Psyllid ID: psy10051


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60---
MNPGRKFEGTPFHPGNDRYWSIVEKYKVNQFYTAPTAIRTLMKYGEGPVQKHEVELDSNKQQE
ccccEEEEcccccccccccHHHHHHccccEEEEcHHHHHHHHHHccccccccccccccccccc
cccEEEEEcccccccccHHHHHHHHccEEEEEccHHHHHHHHHcccccccccccccccccccc
mnpgrkfegtpfhpgndrYWSIVEKYKvnqfytapTAIRTLmkygegpvqkheveldsnkqqe
mnpgrkfegtpfhpgndrYWSIVEKYKVNQFYTAPTAIRTLMKYGegpvqkheveldsnkqqe
MNPGRKFEGTPFHPGNDRYWSIVEKYKVNQFYTAPTAIRTLMKYGEGPVQKHEVELDSNKQQE
**************GNDRYWSIVEKYKVNQFYTAPTAIRTLMKYG******************
MNPGRKFEGTPFHPGNDRYWSIVEKYKVNQFYTAPTAIRTLMKYGEGPVQKHEVELD*N****
MNPGRKFEGTPFHPGNDRYWSIVEKYKVNQFYTAPTAIRTLMKYGEGPVQKH***********
*NPGRKFEGTPFHPGNDRYWSIVEKYKVNQFYTAPTAIRTLMKYGEG****************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNPGRKFEGTPFHPGNDRYWSIVEKYKVNQFYTAPTAIRTLMKYGEGPVQKHEVELDSNKQQE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query63 2.2.26 [Sep-21-2011]
Q9VP61 670 Acetyl-coenzyme A synthet no N/A 0.761 0.071 0.791 4e-18
Q9QXG4 701 Acetyl-coenzyme A synthet yes N/A 0.746 0.067 0.659 3e-12
B1ZB59 649 Acetyl-coenzyme A synthet yes N/A 0.714 0.069 0.644 3e-12
Q9NR19 701 Acetyl-coenzyme A synthet no N/A 0.746 0.067 0.659 3e-12
Q1AXQ5 644 Acetyl-coenzyme A synthet yes N/A 0.761 0.074 0.583 4e-12
B7KPN8 652 Acetyl-coenzyme A synthet yes N/A 0.714 0.069 0.644 5e-12
B1M0M1 648 Acetyl-coenzyme A synthet yes N/A 0.714 0.069 0.644 1e-11
A9W5V0 649 Acetyl-coenzyme A synthet yes N/A 0.714 0.069 0.622 1e-11
A4YK73 650 Acetyl-coenzyme A synthet yes N/A 0.777 0.075 0.591 2e-11
Q89WV5 648 Acetyl-coenzyme A synthet yes N/A 0.714 0.069 0.6 8e-11
>sp|Q9VP61|ACSA_DROME Acetyl-coenzyme A synthetase OS=Drosophila melanogaster GN=AcCoAS PE=2 SV=1 Back     alignment and function desciption
 Score = 90.1 bits (222), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 43/48 (89%)

Query: 7   FEGTPFHPGNDRYWSIVEKYKVNQFYTAPTAIRTLMKYGEGPVQKHEV 54
           FEGTPF PGNDRYWS+++KYKV QFYTAPTAIR LMK+GEGPV KH +
Sbjct: 351 FEGTPFFPGNDRYWSVIDKYKVTQFYTAPTAIRALMKFGEGPVLKHNL 398




Activates acetate so that it can be used for lipid synthesis or for energy generation.
Drosophila melanogaster (taxid: 7227)
EC: 6EC: .EC: 2EC: .EC: 1EC: .EC: 1
>sp|Q9QXG4|ACSA_MOUSE Acetyl-coenzyme A synthetase, cytoplasmic OS=Mus musculus GN=Acss2 PE=1 SV=2 Back     alignment and function description
>sp|B1ZB59|ACSA_METPB Acetyl-coenzyme A synthetase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=acsA PE=3 SV=1 Back     alignment and function description
>sp|Q9NR19|ACSA_HUMAN Acetyl-coenzyme A synthetase, cytoplasmic OS=Homo sapiens GN=ACSS2 PE=1 SV=1 Back     alignment and function description
>sp|Q1AXQ5|ACSA_RUBXD Acetyl-coenzyme A synthetase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=acsA PE=3 SV=1 Back     alignment and function description
>sp|B7KPN8|ACSA_METC4 Acetyl-coenzyme A synthetase OS=Methylobacterium chloromethanicum (strain CM4 / NCIMB 13688) GN=acsA PE=3 SV=1 Back     alignment and function description
>sp|B1M0M1|ACSA_METRJ Acetyl-coenzyme A synthetase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=acsA PE=3 SV=1 Back     alignment and function description
>sp|A9W5V0|ACSA_METEP Acetyl-coenzyme A synthetase OS=Methylobacterium extorquens (strain PA1) GN=acsA PE=3 SV=1 Back     alignment and function description
>sp|A4YK73|ACSA_BRASO Acetyl-coenzyme A synthetase OS=Bradyrhizobium sp. (strain ORS278) GN=acsA PE=3 SV=1 Back     alignment and function description
>sp|Q89WV5|ACSA_BRAJA Acetyl-coenzyme A synthetase OS=Bradyrhizobium japonicum (strain USDA 110) GN=acsA PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query63
194749047 670 GF10175 [Drosophila ananassae] gi|190624 0.761 0.071 0.791 8e-17
195495647 595 GE22350 [Drosophila yakuba] gi|194181457 0.761 0.080 0.791 1e-16
608694 581 acetyl-CoA synthetase [Drosophila melano 0.761 0.082 0.791 1e-16
25012190 524 GM15363p [Drosophila melanogaster] 0.761 0.091 0.791 1e-16
194875428 670 GG13250 [Drosophila erecta] gi|190655379 0.761 0.071 0.791 1e-16
195592088 674 GD12130 [Drosophila simulans] gi|1941977 0.761 0.071 0.791 1e-16
24667959 524 acetyl coenzyme A synthase, isoform B [D 0.761 0.091 0.791 2e-16
34922289 670 RecName: Full=Acetyl-coenzyme A syntheta 0.761 0.071 0.791 2e-16
195441363 670 GK20397 [Drosophila willistoni] gi|19416 0.761 0.071 0.791 2e-16
24667955 670 acetyl coenzyme A synthase, isoform A [D 0.761 0.071 0.791 2e-16
>gi|194749047|ref|XP_001956951.1| GF10175 [Drosophila ananassae] gi|190624233|gb|EDV39757.1| GF10175 [Drosophila ananassae] Back     alignment and taxonomy information
 Score = 91.3 bits (225), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 44/48 (91%)

Query: 7   FEGTPFHPGNDRYWSIVEKYKVNQFYTAPTAIRTLMKYGEGPVQKHEV 54
           FEGTPF+PGNDRYWS+++KYKV QFYTAPTAIR LMK+GEGPV KH +
Sbjct: 351 FEGTPFYPGNDRYWSVIDKYKVTQFYTAPTAIRALMKFGEGPVLKHNL 398




