Psyllid ID: psy10105

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------
MAYTSPETKTLRPELQLFTQVPIQVNISSTKVPALQSRRQLCGIDKQVIQVSNLTAVRYGAGYDLAARRKNATRESTATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWEPKNKTDDDDDAIISDCDEKDKDDLMMDEEKMKQHHRMVKGHFPHMYVTKYETLPPTNLQGLTPKG
cccccccccccccccccccccccccccccccccccccccccccccccHHHcccHHHHHcccccccccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccc
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHcccHHHcccccccccHHHHHHccccccccccccc
maytspetktlrpelqlftqvpiqvnisstkvpalqsrrqlcgidkqviQVSNLTAVRYGAGYDLAARRKNATRESTATLKAWLNehkknpyptkgEKIMLAIITKMTLTQVSTWFANARRRLKKEnkmtwepknktdddddaiisdcdekdkddlmMDEEKMKQHHRmvkghfphmyvtkyetlpptnlqgltpkg
maytspetktlrpelqlftqVPIQVNISSTKVPALQSRRQLCgidkqviqvsnlTAVRYGAGydlaarrknaTRESTATLKAwlnehkknpyptkGEKIMLAIITKMTLTQVSTWFANARRrlkkenkmtwepknktdddddaiisdCDEKDKDDLMMDEEKMKQHHRMVKGHFPHMYVTKyetlpptnlqgltpkg
MAYTSPETKTLRPELQLFTQVPIQVNISSTKVPALQSRRQLCGIDKQVIQVSNLTAVRYGAGYDLAARRKNATRESTATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWEPKNKTdddddaiisdcdekdkddlmmdeekmkQHHRMVKGHFPHMYVTKYETLPPTNLQGLTPKG
**************LQLFTQVPIQVNISSTKVPALQSRRQLCGIDKQVIQVSNLTAVRYGAGYDLAARRK******TATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANAR***************************************************GHFPHMYVTKYE**************
***************************************************************************STATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRL**************************************************************************
**********LRPELQLFTQVPIQVNISSTKVPALQSRRQLCGIDKQVIQVSNLTAVRYGAGYDLAARRKNATRESTATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWEPKNKTDDDDDAIISDCDEKDKDDLMMDEEKMKQHHRMVKGHFPHMYVTKYETLPPTNLQGLTPKG
****SPETKTLRPELQLFTQVPIQVNISSTKVPALQSRRQLCGIDKQVIQVSNLTAVRYGAGYDLAARRKNATRESTATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWE*******************************************HMYVTKYETLPPTNLQGL****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAYTSPETKTLRPELQLFTQVPIQVNISSTKVPALQSRRQLCGIDKQVIQVSNLTAVRYGAGYDLAARRKNATRESTATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWEPKNKTDDDDDAIISDCDEKDKDDLMMDEEKMKQHHRMVKGHFPHMYVTKYETLPPTNLQGLTPKG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query197 2.2.26 [Sep-21-2011]
Q24248 717 Homeobox protein araucan yes N/A 0.492 0.135 0.938 2e-41
P54269 693 Homeobox protein caupolic no N/A 0.517 0.147 0.854 1e-40
P78412 446 Iroquois-class homeodomai yes N/A 0.436 0.192 0.816 4e-35
Q9ER75 438 Iroquois-class homeodomai yes N/A 0.512 0.230 0.678 6e-35
Q9JKQ4 484 Iroquois-class homeodomai no N/A 0.507 0.206 0.7 9e-35
Q4LDQ3 482 Iroquois-class homeodomai yes N/A 0.522 0.213 0.708 2e-34
P78411 483 Iroquois-class homeodomai no N/A 0.507 0.207 0.7 2e-34
Q9YGS0 485 Iroquois-class homeodomai yes N/A 0.416 0.169 0.831 2e-34
Q90XW6 496 Iroquois-class homeodomai N/A N/A 0.416 0.165 0.819 5e-34
Q9QY61 515 Iroquois-class homeodomai no N/A 0.416 0.159 0.819 5e-34
>sp|Q24248|ARA_DROME Homeobox protein araucan OS=Drosophila melanogaster GN=ara PE=1 SV=2 Back     alignment and function desciption
 Score =  169 bits (427), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 92/98 (93%), Positives = 96/98 (97%), Gaps = 1/98 (1%)

