ls~~er~l~~~ls~fp~~~~i~----i~~w~a~~~G~i~~~~~~~~~~~~~~-~l~~L~~rsLl~~  445 (549)
T 2a5y_B          371 YKSLAMALQRCVEVLSDEDRSALAFAVVMPPGVDIP----VKLWSCVIPVDICSNEEEQLDDEVAD-RLKRLSKRGALLS  445 (549)
T ss_dssp             SSSHHHHHHHHHHTSCHHHHHHTTGGGSSCTTCCEE----HHHHHHHSCC-------CCCTHHHHH-HHHHTTTBSSCSE
T ss_pred             cccccHHHHHHHhccchhhhhHhhheeeeCCCCeee----eeeeeeeccceeccCCCCCCHHHHHH-HHHHHHHcCCeeE
Confidence            9999999999999           999999999998    8899999  99987654556777777 9999999999997


Q ss_pred             cccCCCCceEEEEEeChhHHHHHHHHhccce
Q 048833          241 LTFGMFGLEVLTFKMHDLMHDLAMLVAKDEF  271 (629)
Q Consensus       241 ~~~~~~~~~~~~~~mhd~~~~~~~~~~~~~~  271 (629)
                      ...+    ...+|+|||+++++++.++.++.
T Consensus       446 ~~~~----~~~~~~mHdlv~~~a~~~~~~~~  472 (549)
T 2a5y_B          446 GKRM----PVLTFKIDHIIHMFLKHVVDAQT  472 (549)
T ss_dssp             EECS----SSCEEECCHHHHHHHHTTSCTHH
T ss_pred             ecCC----CceEEEeChHHHHHHHHHHHHHH
Confidence            6543    34589999999999998887653

PyMOL of 2a5y

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A*	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A*	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20	Back alignment and structure

>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi}	Back alignment and structure

>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A*	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A*	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix}	Back alignment and structure

>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus}	Back alignment and structure

>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus}	Back alignment and structure

>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C*	Back alignment and structure

>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus}	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B*	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A	Back alignment and structure

>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A	Back alignment and structure

>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E*	Back alignment and structure

>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A*	Back alignment and structure

>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A*	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		629
d2a5yb3		277	c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor	2e-28
d1xkua_		305	c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99	2e-05
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	2e-05
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	2e-04
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	0.004
d2astb2		284	c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1	3e-04
d2astb2		284	c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1	3e-04
d1ogqa_		313	c.10.2.8 (A:) Polygalacturonase inhibiting protein	0.001
d1a9na_		162	c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom	0.003

>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

 Score =  112 bits (282), Expect = 2e-28
 Identities = 28/185 (15%), Positives = 59/185 (31%), Gaps = 16/185 (8%)

Query: 3   KIINFVTGENQSNLDQLQKVLRYSLKGKRYLLVMDDVWNEDPEAWCKLKSLLLGGANGSK 62
            ++NF + E+ +++   + +    +     L V DDV  E+   W              +
Sbjct: 108 DLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETIRW--------AQELRLR 159

Query: 63  ILVTTRSRKVASIMGTRGGTTGFNLQGLPFEDCLSLFMKCAFKEERDKHPNLVKIGVEIV 122
            LVTTR  ++++            +  L  ++C              +      +  + +
Sbjct: 160 CLVTTRDVEISNAA--SQTCEFIEVTSLEIDECYDFLEAYGMPMPVGEKEE--DVLNKTI 215

Query: 123 KKCGGIPLAVRTLGSLLYDSTDEHFWEYVRDNEIWQLEQKESGILPALRLSYDQLPPRLK 182
           +   G P  +          T    +E +         +   G+      SY  L   L+
Sbjct: 216 ELSSGNPATLMMFFKSCEPKT----FEKMAQLNNKLESRGLVGVECITPYSYKSLAMALQ 271

Query: 183 QCVAY 187
           +CV  
Sbjct: 272 RCVEV 276

PyMOL of d2a5yb3

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		629
d2a5yb3		277	CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI	99.91
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.83
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.78
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.77
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.77
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.75
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.74
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.72
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.69
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.69
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.64
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.57
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.57
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.53
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.52
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.51
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.51
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.5
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.46
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.44
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.42
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.38
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.38
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.28
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.27
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.18
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.17
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.15
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	99.08
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	99.07
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.04
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	99.03
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	99.02
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	98.81
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.78
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	98.66
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.56
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.46
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.34
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	97.03
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	96.61
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	96.49
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	95.84
d2fnaa2		283	Archaeal ATPase SSO1545 {Sulfolobus solfataricus [	94.35
d1a5ta2		207	delta prime subunit of DNA polymerase III, N-domai	93.43
d1njfa_		239	delta prime subunit of DNA polymerase III, N-domai	89.84
d1sxje2		252	Replication factor C5 {Baker's yeast (Saccharomyce	82.63
d1sxjc2		227	Replication factor C3 {Baker's yeast (Saccharomyce	82.62
d1sxjd2		237	Replication factor C2 {Baker's yeast (Saccharomyce	82.29
d1sxjb2		224	Replication factor C4 {Baker's yeast (Saccharomyce	80.99

>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

Probab=99.91  E-value=3.4e-25  Score=212.04  Aligned_cols=153  Identities=16%  Similarity=0.155  Sum_probs=122.0

Q ss_pred             HHHHHHHHcCCceEEEEEecCCCCChhhHHHHHHhhCCCCCCcEEEEEcCChHHHHhhcccCCCCceeCCCCChhhHHHH
Q 048833           19 LQKVLRYSLKGKRYLLVMDDVWNEDPEAWCKLKSLLLGGANGSKILVTTRSRKVASIMGTRGGTTGFNLQGLPFEDCLSL   98 (629)
Q Consensus        19 ~~~~l~~~L~~k~~LivlDdv~~~~~~~~~~~~~~~~~~~~gs~iivTTR~~~v~~~~~~~~~~~~~~l~~L~~~~a~~L   98 (629)
                      ....+.+.+.++|+|+||||||+.  +.|..+.      ..|||||||||+++++..+...  .++|+|++|+.+|||+|
T Consensus       124 ~~~~~~~~L~~kr~LlVLDDv~~~--~~~~~~~------~~~srilvTTR~~~v~~~~~~~--~~~~~l~~L~~~ea~~L  193 (277)
T d2a5yb3         124 KRMICNALIDRPNTLFVFDDVVQE--ETIRWAQ------ELRLRCLVTTRDVEISNAASQT--CEFIEVTSLEIDECYDF  193 (277)
T ss_dssp             HHHHHHHHTTSTTEEEEEEEECCH--HHHHHHH------HTTCEEEEEESBGGGGGGCCSC--EEEEECCCCCHHHHHHH
T ss_pred             HHHHHHHHhccCCeeEecchhhHH--hhhhhhc------ccCceEEEEeehHHHHHhcCCC--CceEECCCCCHHHHHHH
Confidence            445688899999999999999965  3444332      3589999999999998876532  36799999999999999


Q ss_pred             HHHhhcccCCCCChhHHHHHHHHHHhcCCCchHHHHHHhhhcCCCCHHHHHHHhhhhccccccccCCcchhhhcccccCC
Q 048833           99 FMKCAFKEERDKHPNLVKIGVEIVKKCGGIPLAVRTLGSLLYDSTDEHFWEYVRDNEIWQLEQKESGILPALRLSYDQLP  178 (629)
Q Consensus        99 f~~~a~~~~~~~~~~~~~~~~~i~~~c~glPLal~~~g~~L~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~l~~sy~~L~  178 (629)
                      |++++|....  .+..++++++|+++|+|+||||+++|+.|+.++ .+.|..+.+...   .....++..++.+||++||
T Consensus       194 f~~~~~~~~~--~~~~~~~~~~iv~~c~GlPLAl~~ig~~l~~k~-~~~~~~~~~~L~---~~~~~~v~~il~~sY~~L~  267 (277)
T d2a5yb3         194 LEAYGMPMPV--GEKEEDVLNKTIELSSGNPATLMMFFKSCEPKT-FEKMAQLNNKLE---SRGLVGVECITPYSYKSLA  267 (277)
T ss_dssp             HHHTSCCCC----CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSSS-HHHHHHHHHHHH---HHCSSTTCCCSSSSSSSHH
T ss_pred             HHHHhCCccC--chhhHHHHHHHHHHhCCCHHHHHHHHHHhccCC-HHHHHHHHHHHh---cCcHHHHHHHHHHHHhccc
Confidence            9999986533  346688999999999999999999999998654 555655544321   1235778999999999999


Q ss_pred             hhhhhhhhh
Q 048833          179 PRLKQCVAY  187 (629)
Q Consensus       179 ~~~k~~fl~  187 (629)
                      ++.|.||-+
T Consensus       268 ~~lk~c~~~  276 (277)
T d2a5yb3         268 MALQRCVEV  276 (277)
T ss_dssp             HHHHHHHHT
T ss_pred             HHHHHHHHh
Confidence            999999965

PyMOL of d2a5yb3

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure