Diaphorina citri psyllid: psy10039

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450

MAEKDLLHLLMEENTNELRRRDLALFLREYCQFSQNLQPQAKENFYKTLSSLGILPALEVVLSAEDIATKNAAIDILNFIIEFSPSFIRDYTLQQAACISREEQDPMLVNVIIEQMVSDTDPELGRAVQLMSILKILIDPDNMLSSINKTEKCEFLNYFYKYSIHLLMDPLLDNTKKDEVQVDSYHNAQLLGVILELLSFCVEHHSYHIKNFVLNKDLLRKVLVLMKSCHTFLVLSSLRFMRKIIAMKDDFYNRYIIKGHLFQPVIDTFNRNKGRYNLLDSAVLELFEYIKLEDIKVLCSHVVETYGDELESIHYVQTFRSLRLKYNQAQDKLKDLKDKSSTNLLDSVSLLRNKMTTIHRSSRAHQEPRQMDEDEEIWFNEEDSFEDASADTSPPSVTSSQLGNSAASNVITFESIGKSLSEKKVSSDSLGALVDYEEDSDEEEDPQQDT

cHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccHHcccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

*AEKDLLH*L******ELRRRDLALFLREYCQFSQNLQPQAKENFYKTLSSLGILPALEVVLSAEDIATKNAAIDILNFIIEFSPSFIRDYTLQQAACISREEQDPMLVNVIIEQMVSDTDPELGRAVQLMSILKILIDPDNMLSSINKTEKCEFLNYFYKYSIHLLMDPLLDNTKKDEVQVDSYHNAQLLGVILELLSFCVEHHSYHIKNFVLNKDLLRKVLVLMKSCHTFLVLSSLRFMRKIIAMKDDFYNRYIIKGHLFQPVIDTFNRNKGRYNLLDSAVLELFEYIKLEDIKVLCSHVVETYGDELESIHYVQTFRSLRLKYN***************************************************************************************************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MAEKDLLHLLMEENTNELRRRDLALFLREYCQFSQNLQPQAKENFYKTLSSLGILPALEVVLSAEDIATKNAAIDILNFIIEFSPSFIRDYTLQQAACISREEQDPMLVNVIIEQMVSDTDPELGRAVQLMSILKILIDPDNMLSSINKTEKCEFLNYFYKYSIHLLMDPLLDNTKKDEVQVDSYHNAQLLGVILELLSFCVEHHSYHIKNFVLNKDLLRKVLVLMKSCHTFLVLSSLRFMRKIIAMKDDFYNRYIIKGHLFQPVIDTFNRNKGRYNLLDSAVLELFEYIKLEDIKVLCSHVVETYGDELESIHYVQTxxxxxxxxxxxxxxxxxxxxxSSTNLLDSVSLLRNKMTTIHRSSRAHQEPRQMDEDEEIWFNEEDSFEDASADTSPPSVTSSQLGNSAASNVITFESIGKSLSEKKVSSDSLGALVDYEEDSDEEEDPQQDT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Serine/threonine-protein phosphatase 4 regulatory subunit 3	Regulatory subunit of serine/threonine-protein phosphatase 4. The probable PP4 complex Pp4-19C-PPP4R2r-flfl (PPP4C-PPP4R2-PPP4R3) is required to prevent caspase induced cell death (in vitro). May be involved in DNA damage repair. Key mediator specific for the localization of mira and associated cell fate determinants during both interphase and mitosis. Nuclear Flfl is required to exclude mira/pros from the nucleus when inefficiently bound to the cytoskeleton/cortex, whereas cytosolic or membrane-associated flfl is required for the cortical association and asymmetric localization of mira/pros/brat/stau at metaphase and anaphase.	confident	Q9VFS5
Serine/threonine-protein phosphatase 4 regulatory subunit 3B	Regulatory subunit of serine/threonine-protein phosphatase 4 (PP4). May regulate the activity of PPP4C at centrosomal microtubule organizing centers.	confident	Q922R5
Serine/threonine-protein phosphatase 4 regulatory subunit 3	Regulatory subunit of serine/threonine-protein phosphatase 4 (PP4).	confident	Q6DFT3

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0030289 [CC]	protein phosphatase 4 complex	probable	GO:0043234, GO:0008287, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0045722 [BP]	positive regulation of gluconeogenesis	probable	GO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:0031323, GO:0010906, GO:0010907, GO:0050789, GO:0080090, GO:0009891, GO:0010565, GO:0065007, GO:0006111, GO:0045913, GO:0009889, GO:0050794, GO:0048518, GO:0008150, GO:0010675, GO:0010676, GO:0043255, GO:0006109, GO:0048522
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005737 [CC]	cytoplasm	probable	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3UL1, chain B
Confidence level:probable
Coverage over the Query: 2-96,108-270
View the alignment between query and template
View the model in PyMOL

Template: 4B8J, chain A
Confidence level:probable
Coverage over the Query: 4-93,106-141,153-174,186-290
View the alignment between query and template
View the model in PyMOL

Template: 1W63, chain A
Confidence level:probable
Coverage over the Query: 57-92,110-162,187-249,277-311
View the alignment between query and template
View the model in PyMOL