Query: 59  YGAGYDLAARRKNATRESTATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFAN 118
           YGA YDLAARRKNATRESTATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFAN
Sbjct: 249 YGASYDLAARRKNATRESTATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFAN 308

Query: 119 ARRRLKKENKMTWEPKNKTDDDDDAIISDCDEKDKDDL 156
           ARRRLKKENKMTWEPKN+TDDDDDA++SD DEKDK+DL
Sbjct: 309 ARRRLKKENKMTWEPKNRTDDDDDALVSD-DEKDKEDL 345
Controls proneural and vein forming genes. Positive transcriptional controler of AC-SC (achaete-scute). May act as an activator that interacts with the transcriptional complex assembled on the AC and SC promoters and participates in transcription initiation.
Drosophila melanogaster (taxid: 7227)
>sp|P54269|CAUP_DROME Homeobox protein caupolican OS=Drosophila melanogaster GN=caup PE=2 SV=2 Back     alignment and function description
>sp|P78412|IRX6_HUMAN Iroquois-class homeodomain protein IRX-6 OS=Homo sapiens GN=IRX6 PE=2 SV=3 Back     alignment and function description
>sp|Q9ER75|IRX6_MOUSE Iroquois-class homeodomain protein IRX-6 OS=Mus musculus GN=Irx6 PE=2 SV=2 Back     alignment and function description
>sp|Q9JKQ4|IRX5_MOUSE Iroquois-class homeodomain protein IRX-5 OS=Mus musculus GN=Irx5 PE=2 SV=1 Back     alignment and function description
>sp|Q4LDQ3|IRX5_XENTR Iroquois-class homeodomain protein irx-5 OS=Xenopus tropicalis GN=irx5 PE=2 SV=1 Back     alignment and function description
>sp|P78411|IRX5_HUMAN Iroquois-class homeodomain protein IRX-5 OS=Homo sapiens GN=IRX5 PE=1 SV=3 Back     alignment and function description
>sp|Q9YGS0|IRX4_CHICK Iroquois-class homeodomain protein IRX-4 OS=Gallus gallus GN=IRX4 PE=2 SV=1 Back     alignment and function description
>sp|Q90XW6|IRX4A_XENLA Iroquois-class homeodomain protein irx-4-A OS=Xenopus laevis GN=irx4-a PE=2 SV=1 Back     alignment and function description
>sp|Q9QY61|IRX4_MOUSE Iroquois-class homeodomain protein IRX-4 OS=Mus musculus GN=Irx4 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query197
357607497 456 putative iroquois-like protein [Danaus p 0.604 0.260 0.747 1e-46
328718930 585 PREDICTED: hypothetical protein LOC10016 0.563 0.189 0.858 1e-45
307197225 670 Homeobox protein araucan [Harpegnathos s 0.548 0.161 0.880 2e-45
340716548 653 PREDICTED: homeobox protein caupolican-l 0.548 0.165 0.871 4e-45
332024321 643 Homeobox protein araucan [Acromyrmex ech 0.538 0.164 0.887 5e-45
345484618 725 PREDICTED: homeobox protein caupolican-l 0.553 0.150 0.863 9e-45
340716546 674 PREDICTED: homeobox protein caupolican-l 0.548 0.160 0.871 9e-45
110760661 677 PREDICTED: homeobox protein araucan-like 0.548 0.159 0.871 1e-44
383860361 679 PREDICTED: homeobox protein caupolican-l 0.548 0.159 0.871 1e-44
350404412 624 PREDICTED: homeobox protein caupolican-l 0.548 0.173 0.871 1e-44
>gi|357607497|gb|EHJ65536.1| putative iroquois-like protein [Danaus plexippus] Back     alignment and taxonomy information
 Score =  191 bits (485), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 89/119 (74%), Positives = 104/119 (87%)

Query: 54  LTAVRYGAGYDLAARRKNATRESTATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVS 113
           L A  YGAGYDLAARRKNATRESTATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVS
Sbjct: 176 LAAYGYGAGYDLAARRKNATRESTATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVS 235

Query: 114 TWFANARRRLKKENKMTWEPKNKTDDDDDAIISDCDEKDKDDLMMDEEKMKQHHRMVKG 172
           TWFANARRRLKKENKMTWEPKNKTDDD+D ++SD + +  D +  ++++ ++   +++G
Sbjct: 236 TWFANARRRLKKENKMTWEPKNKTDDDEDTMLSDEEREQDDKIKANKDEERKGDELLQG 294

Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328718930|ref|XP_001946080.2| PREDICTED: hypothetical protein LOC100165521 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|307197225|gb|EFN78544.1| Homeobox protein araucan [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|340716548|ref|XP_003396759.1| PREDICTED: homeobox protein caupolican-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|332024321|gb|EGI64520.1| Homeobox protein araucan [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|345484618|ref|XP_001604958.2| PREDICTED: homeobox protein caupolican-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|340716546|ref|XP_003396758.1| PREDICTED: homeobox protein caupolican-like isoform 1 [Bombus terrestris] Back     alignment and taxonomy information
>gi|110760661|ref|XP_396292.3| PREDICTED: homeobox protein araucan-like [Apis mellifera] Back     alignment and taxonomy information
>gi|383860361|ref|XP_003705659.1| PREDICTED: homeobox protein caupolican-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|350404412|ref|XP_003487096.1| PREDICTED: homeobox protein caupolican-like [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query197
FB|FBgn0015919 693 caup "caupolican" [Drosophila 0.426 0.121 0.928 8e-39
FB|FBgn0015904 717 ara "araucan" [Drosophila mela 0.401 0.110 0.974 1.6e-37
ZFIN|ZDB-GENE-040712-4 439 irx4b "iroquois homeobox prote 0.401 0.179 0.862 2e-33
UNIPROTKB|O42261 448 irx3 "Iroquois-class homeodoma 0.360 0.158 0.887 3.8e-33
UNIPROTKB|E1BPC7 445 IRX6 "Uncharacterized protein" 0.395 0.175 0.876 4.1e-33
UNIPROTKB|P78412 446 IRX6 "Iroquois-class homeodoma 0.395 0.174 0.876 4.1e-33
UNIPROTKB|F1RF02 440 IRX6 "Uncharacterized protein" 0.395 0.177 0.876 5.2e-33
UNIPROTKB|F1RF01 500 IRX3 "Uncharacterized protein" 0.360 0.142 0.887 7.6e-33
UNIPROTKB|P78415 501 IRX3 "Iroquois-class homeodoma 0.360 0.141 0.887 8.1e-33
UNIPROTKB|A2VDX5 502 IRX3 "IRX3 protein" [Bos tauru 0.360 0.141 0.887 8.5e-33
FB|FBgn0015919 caup "caupolican" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 407 (148.3 bits), Expect = 8.0e-39, Sum P(2) = 8.0e-39
 Identities = 78/84 (92%), Positives = 79/84 (94%)

Query:    54 LTAVRYGAGYDLAARRKNATRESTATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVS 113
             L A  YG  YDLAARRKNATRESTATLKAWL+EHKKNPYPTKGEKIMLAIITKMTLTQVS
Sbjct:   215 LAAYGYGPNYDLAARRKNATRESTATLKAWLSEHKKNPYPTKGEKIMLAIITKMTLTQVS 274

Query:   114 TWFANARRRLKKENKMTWEPKNKT 137
             TWFANARRRLKKENKMTWEPKNKT
Sbjct:   275 TWFANARRRLKKENKMTWEPKNKT 298
GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=ISS
GO:0005634 "nucleus" evidence=ISS;NAS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS;NAS
GO:0007474 "imaginal disc-derived wing vein specification" evidence=IGI
GO:0003705 "RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0045317 "equator specification" evidence=TAS
GO:0006357 "regulation of transcription from RNA polymerase II promoter" evidence=NAS
GO:0001745 "compound eye morphogenesis" evidence=IMP
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0006911 "phagocytosis, engulfment" evidence=IMP
GO:0042693 "muscle cell fate commitment" evidence=IGI
FB|FBgn0015904 ara "araucan" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040712-4 irx4b "iroquois homeobox protein 4b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|O42261 irx3 "Iroquois-class homeodomain protein irx-3" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|E1BPC7 IRX6 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P78412 IRX6 "Iroquois-class homeodomain protein IRX-6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RF02 IRX6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1RF01 IRX3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P78415 IRX3 "Iroquois-class homeodomain protein IRX-3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A2VDX5 IRX3 "IRX3 protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q93348IRX_CAEELNo assigned EC number0.54120.54820.2864yesN/A
Q9YGS0IRX4_CHICKNo assigned EC number0.83130.41620.1690yesN/A
Q4LDQ3IRX5_XENTRNo assigned EC number0.70870.52280.2136yesN/A
Q9ER75IRX6_MOUSENo assigned EC number0.67850.51260.2305yesN/A
P78412IRX6_HUMANNo assigned EC number0.81600.43650.1928yesN/A
Q24248ARA_DROMENo assigned EC number0.93870.49230.1352yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query197
pfam0592040 pfam05920, Homeobox_KN, Homeobox KN domain 5e-18
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 6e-12
smart0038957 smart00389, HOX, Homeodomain 2e-10
pfam0004657 pfam00046, Homeobox, Homeobox domain 5e-06
COG5576156 COG5576, COG5576, Homeodomain-containing transcrip 2e-04
>gnl|CDD|203350 pfam05920, Homeobox_KN, Homeobox KN domain Back     alignment and domain information 
 Score = 73.3 bits (181), Expect = 5e-18
 Identities = 21/40 (52%), Positives = 26/40 (65%)

Query: 83  WLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRR 122
           WL EH  NPYP++ EK  LA  T ++  Q+  WF NARRR
Sbjct: 1   WLLEHLHNPYPSEEEKSELARQTGLSRKQIDNWFINARRR 40

This is a homeobox transcription factor KN domain conserved from fungi to human and plants. Length = 40
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information
>gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 197
KOG0775|consensus304 99.97
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 99.74
KOG0774|consensus334 99.62
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.6
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.59
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.58
KOG0773|consensus342 99.5
KOG0489|consensus261 99.32
KOG0487|consensus308 99.29
KOG0843|consensus197 99.27
KOG0850|consensus245 99.19
KOG0488|consensus309 99.15
KOG0842|consensus307 99.07
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.03
KOG3802|consensus398 98.99
KOG0483|consensus198 98.99
KOG0485|consensus268 98.98
COG5576156 Homeodomain-containing transcription factor [Trans 98.96
KOG0848|consensus317 98.9
KOG0491|consensus194 98.89
KOG0493|consensus342 98.87
KOG0484|consensus125 98.85
KOG2251|consensus228 98.84
KOG0492|consensus246 98.76
KOG0494|consensus332 98.67
KOG0486|consensus 351 98.52
KOG0847|consensus288 98.46
KOG4577|consensus383 98.45
KOG0844|consensus408 98.44
KOG2252|consensus558 98.33
KOG0773|consensus 342 98.32
KOG0849|consensus354 98.18
KOG1168|consensus385 98.1
KOG0490|consensus235 98.07
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 97.4
KOG0490|consensus235 96.48
KOG1146|consensus 1406 94.36
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 93.09
KOG3623|consensus 1007 90.45
cd0056942 HTH_Hin_like Helix-turn-helix domain of Hin and re 85.22
PF0454550 Sigma70_r4: Sigma-70, region 4; InterPro: IPR00763 84.2
cd0617155 Sigma70_r4 Sigma70, region (SR) 4 refers to the mo 82.68
PF0152776 HTH_Tnp_1: Transposase; InterPro: IPR002514 Transp 80.76
>KOG0775|consensus Back     alignment and domain information 
Probab=99.97  E-value=2.3e-33  Score=242.11  Aligned_cols=115  Identities=26%  Similarity=0.302  Sum_probs=110.6

