Diaphorina citri psyllid: psy10094


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------
MFDHIPVGVGSKGIIPMNARDLEEALEMGMDWSLREGYIWAEDKEHCEEYGRMLNADPSKVSMRAKKRGLPQLGTLGAGNHYAEIQIVDEIYDKWAASKMGIEDVGQVCVMIHSGSRGFGHQVATGKCEKITCMAYVFPDALVQMEKAMKRDNIETNDRQLACARINSKEGQDYLKSMAAAANFAWVNRSSMTFLCRQAFAKQFNTTPDDLDMHVIYDVSHNIAKTEEHMVDGKQKTLLVHRKVSEPSHPGVSRNKK
ccccccccccccccccccHHHHHHHHHcccccHHcccccccccHHHHHHHcccccccccHHcHHHHHcccccccccccccCEEEEEEEEEEccHHHHHHcccccccEEEEEEEcccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEcccEEEccEEEEccccEEEEEEcccccccccccccccc
MFDHIPVGVGSKGIIPMNARDLEEALEMGMDWSLREGYIWAEDKEHCEEYGRMLNADPSKVSMRAKKRGLPQLGTLGAGNHYAEIQIVDEIYDKWAASKMGIEDVGQVCVMIHSGSRGFGHQVATGKCEKITCMAYVFPDALVQMEKAMKRDNIETNDRQLACARINSKEGQDYLKSMAAAANFAWVNRSSMTFLCRQAFAKQFNTTPDDLDMHVIYDVSHNIAKTEEHMVDGKQKTLLVHRKVSEPSHP*VS****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFDHIPVGVGSKGIIPMNARDLEEALEMGMDWSLREGYIWAEDKEHCEEYGRMLNADPSKVSMRAKKRGLPQLGTLGAGNHYAEIQIVDEIYDKWAASKMGIEDVGQVCVMIHSGSRGFGHQVATGKCEKITCMAYVFPDALVQMEKAMKRDNIETNDRQLACARINSKEGQDYLKSMAAAANFAWVNRSSMTFLCRQAFAKQFNTTPDDLDMHVIYDVSHNIAKTEEHMVDGKQKTLLVHRKVSEPSHPGVSRNKK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
tRNA-splicing ligase RtcB homolog Catalytic subunit of the tRNA-splicing ligase complex that acts by directly joining spliced tRNA halves to mature-sized tRNAs by incorporating the precursor-derived splice junction phosphate into the mature tRNA as a canonical 3',5'-phosphodiester. May act as a RNA ligase with broad substrate specificity, and may function toward other RNAs.confidentC1E9Y5
tRNA-splicing ligase RtcB homolog Catalytic subunit of the tRNA-splicing ligase complex that acts by directly joining spliced tRNA halves to mature-sized tRNAs by incorporating the precursor-derived splice junction phosphate into the mature tRNA as a canonical 3',5'-phosphodiester. May act as a RNA ligase with broad substrate specificity, and may function toward other RNAs.confidentQ561P3
tRNA-splicing ligase RtcB homolog Catalytic subunit of the tRNA-splicing ligase complex that acts by directly joining spliced tRNA halves to mature-sized tRNAs by incorporating the precursor-derived splice junction phosphate into the mature tRNA as a canonical 3',5'-phosphodiester. May act as a RNA ligase with broad substrate specificity, and may function toward other RNAs.confidentQ19PY3

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006388 [BP]tRNA splicing, via endonucleolytic cleavage and ligationprobableGO:0090304, GO:0034641, GO:0006807, GO:0008033, GO:0034660, GO:1901360, GO:0006139, GO:0044260, GO:0071704, GO:0010467, GO:0008380, GO:0034470, GO:0009987, GO:0006725, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0044238, GO:0000394, GO:0044237, GO:0043170, GO:0006399, GO:0006396
GO:0017166 [MF]vinculin bindingprobableGO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0072669 [CC]tRNA-splicing ligase complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0003972 [MF]RNA ligase (ATP) activityprobableGO:0003824, GO:0003674, GO:0016886, GO:0016874, GO:0008452
GO:0046872 [MF]metal ion bindingprobableGO:0043169, GO:0003674, GO:0005488, GO:0043167
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0001701 [BP]in utero embryonic developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0009792, GO:0008150, GO:0043009, GO:0007275, GO:0044699
GO:0001890 [BP]placenta developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0022008 [BP]neurogenesisprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0009987, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2EPG, chain A
Confidence level:very confident
Coverage over the Query: 1-125,140-257
View the alignment between query and template
View the model in PyMOL