Diaphorina citri psyllid: psy10038


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50-
MEMITPTLDGLILPGITRMSILELSHQWNDYKVTERKITMPDIVQLSREKR
cCECccccccccccccHHHHHHHHHHHccccEEEEEEEcHHHHHHHHHHcc
MEMITPTLDGLILPGITRMSILELSHQWNDYKVTERKITMPDIVQLSR***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEMITPTLDGLILPGITRMSILELSHQWNDYKVTERKITMPDIVQLSREKR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Branched-chain-amino-acid aminotransferase Catalyzes the first reaction in the catabolism of the essential branched chain amino acids leucine, isoleucine, and valine.confidentQ54N47
Branched-chain-amino-acid aminotransferase, cytosolic Catalyzes the first reaction in the catabolism of the essential branched chain amino acids leucine, isoleucine, and valine.confidentP54690
Branched-chain-amino-acid aminotransferase, cytosolic Catalyzes the first reaction in the catabolism of the essential branched chain amino acids leucine, isoleucine, and valine.confidentP54687

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004084 [MF]branched-chain-amino-acid transaminase activityprobableGO:0008483, GO:0016740, GO:0003674, GO:0016769, GO:0003824
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0042802 [MF]identical protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0009083 [BP]branched-chain amino acid catabolic processprobableGO:0019752, GO:0009063, GO:0006807, GO:0044281, GO:0044282, GO:0044712, GO:1901575, GO:0006520, GO:0071704, GO:0009987, GO:0044710, GO:0008150, GO:0008152, GO:0043436, GO:0009056, GO:0044248, GO:0044238, GO:1901564, GO:1901565, GO:0006082, GO:0046395, GO:0016054, GO:0044237, GO:0009081

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2COI, chain A
Confidence level:very confident
Coverage over the Query: 2-51
View the alignment between query and template
View the model in PyMOL