Diaphorina citri psyllid: psy10102


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80------
KVQVLWTFSIYLESVAILPQLFLVSKTGEAESITSHYLFALGAYRALYLLNWVYRYYSEDYLDLIAIVAGVVQTALYCDFFYLYIT
cEEEEEHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHEEEEEEc
KVQVLWTFSIYLESVAILPQLFLVSKTGEAESITSHYLFALGAYRALYLLNWVYRYYSEDYLDLIAIVAGVVQTALYCDFFYLYIT
xxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
KVQVLWTFSIYLESVAILPQLFLVSKTGEAESITSHYLFALGAYRALYLLNWVYRYYSEDYLDLIAIVAGVVQTALYCDFFYLYIT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
ER lumen protein retaining receptor 1 Required for the retention of luminal endoplasmic reticulum proteins. Determines the specificity of the luminal ER protein retention system. Also required for normal vesicular traffic through the Golgi. This receptor recognizes K-D-E-L.confidentQ99JH8
ER lumen protein retaining receptor 1 Required for the retention of luminal endoplasmic reticulum proteins. Determines the specificity of the luminal ER protein retention system. Also required for normal vesicular traffic through the Golgi. This receptor recognizes K-D-E-L.confidentP33946
ER lumen protein retaining receptor Required for the retention of luminal endoplasmic reticulum proteins. Determines the specificity of the luminal ER protein retention system. Also required for normal vesicular traffic through the Golgi.confidentP48583

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043231 [CC]intracellular membrane-bounded organelleconfidentGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0044444 [CC]cytoplasmic partconfidentGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005793 [CC]endoplasmic reticulum-Golgi intermediate compartmentprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005801 [CC]cis-Golgi networkprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0030176 [CC]integral to endoplasmic reticulum membraneprobableGO:0005783, GO:0005789, GO:0042175, GO:0043229, GO:0031301, GO:0031300, GO:0043227, GO:0031227, GO:0031224, GO:0005737, GO:0044446, GO:0031090, GO:0016021, GO:0016020, GO:0043226, GO:0044432, GO:0012505, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044425, GO:0044422
GO:0006886 [BP]intracellular protein transportprobableGO:0033036, GO:0034613, GO:0046907, GO:0070727, GO:0006810, GO:0045184, GO:0008104, GO:0044763, GO:0044699, GO:0071702, GO:0015031, GO:0008150, GO:0009987, GO:0051234, GO:0051179, GO:0051649, GO:0051641
GO:0006621 [BP]protein retention in ER lumenprobableGO:0033036, GO:0070972, GO:0032507, GO:0045185, GO:0035437, GO:0070727, GO:0009987, GO:0034613, GO:0065007, GO:0072595, GO:0008104, GO:0044763, GO:0033365, GO:0008150, GO:0051235, GO:0065008, GO:0051651, GO:0051179, GO:0044699, GO:0051641
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0006987 [BP]activation of signaling protein activity involved in unfolded protein responseprobableGO:0032069, GO:0048522, GO:0019220, GO:0080090, GO:0019222, GO:0033674, GO:0051246, GO:0031325, GO:0031323, GO:0023052, GO:0007165, GO:0070887, GO:0042221, GO:0050789, GO:0043085, GO:0009893, GO:0006984, GO:0051716, GO:0006986, GO:0051347, GO:0010604, GO:0051345, GO:0010562, GO:0043549, GO:0034976, GO:0051247, GO:0019219, GO:0071310, GO:0032270, GO:0044699, GO:0044093, GO:0031399, GO:0048518, GO:0065007, GO:0065009, GO:0042325, GO:0050790, GO:0045937, GO:0060255, GO:0045859, GO:0032075, GO:0051174, GO:0006950, GO:0032268, GO:0044763, GO:0051171, GO:0007154, GO:0050794, GO:0010033, GO:0051336, GO:0044700, GO:0042327, GO:0045860, GO:0030968, GO:0050896, GO:0031401, GO:0051338, GO:0035967, GO:0035966, GO:0033554, GO:0008150, GO:0009987, GO:0001932, GO:0001934, GO:0034620
GO:0048193 [BP]Golgi vesicle transportprobableGO:0009987, GO:0016192, GO:0046907, GO:0006810, GO:0044765, GO:0008150, GO:0051649, GO:0044763, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0005046 [MF]KDEL sequence bindingprobableGO:0042277, GO:0005048, GO:0033218, GO:0003674, GO:0005488, GO:0046923

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted