Diaphorina citri psyllid: psy10049


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80
MKDTLDHSESLGHKVDSCIVVKHLPRLAASYNQINGDNKAAVNWTENRDVWWQDEMEDASTSCYPEWMDAEDPLFMLYTR
cHHHHHHHHHccccccEEEEEEcccccccccccccccccccccccccccccHHHHHHccccccccccccccccEEEEEcc
MKDTLDHSESLGHKVDSCIVVKHLPRLAASYNQINGDNKAAVNWTENRDVWWQDEMEDASTSCYPEWMDAEDPLFMLYTR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKDTLDHSESLGHKVDSCIVVKHLPRLAASYNQINGDNKAAVNWTENRDVWWQDEMEDASTSCYPEWMDAEDPLFMLYTR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Acetyl-coenzyme A synthetase confidentA4Y7Y7
Acetyl-coenzyme A synthetase confidentA3D3E8
Acetyl-coenzyme A synthetase Enables the cell to use acetate during aerobic growth to generate energy via the TCA cycle, and biosynthetic compounds via the glyoxylate shunt. Acetylates CheY, the response regulator involved in flagellar movement and chemotaxis.confidentQ8ZKF6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0050218 [MF]propionate-CoA ligase activityprobableGO:0016878, GO:0003824, GO:0003674, GO:0016874, GO:0016877
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0071704 [BP]organic substance metabolic processprobableGO:0008150, GO:0008152
GO:0044237 [BP]cellular metabolic processprobableGO:0009987, GO:0008150, GO:0008152

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1PG4, chain A
Confidence level:very confident
Coverage over the Query: 3-26,41-80
View the alignment between query and template
View the model in PyMOL