Source: Drosophila ananassae

Species: Drosophila ananassae

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|195495647|ref|XP_002095356.1| GE22350 [Drosophila yakuba] gi|194181457|gb|EDW95068.1| GE22350 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|608694|emb|CAA86738.1| acetyl-CoA synthetase [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|25012190|gb|AAN71211.1| GM15363p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|194875428|ref|XP_001973596.1| GG13250 [Drosophila erecta] gi|190655379|gb|EDV52622.1| GG13250 [Drosophila erecta] Back     alignment and taxonomy information
>gi|195592088|ref|XP_002085768.1| GD12130 [Drosophila simulans] gi|194197777|gb|EDX11353.1| GD12130 [Drosophila simulans] Back     alignment and taxonomy information
>gi|24667959|ref|NP_524196.2| acetyl coenzyme A synthase, isoform B [Drosophila melanogaster] gi|23094224|gb|AAF51696.3| acetyl coenzyme A synthase, isoform B [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|34922289|sp|Q9VP61.1|ACSA_DROME RecName: Full=Acetyl-coenzyme A synthetase; AltName: Full=Acetate--CoA ligase; AltName: Full=Acetyl-CoA synthetase; Short=ACS; Short=AceCS; AltName: Full=Acyl-activating enzyme gi|19528327|gb|AAL90278.1| LD12826p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195441363|ref|XP_002068481.1| GK20397 [Drosophila willistoni] gi|194164566|gb|EDW79467.1| GK20397 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|24667955|ref|NP_730611.1| acetyl coenzyme A synthase, isoform A [Drosophila melanogaster] gi|442633865|ref|NP_001014599.2| acetyl coenzyme A synthase, isoform D [Drosophila melanogaster] gi|23094223|gb|AAF51695.2| acetyl coenzyme A synthase, isoform A [Drosophila melanogaster] gi|329112613|gb|AEB72010.1| FI04028p [Drosophila melanogaster] gi|440216111|gb|AAX52767.2| acetyl coenzyme A synthase, isoform D [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query63
FB|FBgn0012034 670 AcCoAS "Acetyl Coenzyme A synt 0.761 0.071 0.791 1.5e-17
UNIPROTKB|F1S4Y0 701 ACSS2 "Uncharacterized protein 0.730 0.065 0.695 1.8e-12
MGI|MGI:1890410 701 Acss2 "acyl-CoA synthetase sho 0.730 0.065 0.673 6.1e-12
RGD|1305489 701 Acss2 "acyl-CoA synthetase sho 0.730 0.065 0.673 6.1e-12
UNIPROTKB|E7EWU3 651 ACSS2 "Acetyl-coenzyme A synth 0.730 0.070 0.673 9e-12
UNIPROTKB|Q9NR19 701 ACSS2 "Acetyl-coenzyme A synth 0.730 0.065 0.673 1e-11
UNIPROTKB|Q5QPH3 714 ACSS2 "Acetyl-coenzyme A synth 0.730 0.064 0.673 1e-11
UNIPROTKB|A7YWF1 701 ACSS2 "Uncharacterized protein 0.730 0.065 0.673 1.3e-11
UNIPROTKB|F1NST1 612 ACSS2 "Uncharacterized protein 0.730 0.075 0.673 1.3e-11
UNIPROTKB|J9P7N4 701 ACSS2 "Uncharacterized protein 0.730 0.065 0.630 5.7e-11
FB|FBgn0012034 AcCoAS "Acetyl Coenzyme A synthase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 224 (83.9 bits), Expect = 1.5e-17, P = 1.5e-17
 Identities = 38/48 (79%), Positives = 43/48 (89%)

Query:     7 FEGTPFHPGNDRYWSIVEKYKVNQFYTAPTAIRTLMKYGEGPVQKHEV 54
             FEGTPF PGNDRYWS+++KYKV QFYTAPTAIR LMK+GEGPV KH +
Sbjct:   351 FEGTPFFPGNDRYWSVIDKYKVTQFYTAPTAIRALMKFGEGPVLKHNL 398




GO:0003987 "acetate-CoA ligase activity" evidence=ISS;NAS
GO:0008152 "metabolic process" evidence=NAS
GO:0005737 "cytoplasm" evidence=NAS
GO:0016208 "AMP binding" evidence=IEA
GO:0019427 "acetyl-CoA biosynthetic process from acetate" evidence=IEA
GO:0048149 "behavioral response to ethanol" evidence=IMP
UNIPROTKB|F1S4Y0 ACSS2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1890410 Acss2 "acyl-CoA synthetase short-chain family member 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1305489 Acss2 "acyl-CoA synthetase short-chain family member 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E7EWU3 ACSS2 "Acetyl-coenzyme A synthetase, cytoplasmic" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NR19 ACSS2 "Acetyl-coenzyme A synthetase, cytoplasmic" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5QPH3 ACSS2 "Acetyl-coenzyme A synthetase, cytoplasmic" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A7YWF1 ACSS2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1NST1 ACSS2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|J9P7N4 ACSS2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
B1M0M1ACSA_METRJ6, ., 2, ., 1, ., 10.64440.71420.0694yesN/A
O68040ACSA_RHOCB6, ., 2, ., 1, ., 10.55100.77770.0746yesN/A
A4WJG1ACSA_PYRAR6, ., 2, ., 1, ., 10.52080.76190.0716yesN/A
Q98ET8ACSA_RHILO6, ., 2, ., 1, ., 10.55550.71420.0691yesN/A
Q0VSR6ACSA_ALCBS6, ., 2, ., 1, ., 10.57770.71420.0697yesN/A
A9W5V0ACSA_METEP6, ., 2, ., 1, ., 10.62220.71420.0693yesN/A
Q6BQF2ACS1_DEBHA6, ., 2, ., 1, ., 10.51020.77770.0730yesN/A
Q056J9ACSA_LEPBL6, ., 2, ., 1, ., 10.53060.77770.0749yesN/A
Q2NXE2ACSA_XANOM6, ., 2, ., 1, ., 10.53330.71420.0695yesN/A
Q88DW6ACSA2_PSEPK6, ., 2, ., 1, ., 10.54540.69840.0683yesN/A
Q07VK4ACSA_RHOP56, ., 2, ., 1, ., 10.57770.71420.0694yesN/A
A7HSR8ACSA_PARL16, ., 2, ., 1, ., 10.55550.71420.0695yesN/A
B1ZB59ACSA_METPB6, ., 2, ., 1, ., 10.64440.71420.0693yesN/A
A4YK73ACSA_BRASO6, ., 2, ., 1, ., 10.59180.77770.0753yesN/A
Q8P3L1ACSA_XANCP6, ., 2, ., 1, ., 10.55550.71420.0695yesN/A
Q4UP35ACSA_XANC86, ., 2, ., 1, ., 10.55550.71420.0695yesN/A
A7IFD4ACSA_XANP26, ., 2, ., 1, ., 10.57770.71420.0691yesN/A
O93730ACSA_PYRAE6, ., 2, ., 1, ., 10.54160.76190.0716yesN/A
A0LG91ACSA_SYNFM6, ., 2, ., 1, ., 10.59090.69840.0676yesN/A
Q72J95ACSA_THET26, ., 2, ., 1, ., 10.57140.77770.0756yesN/A
Q72LY9ACSA_LEPIC6, ., 2, ., 1, ., 10.51020.77770.0741yesN/A
Q1AXQ5ACSA_RUBXD6, ., 2, ., 1, ., 10.58330.76190.0745yesN/A
Q89WV5ACSA_BRAJA6, ., 2, ., 1, ., 10.60.71420.0694yesN/A
Q54Z60ACSA_DICDI6, ., 2, ., 1, ., 10.63150.60310.0563yesN/A
Q9QXG4ACSA_MOUSE6, ., 2, ., 1, ., 10.65950.74600.0670yesN/A
Q04P35ACSA_LEPBJ6, ., 2, ., 1, ., 10.53060.77770.0749yesN/A
B2IB12ACSA_BEII96, ., 2, ., 1, ., 10.57770.71420.0697yesN/A
B8EPJ0ACSA_METSB6, ., 2, ., 1, ., 10.59090.69840.0682yesN/A
C1AA44ACSA_GEMAT6, ., 2, ., 1, ., 10.52080.76190.0733yesN/A
Q5SIW6ACSA_THET86, ., 2, ., 1, ., 10.57140.77770.0756yesN/A
B7KPN8ACSA_METC46, ., 2, ., 1, ., 10.64440.71420.0690yesN/A
Q27549ACSA_CRYPV6, ., 2, ., 1, ., 10.51060.74600.0677yesN/A
Q9HV66ACSA2_PSEAE6, ., 2, ., 1, ., 10.53330.71420.0697yesN/A
Q87C00ACSA_XYLFT6, ., 2, ., 1, ., 10.55550.71420.0695yesN/A
Q6G1W0ACSA_BARHE6, ., 2, ., 1, ., 10.60.71420.0690yesN/A
Q8PF09ACSA_XANAC6, ., 2, ., 1, ., 10.53330.71420.0695yesN/A
Q8EYG2ACSA_LEPIN6, ., 2, ., 1, ., 10.51020.77770.0741yesN/A
Q9PB89ACSA_XYLFA6, ., 2, ., 1, ., 10.53330.71420.0695yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query63
cd05966 602 cd05966, ACS, Acetyl-CoA synthetase (also known as 3e-25
PRK00174 637 PRK00174, PRK00174, acetyl-CoA synthetase; Provisi 3e-23
TIGR02188 625 TIGR02188, Ac_CoA_lig_AcsA, acetate--CoA ligase 6e-23
PLN02654 666 PLN02654, PLN02654, acetate-CoA ligase 4e-14
PRK10524 629 PRK10524, prpE, propionyl-CoA synthetase; Provisio 3e-13
cd05968 474 cd05968, AACS_like, Uncharacterized acyl-CoA synth 6e-13
COG0365 528 COG0365, Acs, Acyl-coenzyme A synthetases/AMP-(fat 7e-13
TIGR02316 628 TIGR02316, propion_prpE, propionate--CoA ligase 4e-11
PRK04319 570 PRK04319, PRK04319, acetyl-CoA synthetase; Provisi 1e-10
cd05967 607 cd05967, PrpE, Propionyl-CoA synthetase (PrpE) 2e-08
cd05969 443 cd05969, MACS_like_4, Uncharacterized subfamily of 3e-07
PRK03584 655 PRK03584, PRK03584, acetoacetyl-CoA synthetase; Pr 4e-06
cd05943 616 cd05943, AACS, Acetoacetyl-CoA synthetase (acetoac 9e-06
PRK07529 632 PRK07529, PRK07529, AMP-binding domain protein; Va 2e-05
pfam00501 412 pfam00501, AMP-binding, AMP-binding enzyme 4e-04
PTZ00237 647 PTZ00237, PTZ00237, acetyl-CoA synthetase; Provisi 5e-04
cd05972 430 cd05972, MACS_like, Medium-chain acyl-CoA syntheta 0.001
cd05973 440 cd05973, MACS_like_2, Uncharacterized subfamily of 0.004
>gnl|CDD|213313 cd05966, ACS, Acetyl-CoA synthetase (also known as acetate-CoA ligase and acetyl-activating enzyme) Back     alignment and domain information
 Score = 95.7 bits (239), Expect = 3e-25
 Identities = 27/46 (58%), Positives = 34/46 (73%)

Query: 7   FEGTPFHPGNDRYWSIVEKYKVNQFYTAPTAIRTLMKYGEGPVQKH 52
           +EG P +P   R+W IVEKYKV  FYTAPTAIR LM++G+   +KH
Sbjct: 299 YEGAPDYPDPGRWWEIVEKYKVTIFYTAPTAIRMLMRFGDEWPKKH 344


Acetyl-CoA synthetase (ACS) catalyzes the formation of acetyl-CoA from acetate, CoA, and ATP. Synthesis of acetyl-CoA is carried out in a two-step reaction. In the first step, the enzyme catalyzes the synthesis of acetyl-AMP intermediate from acetate and ATP. In the second step, acetyl-AMP reacts with CoA to produce acetyl-CoA. This enzyme is widely present in all living organisms. The activity of this enzyme is crucial for maintaining the required levels of acetyl-CoA, a key intermediate in many important biosynthetic and catabolic processes. Acetyl-CoA is used in the biosynthesis of glucose, fatty acids, and cholesterol. It can also be used in the production of energy in the citric acid cycle. Eukaryotes typically have two isoforms of acetyl-CoA synthetase, a cytosolic form involved in biosynthetic processes and a mitochondrial form primarily involved in energy generation. Length = 602

>gnl|CDD|234677 PRK00174, PRK00174, acetyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|233770 TIGR02188, Ac_CoA_lig_AcsA, acetate--CoA ligase Back     alignment and domain information
>gnl|CDD|215353 PLN02654, PLN02654, acetate-CoA ligase Back     alignment and domain information
>gnl|CDD|182517 PRK10524, prpE, propionyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|213315 cd05968, AACS_like, Uncharacterized acyl-CoA synthetase subfamily similar to Acetoacetyl-CoA synthetase Back     alignment and domain information
>gnl|CDD|223442 COG0365, Acs, Acyl-coenzyme A synthetases/AMP-(fatty) acid ligases [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|131369 TIGR02316, propion_prpE, propionate--CoA ligase Back     alignment and domain information
>gnl|CDD|235279 PRK04319, PRK04319, acetyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|213314 cd05967, PrpE, Propionyl-CoA synthetase (PrpE) Back     alignment and domain information
>gnl|CDD|213316 cd05969, MACS_like_4, Uncharacterized subfamily of Acetyl-CoA synthetase like family (ACS) Back     alignment and domain information
>gnl|CDD|235134 PRK03584, PRK03584, acetoacetyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|213308 cd05943, AACS, Acetoacetyl-CoA synthetase (acetoacetate-CoA ligase, AACS) Back     alignment and domain information
>gnl|CDD|236043 PRK07529, PRK07529, AMP-binding domain protein; Validated Back     alignment and domain information
>gnl|CDD|215954 pfam00501, AMP-binding, AMP-binding enzyme Back     alignment and domain information
>gnl|CDD|240325 PTZ00237, PTZ00237, acetyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|213319 cd05972, MACS_like, Medium-chain acyl-CoA synthetase (MACS or ACSM) Back     alignment and domain information
>gnl|CDD|213320 cd05973, MACS_like_2, Uncharacterized subfamily of medium-chain acyl-CoA synthetase (MACS) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 63
COG0365 528 Acs Acyl-coenzyme A synthetases/AMP-(fatty) acid l 99.4
PLN02654 666 acetate-CoA ligase 98.97
TIGR02188 625 Ac_CoA_lig_AcsA acetate--CoA ligase. This model de 98.77
TIGR02316 628 propion_prpE propionate--CoA ligase. This family c 98.77
KOG1175|consensus 626 98.72
PRK03584 655 acetoacetyl-CoA synthetase; Provisional 98.68
TIGR01217 652 ac_ac_CoA_syn acetoacetyl-CoA synthase. This enzym 98.68
PRK10524 629 prpE propionyl-CoA synthetase; Provisional 98.59
PLN03052 728 acetate--CoA ligase; Provisional 98.57
PRK00174 637 acetyl-CoA synthetase; Provisional 98.51
PTZ00237 647 acetyl-CoA synthetase; Provisional 98.47
COG1021 542 EntE Peptide arylation enzymes [Secondary metaboli 98.4
KOG1176|consensus 537 98.39
KOG1177|consensus 596 98.3
PLN03051 499 acyl-activating enzyme; Provisional 98.2
PRK04319 570 acetyl-CoA synthetase; Provisional 97.92
PRK07868 994 acyl-CoA synthetase; Validated 97.89
PRK08276 502 long-chain-fatty-acid--CoA ligase; Validated 97.83
PLN02574 560 4-coumarate--CoA ligase-like 97.78
PRK07788 549 acyl-CoA synthetase; Validated 97.76
PRK13382 537 acyl-CoA synthetase; Provisional 97.66
PRK13390 501 acyl-CoA synthetase; Provisional 97.66
COG0318 534 CaiC Acyl-CoA synthetases (AMP-forming)/AMP-acid l 97.63
PLN02860 563 o-succinylbenzoate-CoA ligase 97.63
PRK06334 539 long chain fatty acid--[acyl-carrier-protein] liga 97.62
PRK06188 524 acyl-CoA synthetase; Validated 97.62
PLN02246 537 4-coumarate--CoA ligase 97.61
PRK06839 496 acyl-CoA synthetase; Validated 97.61
PRK07470 528 acyl-CoA synthetase; Validated 97.55
PRK05605 573 long-chain-fatty-acid--CoA ligase; Validated 97.52
PRK12406 509 long-chain-fatty-acid--CoA ligase; Provisional 97.52
PRK08316 523 acyl-CoA synthetase; Validated 97.5
PRK07008 539 long-chain-fatty-acid--CoA ligase; Validated 97.47
PRK13391 511 acyl-CoA synthetase; Provisional 97.46
PRK08314 546 long-chain-fatty-acid--CoA ligase; Validated 97.44
PRK06145 497 acyl-CoA synthetase; Validated 97.43
PRK09274 552 peptide synthase; Provisional 97.43
PLN03102 579 acyl-activating enzyme; Provisional 97.4
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 97.37
PRK05857 540 acyl-CoA synthetase; Validated 97.34
PLN02330 546 4-coumarate--CoA ligase-like 1 97.33
TIGR03205 541 pimA dicarboxylate--CoA ligase PimA. PimA, a membe 97.29
PRK06710 563 long-chain-fatty-acid--CoA ligase; Validated 97.26
PRK06187 521 long-chain-fatty-acid--CoA ligase; Validated 97.26
PRK07638 487 acyl-CoA synthetase; Validated 97.25
PRK05852 534 acyl-CoA synthetase; Validated 97.2
PRK13295 547 cyclohexanecarboxylate-CoA ligase; Reviewed 97.2
PRK08008 517 caiC putative crotonobetaine/carnitine-CoA ligase; 97.16
PRK06164 540 acyl-CoA synthetase; Validated 97.14
PLN02479 567 acetate-CoA ligase 97.14
PRK07656 513 long-chain-fatty-acid--CoA ligase; Validated 97.11
TIGR02275 527 DHB_AMP_lig 2,3-dihydroxybenzoate-AMP ligase. Prot 97.09
PRK08279 600 long-chain-acyl-CoA synthetase; Validated 97.08
PRK06178 567 acyl-CoA synthetase; Validated 97.08
PRK08315 559 AMP-binding domain protein; Validated 97.05
TIGR03098 515 ligase_PEP_1 acyl-CoA ligase (AMP-forming), exosor 97.05
PRK12583 558 acyl-CoA synthetase; Provisional 97.04
PRK13383 516 acyl-CoA synthetase; Provisional 97.02
PRK03640 483 O-succinylbenzoic acid--CoA ligase; Provisional 97.01
PRK06155 542 crotonobetaine/carnitine-CoA ligase; Provisional 97.01
PF00501 417 AMP-binding: AMP-binding enzyme; InterPro: IPR0008 96.94
TIGR03208 538 cyc_hxne_CoA_lg cyclohexanecarboxylate-CoA ligase. 96.93
PRK05677 562 long-chain-fatty-acid--CoA ligase; Validated 96.92
PLN02614 666 long-chain acyl-CoA synthetase 96.91
PRK07529 632 AMP-binding domain protein; Validated 96.9
PRK06018 542 putative acyl-CoA synthetase; Provisional 96.88
PRK07867 529 acyl-CoA synthetase; Validated 96.87
PRK12492 562 long-chain-fatty-acid--CoA ligase; Provisional 96.86
TIGR03089227 conserved hypothetical protein TIGR03089. This pro 96.82
PRK08751 560 putative long-chain fatty acyl CoA ligase; Provisi 96.81
TIGR02262 508 benz_CoA_lig benzoate-CoA ligase family. Character 96.78
PRK07786 542 long-chain-fatty-acid--CoA ligase; Validated 96.71
PLN02861 660 long-chain-fatty-acid-CoA ligase 96.69
PRK08162 545 acyl-CoA synthetase; Validated 96.66
PTZ00342 746 acyl-CoA synthetase; Provisional 96.63
PRK08308 414 acyl-CoA synthetase; Validated 96.62
PRK07059 557 Long-chain-fatty-acid--CoA ligase; Validated 96.6
PLN02736 651 long-chain acyl-CoA synthetase 96.59
PRK10946 536 entE enterobactin synthase subunit E; Provisional 96.59
PRK08043 718 bifunctional acyl-[acyl carrier protein] synthetas 96.49
PRK13388 540 acyl-CoA synthetase; Provisional 96.44
PRK09088 488 acyl-CoA synthetase; Validated 96.44
TIGR01734 502 D-ala-DACP-lig D-alanine--poly(phosphoribitol) lig 96.43
PRK07787 471 acyl-CoA synthetase; Validated 96.43
PRK08180 614 feruloyl-CoA synthase; Reviewed 96.41
TIGR02155 422 PA_CoA_ligase phenylacetate-CoA ligase. Phenylacet 96.41
PRK10252 1296 entF enterobactin synthase subunit F; Provisional 96.41
PRK08974 560 long-chain-fatty-acid--CoA ligase; Validated 96.4
PRK06087 547 short chain acyl-CoA synthetase; Reviewed 96.38
PRK04813 503 D-alanine--poly(phosphoribitol) ligase subunit 1; 96.09
PRK06060 705 acyl-CoA synthetase; Validated 96.07
PRK05620 576 long-chain-fatty-acid--CoA ligase; Validated 96.04
PRK12316 5163 peptide synthase; Provisional 95.98
PRK12316 5163 peptide synthase; Provisional 95.93
TIGR03443 1389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 95.93
PRK12467 3956 peptide synthase; Provisional 95.75
PRK12467 3956 peptide synthase; Provisional 95.66
PRK05851 525 long-chain-fatty-acid--[acyl-carrier-protein] liga 95.6
PRK05691 4334 peptide synthase; Validated 95.49
PRK07514 504 malonyl-CoA synthase; Validated 95.45
PRK07798 533 acyl-CoA synthetase; Validated 95.39
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 95.14
TIGR01733 408 AA-adenyl-dom amino acid adenylation domain. This 95.1
TIGR01923 436 menE O-succinylbenzoate-CoA ligase. This model rep 94.93
PRK12582 624 acyl-CoA synthetase; Provisional 94.78
PLN02430 660 long-chain-fatty-acid-CoA ligase 94.57
KOG1179|consensus 649 94.47
PTZ00297 1452 pantothenate kinase; Provisional 94.28
PRK05691 4334 peptide synthase; Validated 93.29
TIGR02372 386 4_coum_CoA_lig 4-coumarate--CoA ligase, photoactiv 92.77
PRK07824 358 O-succinylbenzoic acid--CoA ligase; Provisional 92.73
PRK12476 612 putative fatty-acid--CoA ligase; Provisional 91.92
PRK07769 631 long-chain-fatty-acid--CoA ligase; Validated 91.51
PRK07768 545 long-chain-fatty-acid--CoA ligase; Validated 91.31
PRK07445 452 O-succinylbenzoic acid--CoA ligase; Reviewed 87.42
PTZ00216 700 acyl-CoA synthetase; Provisional 86.87
COG1022 613 FAA1 Long-chain acyl-CoA synthetases (AMP-forming) 86.83
PRK09192 579 acyl-CoA synthetase; Validated 86.68
PLN02387 696 long-chain-fatty-acid-CoA ligase family protein 86.39
COG1020 642 EntF Non-ribosomal peptide synthetase modules and 84.33
KOG1256|consensus 691 82.74
PRK05850 578 acyl-CoA synthetase; Validated 81.85
TIGR03335 445 F390_ftsA coenzyme F390 synthetase. This enzyme, c 81.02
>COG0365 Acs Acyl-coenzyme A synthetases/AMP-(fatty) acid ligases [Lipid metabolism] Back     alignment and domain information
Probab=99.40  E-value=7.1e-13  Score=85.46  Aligned_cols=55  Identities=35%  Similarity=0.559  Sum_probs=50.3

Q ss_pred             CceEeecCCCCCCChhHHHHHHhhhcceEEeecHHHHHHHHhcCCCCCccccCCcccc
Q psy10051          2 NPGRKFEGTPFHPGNDRYWSIVEKYKVNQFYTAPTAIRTLMKYGEGPVQKHEVELDSN   59 (63)
Q Consensus         2 ~t~vl~~g~p~~~d~~~~~~~i~~~~vT~~~~~Pt~~~~l~~~~~~~~~~~dl~~l~~   59 (63)
                      +|+++|+|.|++ +++++|++|+++++|+|+++||.+|+|++.+.  .+.+|+|++++
T Consensus       240 at~~~~eg~p~~-~~~~~~~~ie~~~vt~~~tsPT~~R~l~~~g~--~~~~dlssLr~  294 (528)
T COG0365         240 ATTVLYDGRPFY-SPERLWEALEKYKVTIFGTSPTFLRRLMKLGL--GEPYDLSSLRV  294 (528)
T ss_pred             CeEEEeCCCCCC-CHHHHHHHHHHhCCceEeeCHHHHHHHHhcCC--cccccchhhee
Confidence            688999999998 99999999999999999999999999999976  46789998765



>PLN02654 acetate-CoA ligase Back     alignment and domain information
>TIGR02188 Ac_CoA_lig_AcsA acetate--CoA ligase Back     alignment and domain information
>TIGR02316 propion_prpE propionate--CoA ligase Back     alignment and domain information
>KOG1175|consensus Back     alignment and domain information
>PRK03584 acetoacetyl-CoA synthetase; Provisional Back     alignment and domain information
>TIGR01217 ac_ac_CoA_syn acetoacetyl-CoA synthase Back     alignment and domain information
>PRK10524 prpE propionyl-CoA synthetase; Provisional Back     alignment and domain information
>PLN03052 acetate--CoA ligase; Provisional Back     alignment and domain information
>PRK00174 acetyl-CoA synthetase; Provisional Back     alignment and domain information
>PTZ00237 acetyl-CoA synthetase; Provisional Back     alignment and domain information
>COG1021 EntE Peptide arylation enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG1176|consensus Back     alignment and domain information
>KOG1177|consensus Back     alignment and domain information
>PLN03051 acyl-activating enzyme; Provisional Back     alignment and domain information
>PRK04319 acetyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK07868 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK08276 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PLN02574 4-coumarate--CoA ligase-like Back     alignment and domain information
>PRK07788 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK13382 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK13390 acyl-CoA synthetase; Provisional Back     alignment and domain information
>COG0318 CaiC Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases II [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02860 o-succinylbenzoate-CoA ligase Back     alignment and domain information
>PRK06334 long chain fatty acid--[acyl-carrier-protein] ligase; Validated Back     alignment and domain information
>PRK06188 acyl-CoA synthetase; Validated Back     alignment and domain information
>PLN02246 4-coumarate--CoA ligase Back     alignment and domain information
>PRK06839 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK07470 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK05605 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK12406 long-chain-fatty-acid--CoA ligase; Provisional Back     alignment and domain information
>PRK08316 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK07008 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK13391 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK08314 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK06145 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK09274 peptide synthase; Provisional Back     alignment and domain information
>PLN03102 acyl-activating enzyme; Provisional Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>PRK05857 acyl-CoA synthetase; Validated Back     alignment and domain information
>PLN02330 4-coumarate--CoA ligase-like 1 Back     alignment and domain information
>TIGR03205 pimA dicarboxylate--CoA ligase PimA Back     alignment and domain information
>PRK06710 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK06187 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK07638 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK05852 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK13295 cyclohexanecarboxylate-CoA ligase; Reviewed Back     alignment and domain information
>PRK08008 caiC putative crotonobetaine/carnitine-CoA ligase; Validated Back     alignment and domain information
>PRK06164 acyl-CoA synthetase; Validated Back     alignment and domain information
>PLN02479 acetate-CoA ligase Back     alignment and domain information
>PRK07656 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>TIGR02275 DHB_AMP_lig 2,3-dihydroxybenzoate-AMP ligase Back     alignment and domain information
>PRK08279 long-chain-acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK06178 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK08315 AMP-binding domain protein; Validated Back     alignment and domain information
>TIGR03098 ligase_PEP_1 acyl-CoA ligase (AMP-forming), exosortase system type 1 associated Back     alignment and domain information
>PRK12583 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK13383 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK03640 O-succinylbenzoic acid--CoA ligase; Provisional Back     alignment and domain information
>PRK06155 crotonobetaine/carnitine-CoA ligase; Provisional Back     alignment and domain information
>PF00501 AMP-binding: AMP-binding enzyme; InterPro: IPR000873 A number of prokaryotic and eukaryotic enzymes, which appear to act via an ATP-dependent covalent binding of AMP to their substrate, share a region of sequence similarity [, , ] Back     alignment and domain information
>TIGR03208 cyc_hxne_CoA_lg cyclohexanecarboxylate-CoA ligase Back     alignment and domain information
>PRK05677 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PLN02614 long-chain acyl-CoA synthetase Back     alignment and domain information
>PRK07529 AMP-binding domain protein; Validated Back     alignment and domain information
>PRK06018 putative acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK07867 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK12492 long-chain-fatty-acid--CoA ligase; Provisional Back     alignment and domain information
>TIGR03089 conserved hypothetical protein TIGR03089 Back     alignment and domain information
>PRK08751 putative long-chain fatty acyl CoA ligase; Provisional Back     alignment and domain information
>TIGR02262 benz_CoA_lig benzoate-CoA ligase family Back     alignment and domain information
>PRK07786 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PLN02861 long-chain-fatty-acid-CoA ligase Back     alignment and domain information
>PRK08162 acyl-CoA synthetase; Validated Back     alignment and domain information
>PTZ00342 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK08308 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK07059 Long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PLN02736 long-chain acyl-CoA synthetase Back     alignment and domain information
>PRK10946 entE enterobactin synthase subunit E; Provisional Back     alignment and domain information
>PRK08043 bifunctional acyl-[acyl carrier protein] synthetase/2-acylglycerophosphoethanolamine acyltransferase; Validated Back     alignment and domain information
>PRK13388 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK09088 acyl-CoA synthetase; Validated Back     alignment and domain information
>TIGR01734 D-ala-DACP-lig D-alanine--poly(phosphoribitol) ligase, subunit 1 Back     alignment and domain information
>PRK07787 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK08180 feruloyl-CoA synthase; Reviewed Back     alignment and domain information
>TIGR02155 PA_CoA_ligase phenylacetate-CoA ligase Back     alignment and domain information
>PRK10252 entF enterobactin synthase subunit F; Provisional Back     alignment and domain information
>PRK08974 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK06087 short chain acyl-CoA synthetase; Reviewed Back     alignment and domain information
>PRK04813 D-alanine--poly(phosphoribitol) ligase subunit 1; Provisional Back     alignment and domain information
>PRK06060 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK05620 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK12316 peptide synthase; Provisional Back     alignment and domain information
>PRK12316 peptide synthase; Provisional Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>PRK12467 peptide synthase; Provisional Back     alignment and domain information
>PRK12467 peptide synthase; Provisional Back     alignment and domain information
>PRK05851 long-chain-fatty-acid--[acyl-carrier-protein] ligase; Validated Back     alignment and domain information
>PRK05691 peptide synthase; Validated Back     alignment and domain information
>PRK07514 malonyl-CoA synthase; Validated Back     alignment and domain information
>PRK07798 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>TIGR01733 AA-adenyl-dom amino acid adenylation domain Back     alignment and domain information
>TIGR01923 menE O-succinylbenzoate-CoA ligase Back     alignment and domain information
>PRK12582 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PLN02430 long-chain-fatty-acid-CoA ligase Back     alignment and domain information
>KOG1179|consensus Back     alignment and domain information
>PTZ00297 pantothenate kinase; Provisional Back     alignment and domain information
>PRK05691 peptide synthase; Validated Back     alignment and domain information
>TIGR02372 4_coum_CoA_lig 4-coumarate--CoA ligase, photoactive yellow protein activation family Back     alignment and domain information
>PRK07824 O-succinylbenzoic acid--CoA ligase; Provisional Back     alignment and domain information
>PRK12476 putative fatty-acid--CoA ligase; Provisional Back     alignment and domain information
>PRK07769 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK07768 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK07445 O-succinylbenzoic acid--CoA ligase; Reviewed Back     alignment and domain information
>PTZ00216 acyl-CoA synthetase; Provisional Back     alignment and domain information
>COG1022 FAA1 Long-chain acyl-CoA synthetases (AMP-forming) [Lipid metabolism] Back     alignment and domain information
>PRK09192 acyl-CoA synthetase; Validated Back     alignment and domain information
>PLN02387 long-chain-fatty-acid-CoA ligase family protein Back     alignment and domain information
>COG1020 EntF Non-ribosomal peptide synthetase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG1256|consensus Back     alignment and domain information
>PRK05850 acyl-CoA synthetase; Validated Back     alignment and domain information
>TIGR03335 F390_ftsA coenzyme F390 synthetase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query63
1ry2_A 663 Crystal Structure Of Yeast Acetyl-Coenzyme A Synthe 3e-10
2p2f_A 652 Acetyl-coa Synthetase, Wild-type With Acetate, Amp, 6e-06
2p2q_A 652 Acetyl-Coa Synthetase, R584e Mutation Length = 652 6e-06
1pg3_A 652 Acetyl Coa Synthetase, Acetylated On Lys609 Length 1e-05
2p2j_A 652 Acetyl-Coa Synthetase, K609a Mutation Length = 652 1e-05
2p2b_A 652 Acetyl-coa Synthetase, V386a Mutation Length = 652 1e-05
2p2m_A 652 Acetyl-Coa Synthetase, R194a Mutation Length = 652 1e-05
2p20_A 652 Acetyl-Coa Synthetase, R584a Mutation Length = 652 1e-05
>pdb|1RY2|A Chain A, Crystal Structure Of Yeast Acetyl-Coenzyme A Synthetase In Complex With Amp Length = 663 Back     alignment and structure

Iteration: 1

Score = 60.1 bits (144), Expect = 3e-10, Method: Composition-based stats. Identities = 23/49 (46%), Positives = 35/49 (71%) Query: 7 FEGTPFHPGNDRYWSIVEKYKVNQFYTAPTAIRTLMKYGEGPVQKHEVE 55 FEGTP +P RYW I++++KV QFY APTA+R L + G+ ++ H ++ Sbjct: 336 FEGTPAYPNYSRYWDIIDEHKVTQFYVAPTALRLLKRAGDSYIENHSLK 384
>pdb|2P2F|A Chain A, Acetyl-coa Synthetase, Wild-type With Acetate, Amp, And Coa Bound Length = 652 Back     alignment and structure
>pdb|2P2Q|A Chain A, Acetyl-Coa Synthetase, R584e Mutation Length = 652 Back     alignment and structure
>pdb|1PG3|A Chain A, Acetyl Coa Synthetase, Acetylated On Lys609 Length = 652 Back     alignment and structure
>pdb|2P2J|A Chain A, Acetyl-Coa Synthetase, K609a Mutation Length = 652 Back     alignment and structure
>pdb|2P2B|A Chain A, Acetyl-coa Synthetase, V386a Mutation Length = 652 Back     alignment and structure
>pdb|2P2M|A Chain A, Acetyl-Coa Synthetase, R194a Mutation Length = 652 Back     alignment and structure
>pdb|2P20|A Chain A, Acetyl-Coa Synthetase, R584a Mutation Length = 652 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query63
1ry2_A 663 Acetyl-coenzyme A synthetase 1, acyl-activating en 5e-26
1pg4_A 652 Acetyl-COA synthetase; AMP-forming, adenylate-form 8e-26
3etc_A 580 AMP-binding protein; adenylate-forming acyl-COA sy 3e-12
3c5e_A 570 Acyl-coenzyme A synthetase ACSM2A, mitochondrial; 8e-10
>1ry2_A Acetyl-coenzyme A synthetase 1, acyl-activating enzyme 1; AMP forming, related to firefly luciferase, ligase; HET: AMP; 2.30A {Saccharomyces cerevisiae} SCOP: e.23.1.1 Length = 663 Back     alignment and structure
 Score = 97.3 bits (243), Expect = 5e-26
 Identities = 23/46 (50%), Positives = 33/46 (71%)

Query: 7   FEGTPFHPGNDRYWSIVEKYKVNQFYTAPTAIRTLMKYGEGPVQKH 52
           FEGTP +P   RYW I++++KV QFY APTA+R L + G+  ++ H
Sbjct: 336 FEGTPAYPNYSRYWDIIDEHKVTQFYVAPTALRLLKRAGDSYIENH 381


>1pg4_A Acetyl-COA synthetase; AMP-forming, adenylate-forming, thioester-forming, ligase; HET: COA PRX; 1.75A {Salmonella enterica} SCOP: e.23.1.1 PDB: 1pg3_A* 2p2f_A* 2p2b_A* 2p2q_A* 2p2j_A* 2p20_A* 2p2m_A* Length = 652 Back     alignment and structure
>3etc_A AMP-binding protein; adenylate-forming acyl-COA synthetase ligase, ligase; HET: PGE 1PE EPE; 2.10A {Methanosarcina acetivorans} Length = 580 Back     alignment and structure
>3c5e_A Acyl-coenzyme A synthetase ACSM2A, mitochondrial; middle-chain acyl-COA synthetase, xenobiotic/medium-chain FA COA ligase; HET: ATP; 1.60A {Homo sapiens} PDB: 2vze_A 3b7w_A* 3day_A* 3eq6_A* 3eyn_A* 3gpc_A* 2wd9_A* Length = 570 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query63
1ry2_A 663 Acetyl-coenzyme A synthetase 1, acyl-activating en 98.86
1pg4_A 652 Acetyl-COA synthetase; AMP-forming, adenylate-form 98.78
2d1s_A 548 Luciferase, luciferin 4-monooxygenase; alpha/beta, 98.11
3rix_A 550 Luciferase, luciferin 4-monooxygenase; oxidoreduct 98.05
3ni2_A 536 4-coumarate:COA ligase; 4CL, phenylpropanoid biosy 98.02
3etc_A 580 AMP-binding protein; adenylate-forming acyl-COA sy 97.99
1t5h_X 504 4-chlorobenzoyl COA ligase; adenylate-forming coen 97.95
1mdb_A 539 2,3-dihydroxybenzoate-AMP ligase; adenylation doma 97.94
3r44_A 517 Fatty acyl COA synthetase FADD13 (fatty-acyl-COA s 97.83
3o83_A 544 Peptide arylation enzyme; ligase, adenylation of 2 97.81
3g7s_A 549 Long-chain-fatty-acid--COA ligase (FADD-1); protei 97.77
3tsy_A 979 Fusion protein 4-coumarate--COA ligase 1, resvera 97.76
1v25_A 541 Long-chain-fatty-acid-COA synthetase; ligase, stru 97.71
3c5e_A 570 Acyl-coenzyme A synthetase ACSM2A, mitochondrial; 97.67
3ipl_A 501 2-succinylbenzoate--COA ligase; structural genomic 97.61
3qov_A 436 Phenylacetate-coenzyme A ligase; acetyl-COA synthe 97.55
3fce_A 512 D-alanine--poly(phosphoribitol) ligase subunit 1; 97.42
3e7w_A 511 D-alanine--poly(phosphoribitol) ligase subunit 1; 97.42
2y4o_A 443 Phenylacetate-coenzyme A ligase; phenylacetic acid 97.37
4gr5_A 570 Non-ribosomal peptide synthetase; MBTH-like domain 97.35
3rg2_A 617 Enterobactin synthase component E (ENTE), 2,3-DIH 97.27
4fuq_A 503 Malonyl COA synthetase; ANL superfamily, methylma 97.27
2v7b_A 529 Benzoate-coenzyme A ligase; benzoate oxidation, be 97.23
2y27_A 437 Phenylacetate-coenzyme A ligase; phenylacetic acid 97.22
4dg8_A 620 PA1221; ANL superfamily, adenylation domain, pepti 97.18
3ivr_A 509 Putative long-chain-fatty-acid COA ligase; structu 97.16
3l8c_A 521 D-alanine--poly(phosphoribitol) ligase subunit 1; 97.11
3kxw_A 590 Saframycin MX1 synthetase B; fatty acid AMP ligase 96.93
3hgu_A 369 EHPF; phenazine, antibiotic, biosynthetic protein; 96.79
3gqw_A 576 Fatty acid AMP ligase; FAAL, E. coli, ATP-dependen 96.7
4gs5_A 358 Acyl-COA synthetase (AMP-forming)/AMP-acid ligase 96.66
3t5a_A 480 Long-chain-fatty-acid--AMP ligase FADD28; acetyl-C 96.66
3nyq_A 505 Malonyl-COA ligase; A/B topology ababa sandwich be 96.31
2vsq_A 1304 Surfactin synthetase subunit 3; ligase, peptidyl c 95.81
1amu_A 563 GRSA, gramicidin synthetase 1; peptide synthetase, 94.8
3ite_A 562 SIDN siderophore synthetase; ligase, non-ribosomal 94.3
>1ry2_A Acetyl-coenzyme A synthetase 1, acyl-activating enzyme 1; AMP forming, related to firefly luciferase, ligase; HET: AMP; 2.30A {Saccharomyces cerevisiae} SCOP: e.23.1.1 Back     alignment and structure
Probab=98.86  E-value=6.9e-09  Score=66.99  Aligned_cols=58  Identities=40%  Similarity=0.698  Sum_probs=47.9

Q ss_pred             CceEeecCCCCCCChhHHHHHHhhhcceEEeecHHHHHHHHhcCCCCCccccCCcccc
Q psy10051          2 NPGRKFEGTPFHPGNDRYWSIVEKYKVNQFYTAPTAIRTLMKYGEGPVQKHEVELDSN   59 (63)
Q Consensus         2 ~t~vl~~g~p~~~d~~~~~~~i~~~~vT~~~~~Pt~~~~l~~~~~~~~~~~dl~~l~~   59 (63)
                      ++++++++.|.+++++++|++|++++||+++++|++++.|++.+......+++++++.
T Consensus       331 ~t~v~~~~~~~~~~~~~~~~~i~~~~vt~~~~~Ps~~~~l~~~~~~~~~~~~l~sLr~  388 (663)
T 1ry2_A          331 CATLVFEGTPAYPNYSRYWDIIDEHKVTQFYVAPTALRLLKRAGDSYIENHSLKSLRC  388 (663)
T ss_dssp             SEEEEECSCTTSSCTTHHHHHHHHTTCSEEEECHHHHHHHTTSCTTSSSSCCCTTCCE
T ss_pred             CEEEEECCCCCCCCHHHHHHHHHHcCCCEEEecHHHHHHHHhcCccccccCCcCceEE
Confidence            5788999888778999999999999999999999999999987643234567776554



>1pg4_A Acetyl-COA synthetase; AMP-forming, adenylate-forming, thioester-forming, ligase; HET: COA PRX; 1.75A {Salmonella enterica} SCOP: e.23.1.1 PDB: 1pg3_A* 2p2f_A* 2p2b_A* 2p2q_A* 2p2j_A* 2p20_A* 2p2m_A* Back     alignment and structure
>2d1s_A Luciferase, luciferin 4-monooxygenase; alpha/beta, beta barrel, alpha+beta, riken structural genomics/proteomics initiative, RSGI; HET: SLU; 1.30A {Luciola cruciata} PDB: 2d1q_A* 2d1r_A* 2d1t_A* Back     alignment and structure
>3rix_A Luciferase, luciferin 4-monooxygenase; oxidoreductase, photoprotein, luminescence, aspulvinone, natural product extracts; HET: 923; 1.70A {Photinus pyralis} SCOP: e.23.1.1 PDB: 1ba3_A 1lci_A* 4e5d_A* 3ies_A* 3iep_A* 3ier_A* 4g36_A* 4g37_A* 3qya_A Back     alignment and structure
>3ni2_A 4-coumarate:COA ligase; 4CL, phenylpropanoid biosynthesis; HET: AYL EPE; 1.90A {Populus tomentosa} PDB: 3a9v_A* 3a9u_A* Back     alignment and structure
>3etc_A AMP-binding protein; adenylate-forming acyl-COA synthetase ligase, ligase; HET: PGE 1PE EPE; 2.10A {Methanosarcina acetivorans} Back     alignment and structure
>1t5h_X 4-chlorobenzoyl COA ligase; adenylate-forming coenzyme A ligase domain alternation confo change; 2.00A {Alcaligenes SP} SCOP: e.23.1.1 PDB: 1t5d_X 3cw9_A* 3cw8_X* 2qvz_X* 2qw0_X* 3dlp_X* 2qvx_X* 2qvy_X* Back     alignment and structure
>1mdb_A 2,3-dihydroxybenzoate-AMP ligase; adenylation domain, peptide synthetase, antibiotic biosynthesis, siderophore formation; HET: AMP DBH; 2.15A {Bacillus subtilis} SCOP: e.23.1.1 PDB: 1md9_A* 1mdf_A Back     alignment and structure
>3r44_A Fatty acyl COA synthetase FADD13 (fatty-acyl-COA synthetase); ligase; HET: HIS; 1.80A {Mycobacterium tuberculosis} PDB: 3t5c_A 3t5b_A Back     alignment and structure
>3o83_A Peptide arylation enzyme; ligase, adenylation of 2,3-dihydroxybenzoate and transfer to pantetheine cofactor of BASF; HET: IXN; 1.90A {Acinetobacter baumannii} SCOP: e.23.1.0 PDB: 3o82_A* 3o84_A* 3u16_A* 3u17_A* Back     alignment and structure
>3g7s_A Long-chain-fatty-acid--COA ligase (FADD-1); protein structure initiative, PSI-II, NYSGXRC, 11193J, structural genomics; 2.15A {Archaeoglobus fulgidus dsm 4304} Back     alignment and structure
>3tsy_A Fusion protein 4-coumarate--COA ligase 1, resvera synthase; transferase; 3.10A {Arabidospis thaliana} Back     alignment and structure
>1v25_A Long-chain-fatty-acid-COA synthetase; ligase, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.30A {Thermus thermophilus} SCOP: e.23.1.1 PDB: 1ult_A* 1v26_A* Back     alignment and structure
>3c5e_A Acyl-coenzyme A synthetase ACSM2A, mitochondrial; middle-chain acyl-COA synthetase, xenobiotic/medium-chain FA COA ligase; HET: ATP; 1.60A {Homo sapiens} PDB: 2vze_A 3b7w_A* 3day_A* 3eq6_A* 3eyn_A* 3gpc_A* 2wd9_A* Back     alignment and structure
>3ipl_A 2-succinylbenzoate--COA ligase; structural genomics, acyl-protein synthetase, PSI-2, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>3qov_A Phenylacetate-coenzyme A ligase; acetyl-COA synthetase-like, structural genomics, joint cente structural genomics, JCSG; HET: MSE ADP COA; 2.20A {Bacteroides thetaiotaomicron} PDB: 3s89_A* Back     alignment and structure
>3fce_A D-alanine--poly(phosphoribitol) ligase subunit 1; DLTA, AMP-forming domain, adenylation, D-alanine protein ligase, ATP complex; HET: ATP; 1.90A {Bacillus cereus} PDB: 3fcc_A* 3dhv_A* Back     alignment and structure
>3e7w_A D-alanine--poly(phosphoribitol) ligase subunit 1; DLTA, non-ribosomal peptide synthetase, NRPS, adenylation domain, D-alanylation; HET: AMP; 2.28A {Bacillus subtilis} PDB: 3e7x_A* Back     alignment and structure
>2y4o_A Phenylacetate-coenzyme A ligase; phenylacetic acid degradation pathway; HET: DLL; 1.90A {Burkholderia cenocepacia} Back     alignment and structure
>4gr5_A Non-ribosomal peptide synthetase; MBTH-like domain, adenylation domain, ligase, rossmann fold, binding; HET: APC TLA; 1.92A {Streptomyces lydicus} PDB: 4gr4_A Back     alignment and structure
>3rg2_A Enterobactin synthase component E (ENTE), 2,3-DIH dihydroxybenzoate synthetase, isochroismatase...; adenylate-forming enzymes, ANL superfamily; HET: SVS PNS; 3.10A {Escherichia coli} Back     alignment and structure
>4fuq_A Malonyl COA synthetase; ANL superfamily, methylma malonate, ligase; HET: MSE; 1.70A {Rhodopseudomonas palustris} PDB: 4fut_A* 4gxr_A* 4gxq_A* Back     alignment and structure
>2v7b_A Benzoate-coenzyme A ligase; benzoate oxidation, benzoate COA ligase; 1.84A {Burkholderia xenovorans} Back     alignment and structure
>2y27_A Phenylacetate-coenzyme A ligase; phenylacetic acid degradation pathway; HET: MSE PG4 ATP; 1.60A {Burkholderia cenocepacia} PDB: 2y4n_A* Back     alignment and structure
>4dg8_A PA1221; ANL superfamily, adenylation domain, peptidyl carrier protei ribosomal peptide synthetase, NRPS, valine adenylation, LIG; HET: AMP; 2.15A {Pseudomonas aeruginosa} PDB: 4dg9_A* Back     alignment and structure
>3ivr_A Putative long-chain-fatty-acid COA ligase; structural genomics, PSI-2, protein S initiative, fatty acid synthesis; HET: GOL; 2.00A {Rhodopseudomonas palustris} SCOP: e.23.1.0 Back     alignment and structure
>3l8c_A D-alanine--poly(phosphoribitol) ligase subunit 1; structural genomics, DLTA, ATP-binding, cytoplasm, nucleotide-binding; 2.41A {Streptococcus pyogenes serotype M6} PDB: 3lgx_A* Back     alignment and structure
>3kxw_A Saframycin MX1 synthetase B; fatty acid AMP ligase, SGX, acyl adenylate, structural genom 2, protein structure initiative; HET: 1ZZ; 1.85A {Legionella pneumophila subsp} PDB: 3lnv_A* Back     alignment and structure
>3hgu_A EHPF; phenazine, antibiotic, biosynthetic protein; 1.95A {Pantoea agglomerans} PDB: 3hgv_A 3l2k_A* Back     alignment and structure
>4gs5_A Acyl-COA synthetase (AMP-forming)/AMP-acid ligase protein; structural genomics, PSI-biology; 2.02A {Dyadobacter fermentans} Back     alignment and structure
>3t5a_A Long-chain-fatty-acid--AMP ligase FADD28; acetyl-COA synthetase like fold, AMP-binding; 2.05A {Mycobacterium tuberculosis} PDB: 3e53_A Back     alignment and structure
>3nyq_A Malonyl-COA ligase; A/B topology ababa sandwich beta-barrel adenylate-forming EN fold; HET: MCA AMP; 1.43A {Streptomyces coelicolor} PDB: 3nyr_A* Back     alignment and structure
>2vsq_A Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, TER module, phosphopantetheine; 2.60A {Bacillus subtilis} Back     alignment and structure
>1amu_A GRSA, gramicidin synthetase 1; peptide synthetase, adenylate forming; HET: PHE AMP; 1.90A {Brevibacillus brevis} SCOP: e.23.1.1 Back     alignment and structure
>3ite_A SIDN siderophore synthetase; ligase, non-ribosomal peptide synthesis, NRPS, sidna3, fungal, endophyte; HET: MSE; 2.00A {Neotyphodium lolii} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 63
d1pg4a_ 643 e.23.1.1 (A:) Acetyl-CoA synthetase {Salmonella en 4e-08
d1ry2a_ 640 e.23.1.1 (A:) Acetyl-CoA synthetase {Baker's yeast 1e-07
>d1pg4a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Salmonella enterica [TaxId: 28901]} Length = 643 Back     information, alignment and structure

class: Multi-domain proteins (alpha and beta)
fold: Acetyl-CoA synthetase-like
superfamily: Acetyl-CoA synthetase-like
family: Acetyl-CoA synthetase-like
domain: Acetyl-CoA synthetase
species: Salmonella enterica [TaxId: 28901]
 Score = 45.0 bits (106), Expect = 4e-08
 Identities = 21/47 (44%), Positives = 29/47 (61%)

Query: 7   FEGTPFHPGNDRYWSIVEKYKVNQFYTAPTAIRTLMKYGEGPVQKHE 53
           FEG P  P   R   +V+K++VN  YTAPTAIR LM  G+  ++  +
Sbjct: 326 FEGVPNWPTPARMCQVVDKHQVNILYTAPTAIRALMAEGDKAIEGTD 372


>d1ry2a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 640 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query63
d1pg4a_ 643 Acetyl-CoA synthetase {Salmonella enterica [TaxId: 98.99
d1ry2a_ 640 Acetyl-CoA synthetase {Baker's yeast (Saccharomyce 98.81
d1v25a_ 534 Long chain fatty acid-CoA ligase TT0168 {Thermus t 96.98
d1mdba_ 536 Dihydroxybenzoate-AMP ligase DhbE {Bacillus subtil 94.09
d3cw9a1 503 4-chlorobenzoyl CoA ligase {Alcaligenes sp. [TaxId 93.91
d1lcia_ 541 Luciferase {Firefly (Photinus pyralis) [TaxId: 705 93.38
>d1pg4a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
class: Multi-domain proteins (alpha and beta)
fold: Acetyl-CoA synthetase-like
superfamily: Acetyl-CoA synthetase-like
family: Acetyl-CoA synthetase-like
domain: Acetyl-CoA synthetase
species: Salmonella enterica [TaxId: 28901]
Probab=98.99  E-value=3.4e-10  Score=71.21  Aligned_cols=58  Identities=36%  Similarity=0.503  Sum_probs=49.1

Q ss_pred             CceEeecCCCCCCChhHHHHHHhhhcceEEeecHHHHHHHHhcCCCCCccccCCcccc
Q psy10051          2 NPGRKFEGTPFHPGNDRYWSIVEKYKVNQFYTAPTAIRTLMKYGEGPVQKHEVELDSN   59 (63)
Q Consensus         2 ~t~vl~~g~p~~~d~~~~~~~i~~~~vT~~~~~Pt~~~~l~~~~~~~~~~~dl~~l~~   59 (63)
                      +|+|+++|.|.+++++.+|++|++++||+++++|++++.|++.+......+|++++++
T Consensus       321 ~t~vl~~~~~~~~~~~~~~~~i~~~~vt~~~~~P~~l~~l~~~~~~~~~~~dl~sLr~  378 (643)
T d1pg4a_         321 ATTLMFEGVPNWPTPARMCQVVDKHQVNILYTAPTAIRALMAEGDKAIEGTDRSSLRI  378 (643)
T ss_dssp             CEEEEECSCTTSSSTTHHHHHHHHHTCSEEEECHHHHHHHHTTGGGGTTTCCCTTCCE
T ss_pred             CEEEEecCCCCCCCHHHHHHHHHHHCCcEEEehHHHHHHHHhCcchhccccCCCceEE
Confidence            5789999989889999999999999999999999999999987543235567777654



>d1ry2a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v25a_ e.23.1.1 (A:) Long chain fatty acid-CoA ligase TT0168 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mdba_ e.23.1.1 (A:) Dihydroxybenzoate-AMP ligase DhbE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3cw9a1 e.23.1.1 (A:1-503) 4-chlorobenzoyl CoA ligase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure
>d1lcia_ e.23.1.1 (A:) Luciferase {Firefly (Photinus pyralis) [TaxId: 7054]} Back     information, alignment and structure