Diaphorina citri psyllid: psy10051


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60---
MNPGRKFEGTPFHPGNDRYWSIVEKYKVNQFYTAPTAIRTLMKYGEGPVQKHEVELDSNKQQE
ccccEEEEcccccccccccHHHHHHccccEEECcHHHHHHHHHcccccccccccccccccccc
MNPGRKFEGTPFHPGNDRYWSIVEKYKVNQFYTAPTAIRTLMKYGEGPVQKH***********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNPGRKFEGTPFHPGNDRYWSIVEKYKVNQFYTAPTAIRTLMKYGEGPVQKHEVELDSNKQQE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Acetyl-coenzyme A synthetase confidentB1M0M1
Acetyl-coenzyme A synthetase confidentO68040
Acetyl-coenzyme A synthetase confidentA4WJG1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0003987 [MF]acetate-CoA ligase activityprobableGO:0016878, GO:0016405, GO:0003824, GO:0003674, GO:0016874, GO:0016877
GO:0055114 [BP]oxidation-reduction processprobableGO:0044710, GO:0008150, GO:0008152
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0009570 [CC]chloroplast stromaprobableGO:0005737, GO:0005575, GO:0009536, GO:0043231, GO:0009532, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044435, GO:0044434, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0009507
GO:0019413 [BP]acetate biosynthetic processprobableGO:0071704, GO:1901576, GO:0044710, GO:0044711, GO:0006082, GO:0006083, GO:0046394, GO:0044237, GO:0009987, GO:0016053, GO:0019752, GO:0032787, GO:0044249, GO:0009058, GO:0008150, GO:0044281, GO:0008152, GO:0044283, GO:0043436, GO:0072330
GO:0048149 [BP]behavioral response to ethanolprobableGO:1901700, GO:0030534, GO:0032501, GO:0044707, GO:0044708, GO:0050896, GO:0007610, GO:0045471, GO:0008150, GO:0042221, GO:0097305, GO:0010033, GO:0044699
GO:0019542 [BP]propionate biosynthetic processprobableGO:0006633, GO:0006631, GO:0019752, GO:0044249, GO:0044281, GO:0044283, GO:0072330, GO:1901576, GO:0044710, GO:0044711, GO:0019541, GO:0071704, GO:0051790, GO:0006629, GO:0009987, GO:0032787, GO:0009058, GO:0008150, GO:0008152, GO:0043436, GO:0044255, GO:0008610, GO:0044238, GO:0006082, GO:0046394, GO:0016053, GO:0044237, GO:0046459
GO:0006085 [BP]acetyl-CoA biosynthetic processprobableGO:0006084, GO:1901576, GO:0035383, GO:0051186, GO:0006637, GO:0035384, GO:0071704, GO:0006732, GO:0009987, GO:0051188, GO:0044237, GO:0044249, GO:0009058, GO:0009108, GO:0071616, GO:0008152, GO:0006793, GO:0008150

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1RY2, chain A
Confidence level:very confident
Coverage over the Query: 2-59
View the alignment between query and template
View the model in PyMOL