Diaphorina citri psyllid: psy10057


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10
MGRKHPAPEPQLDEEPVGKKIRSEESLIPEQVFLSKMATPNVTFNVVVPNMTDKPEWKLNGQTLSLSLDLRTSVTALKSQIHDLIGMPAGKQKLHLDVS
cccccccccccccccccccccccccccccHHHHHHHcccccEEEEEEccccccccccccccEEEEEEEcccccHHHHHHHHHHHHccccccCEEEEEcc
***************************IPEQVFLSKMATPNVTFNVVVPNMTDKPEWKLNGQTLSLSLDLRTSVTALKSQIHDLIGMPAGKQ*L*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGRKHPAPEPQLDEEPVGKKIRSEESLIPEQVFLSKMATPNVTFNVVVPNMTDKPEWKLNGQTLSLSLDLRTSVTALKSQIHDLIGMPAGKQKLHLDVS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Splicing factor 3A subunit 1 Subunit of the splicing factor SF3A required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. Sequence independent binding of SF3A/SF3B complex upstream of the branch site is essential, it may anchor U2 snRNP to the pre-mRNA. May also be involved in the assembly of the 'E' complex.confidentQ8K4Z5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044428 [CC]nuclear partprobableGO:0005575, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044424, GO:0043227, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WE7, chain A
Confidence level:very confident
Coverage over the Query: 17-97
View the alignment between query and template
View the model in PyMOL