Diaphorina citri psyllid: psy1009


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MLLTLIEGMVEGTNQRGRPRKEYIRDVETAMGYQNYMELKRLAQNRNEWRRRTKLLLPTNRQIFQLISSVHCALCFRHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFSKQRSVVG
cHHHHHHcccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHcc
*LLTLIE***************YIRDVETAMGYQNYMELKRLAQNRNEWRRRTKLLLPTNR*****ISSVHCALCFRHPLFPLLALIFEKCELATCT**************ESFNEDIAVFSKQR****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLLTLIEGMVEGTNQRGRPRKEYIRDVETAMGYQNYMELKRLAQNRNEWRRRTKLLLPTNRQIFQLISSVHCALCFRHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFSKQRSVVG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Homeobox protein Meis1 Acts as a transcriptional regulator of PAX6. Also acts as a transcriptional activator of PF4 in complex with PBX1 or PBX2. Required for hematopoiesis, megakaryocyte lineage development and vascular patterning. May function as a cofactor for HOXA7 and HOXA9 in the induction of myeloid leukemias.confidentQ60954
Homeobox protein Meis1 Acts as a transcriptional regulator of PAX6. Acts as a transcriptional activator of PF4 in complex with PBX1 or PBX2. Required for hematopoiesis, megakaryocyte lineage development and vascular patterning. May function as a cofactor for HOXA7 and HOXA9 in the induction of myeloid leukemias.confidentO00470

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0003705 [MF]RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activityprobableGO:0003700, GO:0003674, GO:0001071, GO:0000981
GO:0005667 [CC]transcription factor complexprobableGO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0045638 [BP]negative regulation of myeloid cell differentiationprobableGO:0051093, GO:0050793, GO:0050794, GO:0050789, GO:0045596, GO:0045595, GO:0065007, GO:2000026, GO:0008150, GO:0051239, GO:0048519, GO:0002682, GO:0045637, GO:0048523
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488
GO:0043565 [MF]sequence-specific DNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0002089 [BP]lens morphogenesis in camera-type eyeprobableGO:0032502, GO:0032501, GO:0009887, GO:0048856, GO:0044707, GO:0007423, GO:0048592, GO:0048593, GO:0044767, GO:0048513, GO:0001654, GO:0048731, GO:0002088, GO:0008150, GO:0009653, GO:0043010, GO:0007275, GO:0044699
GO:0045665 [BP]negative regulation of neuron differentiationprobableGO:0030154, GO:0050789, GO:0044699, GO:0050767, GO:0048869, GO:0060284, GO:0007275, GO:0045664, GO:0065007, GO:0048519, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045596, GO:0045595, GO:0008150, GO:0051239, GO:0022008, GO:0051093, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0044763, GO:0051960, GO:2000026, GO:0048731, GO:0048523
GO:0046982 [MF]protein heterodimerization activityprobableGO:0046983, GO:0003674, GO:0005488, GO:0005515
GO:0001525 [BP]angiogenesisprobableGO:0032502, GO:0032501, GO:0044707, GO:0001568, GO:0048856, GO:0001944, GO:0044767, GO:0072359, GO:0072358, GO:0048514, GO:0048646, GO:0048731, GO:0008150, GO:0009653, GO:0007275, GO:0044699
GO:0006355 [BP]regulation of transcription, DNA-dependentprobableGO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0060216 [BP]definitive hemopoiesisprobableGO:0032502, GO:0002376, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0030097, GO:0048534, GO:0007275, GO:0044699, GO:0002520
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
2ezd, chain Aprobable Alignment | Template Structure