Diaphorina citri psyllid: psy10063


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890----
MKRPILSSPLSVDRLNSMSPAARKLATVVVKARAFFSLRDTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTSTSTSTSTSTNNQHQHQHQQQQLIHFLSSSPILSSPLSVDRLNSMSPAARKLATNAEPVVKMQVTDQSAKITSLLWGNLDQYIITGHAKGDICTWDLRMGRELESISGHAKEPINDMQFSKDATMFITASHSQAVEPINDMQFSKDATMFITASKDHTAKLFTTHDRQLLKTYTTERPVNSAALSPILPHVVLGGGQEAREVTTTSTKVGKFDARFYHLIFEEEFARIKGHFGPINSLAFHPDGKSYASGGEDGFLISNTLSNGLDISEGSFTSSSTQQPDGLVYPSQGGHIHSLSSHSTSSTDTGGVFSGSRVDDSGVELTKDEQIEMARNRMSINHSGTRLHVNPFDEQQSVELTKDEQIEMARNRMSINHSGTRLHVNPFDEQQSVDASPLMTWGHIEGTPFKLDGSDTPILAGPVDIGFKMPEPPKREKLALALADKVSERYRDRKNKATAGFLLSCPDFLFDFDTTREVTTTSTKVGKFDARFYHLIFEEEFARIKGHFGPINSLAFHPDGKSYASGGEDGFVRLHTFDQAYFDYTFDISEEFHCQPS
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEECcccccccccccccccccccccHHHHcccccccCEEEEEEcccccEEEEEEcccccEEEEEcccccEEEEEcccccEEccccccccccccccccccccccHHHcccccccccEEEEEccccccEEEEEEcccccEEEEcccccEEEEEcccccccccccccccccEEEcccccccEEEEcccccccCEEEEEEEEHHHHcccccccccccEEEEEccccccccccccccEEEEEEccccccccccccccccccccccCEcccccccEEEEccccccccccccccccccccccccccccHHHHHHHHHHHHccccccEEEEccccccccccccHHHHHHHHccEEEEEEcccEEECccccccccccccccccccccccccEEEcccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccCEEccccccCEEEcccccccCEEEEEEEEHHHHcccccccccccEEEEEccccccccccccccEEEEEEEcccccccccccccccccccc
************************LATVVVKARAFFSL**************************************************************************************************************************************************************************************************************************************************************************TNTNTN*********************NTNTNTNTNTSTSTSTSTSTNNQHQHQHQQQQLIHFLSSSPILSSPLSVDRLNSMSPAARKLATNAEPVVKMQVTDQSAKITSLLWGNLDQYIITGHAKGDICTWDLRMGRELESISGHAKEPINDMQFSKDATMFITASHSQAVEPINDMQFSKDATMFITASKDHTAKLFTTHDRQLLKTYTTERPVNSAALSPILPHVVLGGGQEAREVTTTSTKVGKFDARFYHLIFEEEFARIKGHFGPINSLAFHPDGKSYASGGEDGFLISNTLSNGLDISEGSFTSSSTQQPDGLVYPSQGGHIHSLSSHSTSSTDTGGVFSGSRVDDSGVELTKDEQIEMARNRMSINHSGTRLHVNPFDEQQSV****DEQIEMARNRMSINHSGTRLHVNPFDEQQSVDASPLMTWGHIEGTPFKLDGSDTPILAGPVDIGFKMPEPPKREKLALALADKVSERYRDRKNKATAGFLLSCPDFLFDFDTTREVTTTSTKVGKFDARFYHLIFEEEFARIKGHFGPINSLAFHPDGKSYASGGEDGFVRLHTFDQAYFDYTFDISEEF*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKRPILSSPLSVDRLNSMSPAARKLATVVVKARAFFSLRDTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTNTSTSTSTSTSTNNQHQHQHQQQQLIHFLSSSPILSSPLSVDRLNSMSPAARKLATNAEPVVKMQVTDQSAKITSLLWGNLDQYIITGHAKGDICTWDLRMGRELESISGHAKEPINDMQFSKDATMFITASHSQAVEPINDMQFSKDATMFITASKDHTAKLFTTHDRQLLKTYTTERPVNSAALSPILPHVVLGGGQEAREVTTTSTKVGKFDARFYHLIFEEEFARIKGHFGPINSLAFHPDGKSYASGGEDGFLISNTLSNGLDISEGSFTSSSTQQPDGLVYPSQGGHIHSLSSHSTSSTDTGGVFSGSRVDDSGVELTKDEQIEMARNRMSINHSGTRLHVNPFDEQQSVELTKDEQIEMARNRMSINHSGTRLHVNPFDEQQSVDASPLMTWGHIEGTPFKLDGSDTPILAGPVDIGFKMPEPPKREKLALALADKVSERYRDRKNKATAGFLLSCPDFLFDFDTTREVTTTSTKVGKFDARFYHLIFEEEFARIKGHFGPINSLAFHPDGKSYASGGEDGFVRLHTFDQAYFDYTFDISEEFHCQPS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Eukaryotic translation initiation factor 3 subunit I Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome.confidentQ7PP77
Eukaryotic translation initiation factor 3 subunit I Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S preinitiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of posttermination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation.confidentQ13347
Eukaryotic translation initiation factor 3 subunit I Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome.confidentQ5EBE8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005852 [CC]eukaryotic translation initiation factor 3 complexprobableGO:0043234, GO:0005737, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3ZWL, chain B
Confidence level:very confident
Coverage over the Query: 399-452,478-608,753-888
View the alignment between query and template
View the model in PyMOL
Template: 2YMU, chain A
Confidence level:very confident
Coverage over the Query: 376-540,555-873
View the alignment between query and template
View the model in PyMOL
Template: 3S94, chain A
Confidence level:probable
Coverage over the Query: 478-542,555-692,708-878
View the alignment between query and template
View the model in PyMOL