Q ss_pred             CCccccccccCCCeeecccCCCCcchhhhhhhcCcccccccccccccccCCCCCccCCCCCC---------------CCH
Q psy10105         10 TLRPELQLFTQVPIQVNISSTKVPALQSRRQLCGIDKQVIQVSNLTAVRYGAGYDLAARRKN---------------ATR   74 (197)
Q Consensus        10 ~lr~~~q~~~~~~~~~~~s~~~~p~~~~~~q~~~~~~~~~~~~~l~~~~~g~~~~~r~rR~~---------------f~~   74 (197)
                      .+++||.+.+.++|.|+++|.|.+++|.++|.+|+++||.|+++++|+++|+|+|||.|||.               |++
T Consensus       106 A~vafH~gnf~eLY~iLE~h~Fs~~~h~~LQ~lWl~AhY~EAek~RGR~LgaV~KYRvRrKfPlPrTIWDGEet~yCFKe  185 (304)
T KOG0775|consen  106 AVVAFHSGNFRELYHILENHKFSPHNHPKLQALWLKAHYKEAEKLRGRPLGAVDKYRVRRKFPLPRTIWDGEETVYCFKE  185 (304)
T ss_pred             HHHHHhcccHHHHHHHHHhccCChhhhHHHHHHHHHHHHHHHHHhcCCcCCccccceeeccCCCCCccccCceeeeehhH
Confidence            36799999999999999999999999999999999999999999999999999999999994               999


Q ss_pred             HHHHHHHHHHHHhhCCCCCCHHHHHHHHHHhCCChHHHhhhhhHHHHhhhhcc
Q psy10105         75 ESTATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKEN  127 (197)
Q Consensus        75 ~~~~~L~~wf~~h~~nPYPs~~ek~~LA~~tgLs~~QV~nWF~N~R~R~k~~~  127 (197)
                      .++.+|++||   .+||||++++|++||++|||+.+||+|||+|||+|+|...
T Consensus       186 kSR~~LrewY---~~~~YPsp~eKReLA~aTgLt~tQVsNWFKNRRQRDRa~~  235 (304)
T KOG0775|consen  186 KSRSLLREWY---LQNPYPSPREKRELAEATGLTITQVSNWFKNRRQRDRAAA  235 (304)
T ss_pred             hhHHHHHHHH---hcCCCCChHHHHHHHHHhCCchhhhhhhhhhhhhhhhhcc
Confidence            9999999999   8999999999999999999999999999999999999543

>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>KOG0774|consensus Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>KOG0773|consensus Back     alignment and domain information
>KOG0489|consensus Back     alignment and domain information
>KOG0487|consensus Back     alignment and domain information
>KOG0843|consensus Back     alignment and domain information
>KOG0850|consensus Back     alignment and domain information
>KOG0488|consensus Back     alignment and domain information
>KOG0842|consensus Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>KOG3802|consensus Back     alignment and domain information
>KOG0483|consensus Back     alignment and domain information
>KOG0485|consensus Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG0848|consensus Back     alignment and domain information
>KOG0491|consensus Back     alignment and domain information
>KOG0493|consensus Back     alignment and domain information
>KOG0484|consensus Back     alignment and domain information
>KOG2251|consensus Back     alignment and domain information
>KOG0492|consensus Back     alignment and domain information
>KOG0494|consensus Back     alignment and domain information
>KOG0486|consensus Back     alignment and domain information
>KOG0847|consensus Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>KOG0844|consensus Back     alignment and domain information
>KOG2252|consensus Back     alignment and domain information
>KOG0773|consensus Back     alignment and domain information
>KOG0849|consensus Back     alignment and domain information
>KOG1168|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>cd00569 HTH_Hin_like Helix-turn-helix domain of Hin and related proteins, a family of DNA-binding domains unique to bacteria and represented by the Hin protein of Salmonella Back     alignment and domain information
>PF04545 Sigma70_r4: Sigma-70, region 4; InterPro: IPR007630 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>cd06171 Sigma70_r4 Sigma70, region (SR) 4 refers to the most C-terminal of four conserved domains found in Escherichia coli (Ec) sigma70, the main housekeeping sigma, and related sigma-factors (SFs) Back     alignment and domain information
>PF01527 HTH_Tnp_1: Transposase; InterPro: IPR002514 Transposase proteins are necessary for efficient DNA transposition Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query197
2lk2_A89 Solution Nmr Structure Of Homeobox Domain (171-248) 2e-08
1x2n_A73 Solution Structure Of The Homeobox Domain Of Human 3e-08
2dmn_A83 The Solution Structure Of The Homeobox Domain Of Hu 4e-08
3k2a_A67 Crystal Structure Of The Homeobox Domain Of Human H 7e-07
1lfu_P82 Nmr Solution Stucture Of The Extended Pbx Homeodoma 1e-06
1puf_B73 Crystal Structure Of Hoxa9 And Pbx1 Homeodomains Bo 2e-06
1b72_B87 Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Le 2e-06
1b8i_B63 Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX 1e-05
1du6_A64 Solution Structure Of The Truncated Pbx Homeodomain 3e-05
4egc_A559 Crystal Structure Of Mbp-fused Human Six1 Bound To 4e-04
>pdb|2LK2|A Chain A, Solution Nmr Structure Of Homeobox Domain (171-248) Of Human Homeobox Protein Tgif1, Northeast Structural Genomics Consortium Target Hr4411b Length = 89 Back     alignment and structure 
Iteration: 1

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 33/50 (66%)
Query: 74  RESTATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRL 123
           +ES   L+ WL EH+ N YP++ EK +L+  T ++  QV  WF NARRRL
Sbjct: 14  KESVQILRDWLYEHRYNAYPSEQEKALLSQQTHLSTLQVCNWFINARRRL 63
>pdb|1X2N|A Chain A, Solution Structure Of The Homeobox Domain Of Human Homeobox Protein Pknox1 Length = 73 Back     alignment and structure
>pdb|2DMN|A Chain A, The Solution Structure Of The Homeobox Domain Of Human Homeobox Protein Tgif2lx Length = 83 Back     alignment and structure
>pdb|3K2A|A Chain A, Crystal Structure Of The Homeobox Domain Of Human Homeobox Protein Meis2 Length = 67 Back     alignment and structure
>pdb|1LFU|P Chain P, Nmr Solution Stucture Of The Extended Pbx Homeodomain Bound To Dna Length = 82 Back     alignment and structure
>pdb|1PUF|B Chain B, Crystal Structure Of Hoxa9 And Pbx1 Homeodomains Bound To Dna Length = 73 Back     alignment and structure
>pdb|1B72|B Chain B, Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Length = 87 Back     alignment and structure
>pdb|1B8I|B Chain B, Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX Length = 63 Back     alignment and structure
>pdb|1DU6|A Chain A, Solution Structure Of The Truncated Pbx Homeodomain Length = 64 Back     alignment and structure
>pdb|4EGC|A Chain A, Crystal Structure Of Mbp-fused Human Six1 Bound To Human Eya2 Eya Domain Length = 559 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query197
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 1e-28
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 6e-28
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 1e-27
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 2e-27
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 3e-27
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 8e-27
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 7e-25
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 3e-24
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 5e-24
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 8e-24
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 1e-10
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 2e-10
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 2e-10
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 4e-10
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 7e-10
1e3o_C160 Octamer-binding transcription factor 1; transcript 2e-06
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 2e-06
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 2e-06
2xsd_C164 POU domain, class 3, transcription factor 1; trans 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-06
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 9e-06
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 2e-05
3d1n_I151 POU domain, class 6, transcription factor 1; prote 3e-05
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 1e-04
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 1e-04
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 2e-04
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 2e-04
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 2e-04
3a01_A93 Homeodomain-containing protein; homeodomain, prote 2e-04
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 3e-04
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 4e-04
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 5e-04
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 8e-04
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 8e-04
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Length = 73 Back     alignment and structure
 Score =  101 bits (253), Expect = 1e-28
 Identities = 25/69 (36%), Positives = 36/69 (52%)

Query: 68  RRKNATRESTATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKEN 127
           +R+N  +++T  L  +   H  NPYP++  K  LA    +T++QVS WF N R R KK  
Sbjct: 4   KRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNI 63

Query: 128 KMTWEPKNK 136
               E  N 
Sbjct: 64  GKFQEEANI 72
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Length = 87 Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Length = 83 Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Length = 87 Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} Length = 67 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 76 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query197
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.84
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.81
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 99.79
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.79
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.78
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.78
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.77
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.77
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.75
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.75
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.7
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.69
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.68
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.68
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.68
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.68
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.67
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.67
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.66
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.66
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.65
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.65
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.65
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.65
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.65
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.65
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.64
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.64
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.64
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.64
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.64
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.64
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.64
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.63
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.63
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.63
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.63
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.62
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.62
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.62
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.62
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.62
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.62
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.61
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.61
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.61
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.6
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.6
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.59
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.59
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.58
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.58
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.57
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.56
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.56
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.56
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.56
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.55
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.55
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.54
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.52
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.52
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.51
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.51
2e19_A64 Transcription factor 8; homeobox domain, structura 99.51
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.5
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.49
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.45
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.43
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.42
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.42
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.41
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.37
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 99.24
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 99.23
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 99.21
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 99.17
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 96.9
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 95.99
1hlv_A131 CENP-B, major centromere autoantigen B; helix-turn 86.82
2glo_A59 Brinker CG9653-PA; protein-DNA complex, helix-turn 85.45
3hug_A92 RNA polymerase sigma factor; ECF sigma factor, zin 81.46
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
Probab=99.84  E-value=1.2e-20  Score=136.65  Aligned_cols=66  Identities=38%  Similarity=0.656  Sum_probs=62.2

Q ss_pred             CCccCCCCCCCCHHHHHHHHHHHHHhhCCCCCCHHHHHHHHHHhCCChHHHhhhhhHHHHhhhhcc
Q psy10105         62 GYDLAARRKNATRESTATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKEN  127 (197)
Q Consensus        62 ~~~~r~rR~~f~~~~~~~L~~wf~~h~~nPYPs~~ek~~LA~~tgLs~~QV~nWF~N~R~R~k~~~  127 (197)
                      +.+.+++|+.|+.+++.+|++||.+|..||||+.++|..||..|||+..||.+||+|+|+|.|+.+
T Consensus         4 ~~~~rk~R~~~s~~q~~~L~~~f~~~~~~pYPs~~~r~~LA~~~gLs~~qV~~WFqNrR~r~k~~~   69 (83)
T 2dmn_A            4 GSSGKKRKGNLPAESVKILRDWMYKHRFKAYPSEEEKQMLSEKTNLSLLQISNWFINARRRILPDM   69 (83)
T ss_dssp             CCCCCCCCSSCCHHHHHHHHHHHHHTTTTCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHTHHHH
T ss_pred             CCCCCCCCCcCCHHHHHHHHHHHHHhccCCCCCHHHHHHHHHHHCcCHHHhhHHhhhhHhhhcHHH
Confidence            446778888999999999999999999999999999999999999999999999999999999876
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1hlv_A CENP-B, major centromere autoantigen B; helix-turn-helix, protein-DNA complex, riken structural genomics/proteomics initiative, RSGI; 2.50A {Homo sapiens} SCOP: a.4.1.7 a.4.1.7 PDB: 1bw6_A Back     alignment and structure
>2glo_A Brinker CG9653-PA; protein-DNA complex, helix-turn-helix motif, transcription/DNA complex; NMR {Drosophila melanogaster} Back     alignment and structure
>3hug_A RNA polymerase sigma factor; ECF sigma factor, zinc binding anti-sigma factor, oxidative transcription regulation; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 197
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 2e-18
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 1e-16
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 4e-15
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 7e-10
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 1e-09
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 1e-09
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 3e-09
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 2e-08
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 5e-08
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 6e-08
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 8e-08
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 1e-07
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 1e-07
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 1e-07
d2ecca176 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H 1e-07
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 2e-07
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 2e-07
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 2e-07
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 2e-07
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 6e-07
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 2e-06
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 6e-06
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 7e-06
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 7e-06
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 9e-06
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 1e-05
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 2e-05
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 6e-05
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 7e-05
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 9e-05
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 2e-04
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein pknox1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 73.6 bits (181), Expect = 2e-18
 Identities = 24/58 (41%), Positives = 38/58 (65%)

Query: 68  RRKNATRESTATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKK 125
           +R    + +T  +++WL +H  +PYPT+ EK  +A  T +TL QV+ WF NARRR+ +
Sbjct: 5   KRGVLPKHATNVMRSWLFQHIGHPYPTEDEKKQIAAQTNLTLLQVNNWFINARRRILQ 62
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query197
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.85
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.84
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.83
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.7
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.69
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.69
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.69
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.69
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.69
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.69
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.69
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.69
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.67
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.67
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.67
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.66
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.66
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.66
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.66
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.66
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.65
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.65
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.65
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.65
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.63
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.6
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.59
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.58
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.57
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.56
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.54
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.52
d1hlva166 DNA-binding domain of centromere binding protein B 91.13
d1ijwc_47 HIN recombinase (DNA-binding domain) {Synthetic} 86.79
d1or7a168 SigmaE factor (RpoE) {Escherichia coli [TaxId: 562 86.32
d1rp3a271 Sigma factor sigma-28 (FliA) {Aquifex aeolicus [Ta 84.32
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein pknox1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.85  E-value=1.3e-21  Score=133.48  Aligned_cols=59  Identities=41%  Similarity=0.731  Sum_probs=56.3

Q ss_pred             CCCCCCCCHHHHHHHHHHHHHhhCCCCCCHHHHHHHHHHhCCChHHHhhhhhHHHHhhh
Q psy10105         66 AARRKNATRESTATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLK  124 (197)
Q Consensus        66 r~rR~~f~~~~~~~L~~wf~~h~~nPYPs~~ek~~LA~~tgLs~~QV~nWF~N~R~R~k  124 (197)
                      +++|+.|+++++.+|+.||.+|..||||+.+++..||..|||+.+||.|||+|+|+|..
T Consensus         3 krkR~~~~~~~~~iL~~wf~~~~~nPyPs~~e~~~La~~~~l~~~qI~~WF~N~R~R~l   61 (62)
T d1x2na1           3 KNKRGVLPKHATNVMRSWLFQHIGHPYPTEDEKKQIAAQTNLTLLQVNNWFINARRRIL   61 (62)
T ss_dssp             CCSSCCCCHHHHHHHHHHHHHTTTSCCCCHHHHHHHHHHHTCCHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCHHHHHHHHHHHHHhccCCCcCHHHHHHHHHHHCcCHHHhHHHHHHHHHHhc
Confidence            56678899999999999999999999999999999999999999999999999999975
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijwc_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic} Back     information, alignment and structure
>d1or7a1 a.4.13.2 (A:120-187) SigmaE factor (RpoE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rp3a2 a.4.13.2 (A:164-234) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure