Diaphorina citri psyllid: psy10105


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------
MAYTSPETKTLRPELQLFTQVPIQVNISSTKVPALQSRRQLCGIDKQVIQVSNLTAVRYGAGYDLAARRKNATRESTATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWEPKNKTDDDDDAIISDCDEKDKDDLMMDEEKMKQHHRMVKGHFPHMYVTKYETLPPTNLQGLTPKG
ccccccccccccccccccccccccccccccccccccccccccccccccHHcccHHHHHcccccccccccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccc
**************LQLFTQVPIQVNISSTKVPALQSRRQLCGIDKQVIQVSNLTAVRYGAGYDLAARRK*****STATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRL****************************************************HMYVTKYE**************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAYTSPETKTLRPELQLFTQVPIQVNISSTKVPALQSRRQLCGIDKQVIQVSNLTAVRYGAGYDLAARRKNATRESTATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWEPKNKTDDDDDAIISDCDEKDKDDLMMDEEKMKQHHRMVKGHFPHMYVTKYETLPPTNLQGLTPKG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Homeobox protein araucan Controls proneural and vein forming genes. Positive transcriptional controler of AC-SC (achaete-scute). May act as an activator that interacts with the transcriptional complex assembled on the AC and SC promoters and participates in transcription initiation.very confidentQ24248
Iroquois-class homeodomain protein irx-5 Acts partially redundantly with other irx members in neural patterning. Required for formation of the posterior forebrain, midbrain, hindbrain, and to a lesser extent, spinal cord. Patterns the neuroectoderm in both the anterior/posterior and dorsal/ventral axes. Does not appear to play a role in pronephros kidney development.confidentQ4LDQ3
Iroquois-class homeodomain protein IRX-6 confidentP78412

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0003705 [MF]RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activityconfidentGO:0003700, GO:0003674, GO:0001071, GO:0000981
GO:0045317 [BP]equator specificationprobableGO:0048749, GO:0032501, GO:0007163, GO:0007164, GO:0009653, GO:0007275, GO:0044699, GO:0002009, GO:0001745, GO:0008150, GO:0048513, GO:0048729, GO:0048646, GO:0032502, GO:0009887, GO:0060429, GO:0042067, GO:0048592, GO:0009987, GO:0009888, GO:0044767, GO:0001738, GO:0001654, GO:0048731, GO:0001736, GO:0048859, GO:0044707, GO:0007423, GO:0048856, GO:0044763
GO:0042693 [BP]muscle cell fate commitmentprobableGO:0032502, GO:0045165, GO:0048869, GO:0030154, GO:0044767, GO:0044763, GO:0061061, GO:0008150, GO:0009987, GO:0042692, GO:0044699, GO:0048856
GO:0043565 [MF]sequence-specific DNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0007474 [BP]imaginal disc-derived wing vein specificationprobableGO:0048563, GO:0048569, GO:0035107, GO:0009887, GO:0035220, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0009653, GO:0007275, GO:0044699, GO:0007389, GO:0007472, GO:0007552, GO:0007476, GO:0048513, GO:0032502, GO:0048707, GO:0009886, GO:0035114, GO:0008150, GO:0003002, GO:0044767, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0048731, GO:0048736, GO:0048737
GO:0006911 [BP]phagocytosis, engulfmentprobableGO:0009987, GO:0006909, GO:0016192, GO:0016044, GO:0071840, GO:0006810, GO:0010324, GO:0008150, GO:0061024, GO:0044765, GO:0044763, GO:0016043, GO:0006897, GO:0051234, GO:0051179, GO:0044699
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0035310 [BP]notum cell fate specificationprobableGO:0060573, GO:0030154, GO:0035220, GO:0007275, GO:0044699, GO:0007389, GO:0048869, GO:0001708, GO:0008150, GO:0048513, GO:0032502, GO:0032501, GO:0009987, GO:0044767, GO:0060581, GO:0003002, GO:0035309, GO:0045165, GO:0044707, GO:0007444, GO:0048856, GO:0044763, GO:0048731
GO:0072086 [BP]specification of loop of Henle identityprobableGO:0048598, GO:0016331, GO:0061326, GO:0061004, GO:0009887, GO:0035148, GO:0009790, GO:0072175, GO:0072078, GO:0072079, GO:0035282, GO:0009653, GO:0007275, GO:0044699, GO:0007389, GO:0001822, GO:0072073, GO:0048513, GO:0072070, GO:0048729, GO:0060562, GO:0048646, GO:0032502, GO:0061333, GO:0032501, GO:0035239, GO:0002009, GO:0060429, GO:0009888, GO:0044767, GO:0072009, GO:0008150, GO:0003002, GO:0060993, GO:0072001, GO:0072006, GO:0072048, GO:0001838, GO:0072047, GO:0009954, GO:0044707, GO:0007379, GO:0072028, GO:0048856, GO:0035295, GO:0072081, GO:0072080, GO:0048731, GO:0072088, GO:0001655
GO:0006352 [BP]DNA-dependent transcription, initiationprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0019438
GO:0072272 [BP]proximal/distal pattern formation involved in metanephric nephron developmentprobableGO:0061004, GO:0072268, GO:0007275, GO:0044699, GO:0007389, GO:0001822, GO:0048513, GO:0032502, GO:0032501, GO:0072047, GO:0008150, GO:0001655, GO:0001656, GO:0072001, GO:0072006, GO:0072048, GO:0044767, GO:0009954, GO:0044707, GO:0072210, GO:0048856, GO:0048731, GO:0003002
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005667 [CC]transcription factor complexprobableGO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2DMN, chain A
Confidence level:very confident
Coverage over the Query: 62-127
View the alignment between query and template
View the model in PyMOL
Template: 2XSD, chain C
Confidence level:confident
Coverage over the Query: 30-53,72-127
View the alignment between query and template
View the model in PyMOL