Diaphorina citri psyllid: psy10021

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710------
MLVLFETPAGYAFFKLLDEKKLQEADNLYESFQTPQGANKVLKLKHFEKFIDTTEALAATTAAVEGKLCKKLKKVLKSLVSSDVQENLLVADTKRAAYPSLGTTVLLYPYSWSGSSSNAAAKHFHNSFVINIKKPKKSSSSSKHHHHATSKKNASVTHATPSVETGHTKPLRAKRKHQLKLKRFKQTLCRRDFCSNTQILMKIILNRCVQLIGQSSTKNKGKMARMLAAKAALATRVDALGEDSSIELGTDHRAKLEIKLRLLEEGNLRRLSGTTKAKAKLEKYHGKRLEKKKFKTEFDAAEETPATPDTSSSGKKKKKNKNLDTSIVKAEPEDEPAAADVSLSKKKKKKKTQDEEEPVEEGGEEEEVSKKKKKKKKKDVEDETDPLNHVGLAHSLSRYKLKFSPDKVDTMIVQAVSLLDDLDKELNNYMMRCREWYGWHFPELGKIVTDNVAFVKTIKTIGLAHSLSRYKLKFSPDKVDTMIVQAVSLLDDLDKELNNYMMRCREWYGWHFPELGKIVTDNLKRNDNSTRDKTSASDLSEILPEDVEEKVKEAAEISMGTEISDDDIENILLLCDQVLEISSYRGQLYDYLKSRMMAVAPNLTILMGELVGARLVAQAGSLLNLAKHPASTVQILGAEKALFRSLLNLAKHPASTVQILGAEKALFRALKTKRDTPKYGLIYHSQLIGQSSTKNKGKMGSYGWQPGSASRARVTP
cEEEEccccEEEEEEEccHHHHHHHHHHHHHcccHHHHcccEEEccccccccHHHHHHHHHHHHcccccHHHHHHHHHHcccccccEEEEEEccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccHHHHHHHHHHccccccccccccccccccHHHHcccccccccccccHHHHHHHccccccHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHcccccccccccHHccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHccHHHHHHHHHHHccHHHHHcccccHHHHHcHHHHHHHHHccccccccccEEEEccHHHHHHHHHcccccccEEEEEEcccccccccccccHHHHHHccccccccccccc
MLVLFETPAGYAFFKLLDEKKLQEADNLYESFQTPQGANKVLKLKHFEKFIDTTEALAATTAAVEGKLCKKLKKVLKSLVSSDVQENLLVADTKRAAYPSLGTTVLLYPYSWSGSSSNAAAKHFHNSFVINI************************************KPLRAKRKHQLKLKRFKQTLCRRDFCSNTQILMKIILNRCVQLIGQS**KNKGKMARMLAAKAALATRVDALGEDSSIELGTDHRAKLEIKLRLL*******************************************************************EPEDEPAAADVSLSKKKKKKKTQDEEEPVEEGGEEEEVSKKKKKKKKKDVEDETDPLNHVGLAHSLSRYKLKFSPDKVDTMIVQAVSLLDDLDKELNNYMMRCREWYGWHFPELGKIVTDNVAFVKTIKTIGLAHSLSRYKLKFSPDKVDTMIVQAVSLLDDLDKELNNYMMRCREWYGWHFPELGKIVTDNLKRNDNSTRDKTSASDLSEILPEDVEEKV***A******EISDDDIENILLLCDQVLEISSYRGQLYDYLKSRMMAVAPNLTILMGELVGARLVAQAGSLLNLAKHPASTVQILGAEKALFRSLLNLAKHPASTVQILGAEKALFRALKTKRDTPKYGLIYHSQLIGQSSTKNKGKMGSYGWQPGSASRARVTP
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLVLFETPAGYAFFKLLDEKKLQEADNLYESFQTPQGANKVLKLKHFEKFIDTTEALAATTAAVEGKLCKKLKKVLKSLVSSDVQENLLVADTKRAAYPSLGTTVLLYPYSWSGSSSNAAAKHFHNSFVINIKKPKKSSSSSKHHHHATSKKNASVTHATPSVETGHTKPLRAKRKHQLKLKRFKQTLCRRDFCSNTQILMKIILNRCVQLIGQSSTKNKGKMARMLAAKAALATRVDALGEDSSIELGTDHRAKLEIKLRLLEEGNLRRLSGTTKAKAKLEKYHGKRLEKKKFKTEFDAAEETPATPDTSSSGKKKKKNKNLDTSIVKAEPEDEPAAADVSLSKKKKKKKTQDEEEPVEEGGEEEEVSKKKKKKKKKDVEDETDPLNHVGLAHSLSRYKLKFSPDKVDTMIVQAVSLLDDLDKELNNYMMRCREWYGWHFPELGKIVTDNVAFVKTIKTIGLAHSLSRYKLKFSPDKVDTMIVQAVSLLDDLDKELNNYMMRCREWYGWHFPELGKIVTDNLKRNDNSTRDKTSASDLSEILPEDVEEKVKEAAEISMGTEISDDDIENILLLCDQVLEISSYRGQLYDYLKSRMMAVAPNLTILMGELVGARLVAQAGSLLNLAKHPASTVQILGAEKALFRSLLNLAKHPASTVQILGAEKALFRALKTKRDTPKYGLIYHSQLIGQSSTKNKGKMGSYGWQPGSASRARVTP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Nucleolar protein 58 Required for pre-18S rRNA processing. May bind microtubules.confidentQ6CKR8
Nucleolar protein 58 Required for pre-18S rRNA processing. May bind microtubules.confidentQ6BIX6
Probable nucleolar protein 5-1 Required for 60S ribosomal subunit biogenesis.confidentO04658

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0032040 [CC]small-subunit processomeprobableGO:0032991, GO:0044464, GO:0030684, GO:0005623, GO:0030529, GO:0005575, GO:0044424, GO:0005622
GO:0030686 [CC]90S preribosomeprobableGO:0032991, GO:0044464, GO:0030684, GO:0005623, GO:0030529, GO:0005575, GO:0044424, GO:0005622

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1NT2, chain B
Confidence level:very confident
Coverage over the Query: 380-439,513,557-632,657-663,679-714
View the alignment between query and template
View the model in PyMOL
Template: 2NNW, chain A
Confidence level:very confident
Coverage over the Query: 387-464,532-632,657-663,677-714
View the alignment between query and template
View the model in PyMOL
Template: 2NNW, chain A
Confidence level:very confident
Coverage over the Query: 440-593,606-651
View the alignment between query and template
View the model in PyMOL
Template: 3GQU, chain A
Confidence level:very confident
Coverage over the Query: 203-265
View the alignment between query and template
View the model in PyMOL
Template: 1Y8Q, chain B
Confidence level:probable
Coverage over the Query: 242-288
View the alignment between query and template
View the model in PyMOL
Template: 1I84, chain S
Confidence level:probable
Coverage over the Query: 164-205
View the alignment between query and template
View the model in PyMOL