Diaphorina citri psyllid: psy10062

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-----

LPIWNYDGSSTYQSEGSNSDTFLHPVAIFKDPFRLGNNILMSHGVLGNSPNAAMNKTVLDKYLALPVPADKIQATYIWIDGTGEGIRAKDRTLTGVVKNVSGRPDQVYYLIMSHGVLGNSPNAAMNKTVLDKYLALPVPADKIQATYIWIDGTGEGIRAKCSQLPLLRKGPYYCGVGANKVYARDIVEAHYRACLYAGIEISGTNAEGPYYCGVGANKVYARDIVEAHYRACLYAGIEISGTNAEVMPSQWEFQDIAKCQDLPIWNYDGSSTYQSEMREDNGIIEIEKAIDKLSKQHLRHIQAYDPKQGKDNERRLTGKHETSSIHDFSAGVANRGASIRIPRDCAEQKKGYLEDRRVANRGASIRIPRDCAEQKKGYLEDRRPSSNCDPYSVTEALIRTCVLNE

ccccccccccccccccccccEEEEEEEECcccccccccEEEEEccccccccccccHHHHHHHHccccccccEEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccEEEEEEEcccccccccccccccccccccccccccccccEEEEEEccccccccccccccccccccccccEEECcccccHHHHHHHHHHHHHHHHccccEEECccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcHHHHHHHcccccccccccccccccccccccccCEEEcccccEEEEcccccccccccccccccccccccccccHHHHHHccccccccccccccccHHHHHHHHHHHcccc

LPIWNYDGSST*****SNSDTFLHPVAIFKDPFRLGNNILMSHGVLGNSPNAAMNKTVLDKYLALPVPADKIQATYIWIDGTGEGIRAKDRTLTGVVKNVSGRPDQVYYLIMSHGVLGNSPNAAMNKTVLDKYLALPVPADKIQATYIWIDGTGEGIRAKCSQLPLLRKGPYYCGVGANKVYARDIVEAHYRACLYAGIEISGTNAEGPYYCGVGANKVYARDIVEAHYRACLYAGIEISGTNAEVMPSQWEFQDIAKCQDLPIWNYDGSSTYQSEMREDNGIIEIEKAIDKLSKQHLRHIQAYDPKQGKDNERRLTGKHETSSIHDFSAGVANRGASIRIPRDCAEQKKGYLEDRRVANRGASIRIPRDCAEQKKGYLEDRRPSSNCDPYSVTEALIRTCVLNE

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Glutamine synthetase 1, mitochondrial		confident	P20477
Glutamine synthetase, chloroplastic/mitochondrial	The light-modulated chloroplast/mitochondrial enzyme, encoded by a nuclear gene and expressed primarily in leaves, is responsible for the reassimilation of the ammonia generated by photorespiration.	confident	Q43127
Glutamine synthetase	This enzyme has 2 functions: it catalyzes the production of glutamine and 4-aminobutanoate (gamma-aminobutyric acid, GABA), the latter in a pyridoxal phosphate-independent manner. When expressed in liver, it may be involved in detoxifying intramitochondrially generated ammonia.	confident	P16580

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0022626 [CC]	cytosolic ribosome	probable	GO:0005737, GO:0032991, GO:0005840, GO:0043232, GO:0005829, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0044445, GO:0044424, GO:0043228, GO:0005622, GO:0043226
GO:0043204 [CC]	perikaryon	probable	GO:0044464, GO:0044297, GO:0005623, GO:0005575, GO:0097458, GO:0043025
GO:0043679 [CC]	axon terminus	probable	GO:0044306, GO:0044463, GO:0044464, GO:0005623, GO:0030424, GO:0005575, GO:0097458, GO:0043005, GO:0033267, GO:0042995
GO:0030145 [MF]	manganese ion binding	probable	GO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0000287 [MF]	magnesium ion binding	probable	GO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0008283 [BP]	cell proliferation	probable	GO:0008150, GO:0044699
GO:0016020 [CC]	membrane	probable	GO:0005575
GO:0043234 [CC]	protein complex	probable	GO:0005575, GO:0032991
GO:0004356 [MF]	glutamate-ammonia ligase activity	probable	GO:0003824, GO:0016211, GO:0016880, GO:0016879, GO:0003674, GO:0016874
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0005811 [CC]	lipid particle	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0006995 [BP]	cellular response to nitrogen starvation	probable	GO:0009605, GO:0051716, GO:0031669, GO:0009267, GO:0043562, GO:0050896, GO:0009987, GO:0031668, GO:0031667, GO:0008150, GO:0006950, GO:0071496, GO:0044763, GO:0044699, GO:0042594, GO:0007154, GO:0033554, GO:0009991
GO:0016595 [MF]	glutamate binding	probable	GO:0043168, GO:0031406, GO:0043167, GO:0003674, GO:0005488, GO:0016597
GO:0005524 [MF]	ATP binding	probable	GO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0009507 [CC]	chloroplast	probable	GO:0005737, GO:0009536, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0006542 [BP]	glutamine biosynthetic process	probable	GO:0044283, GO:0019752, GO:0044249, GO:0006807, GO:0044281, GO:0009064, GO:1901576, GO:0044710, GO:0044711, GO:0006520, GO:0006541, GO:0071704, GO:1901605, GO:1901607, GO:0044238, GO:0009987, GO:0009058, GO:0008150, GO:0008152, GO:0043436, GO:0008652, GO:1901564, GO:1901566, GO:0006082, GO:0046394, GO:0016053, GO:0044237, GO:0009084
GO:0005791 [CC]	rough endoplasmic reticulum	probable	GO:0005737, GO:0005783, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226, GO:0043231
GO:0065007 [BP]	biological regulation	probable	GO:0008150
GO:0006536 [BP]	glutamate metabolic process	probable	GO:0043648, GO:0044710, GO:0009987, GO:1901564, GO:0006082, GO:0044238, GO:0044237, GO:0006520, GO:0019752, GO:0071704, GO:0006807, GO:0008150, GO:0044281, GO:0008152, GO:0009064, GO:0043436, GO:1901605
GO:0051260 [BP]	protein homooligomerization	probable	GO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
6.-.-.-	Ligases.	probable
6.3.-.-	Forming carbon-nitrogen bonds.	probable
6.3.1.-	Acid--ammonia (or amide) ligases (amide synthases).	probable
6.3.1.2	Glutamate--ammonia ligase.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2OJW, chain A
Confidence level:very confident
Coverage over the Query: 50-344,371-405
View the alignment between query and template
View the model in PyMOL

Template: 2OJW, chain A
Confidence level:very confident
Coverage over the Query: 1-46,61-71,87-106,133-252
View the alignment between query and template
View the model in PyMOL

Template: 2UU7, chain A
Confidence level:very confident
Coverage over the Query: 48-141,157-352,379-405
View the alignment between query and template
View the model in PyMOL