Diaphorina citri psyllid: psy10114

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------82

MSSPCIIPLPLVPILAFSLYWTNILLPIIVHIVLHVTSRVFIYWKLPSNRTYSAYWVYLPNWKVGLPTLCINTLAFSLYWTNILLPIIVHILLHVTSRVFIYWKLPSNRTYSAYWVYLPNWKVGLPTLCINTLLFHHRHHSTSVLRLHVVLMVLNDVFTSILRVLCDYYYVLGRYCFALDLPIYLAAWLSCQTSLWVEYGFKSISCLHYVNLYGLLGLWTLLWPRTPLEFKLGLRENGSTPLNPPSTIMGDDECEMSNYYLKRLVTTVTPPKLLHTSSASHTPKRHHAATEENSNTDLDSRKLSKVQRNLMTHDFSSHRNKHLDQNMNMDLENENNEMEMENLATEDENTAPPLDLYDIMSPAYRSTSANLEVKADRYIPSRCGEKWQTRFSFIPDNRTCSVVPKKTREVSGETSRDGLAYTCLLRNELLGANIEGVKGQCDEKRVIFSPDRRNLFQYLPAPESRMNIEATSPYSLSPVGPKSQKLLRSPRKATRKISRIPFKVLDAPELQDDFYLNLVDWSSQNVLSVGLGSCVYLWSACTSQVTRLCDLSADGNSVTSVAWNERGNLVAVGTHHGYVQVWDVSVAKQVHKLVGHTARVGALAWNGDMLSSGSRDRMILQRDVRTPNSQSERRLVGHRQEVCGLKWSPDNQYLASGGNDNRLYVWNLHSMSPLQTYTEHLAAVKAIAWSPHHHGLLASGGGTADRCIRFWNTLTGQPMQCVDTGSQVCNLAWSKHSSELVSTHGYSQNQILVWKYPTLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKVRSQRESKSVLNLFSSIR

cccccccccccHHHHHHHHHHHHHHHHHEEEEEEEEEcEEEEEEEcccccCEEEEEEECcccccccccEEEEccHHHHHHHHHHHHHHHHHHHHcccEEEEEEEcccccCEEEEEEECcccccccccEEEEEEEcccccccccEEEEEEEHHHHHHHHHHHHHHHHHHEEEEcEEEEcccHHHHHHHHHccccEEEEEEEcEEEEEEEEEHHHHHccEEEEEECcccccccccccccccccccccccccccccccccccEEEEEECccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccEEEEEEcccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccEEEEccccccEEEEcccccccccccccccEEEEEEcccccEEEEcccccEEEcccccccCEEcccccccEEEEEECccccEEEEEEcccEEEEEEcccccEEEEEEcccccccEEEEEEcccccEEEEEEccccEEEEEccccEEEEEcccccccEEEEEEcccEEEEECccccEEEEEccccccCEEEEEccccccEEEEEEcccccEEEEECccccEEEEccccccEEEEcccccccEEEEEEccccccEEEEccccccccEEEEEcccccEEEEEcccccEEEEEEcccccEEEEccccccccEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEEcccccEEEEEcccccccccccccccccccccc

***PCIIPLPLVPILAFSLYWTNILLPIIVHIVLHVTSRVFIYWKLPSNRTYSAYWVYLPNWKVGLPTLCINTLAFSLYWTNILLPIIVHILLHVTSRVFIYWKLPSNRTYSAYWVYLPNWKVGLPTLCINTLLFHHRHHSTSVLRLHVVLMVLNDVFTSILRVLCDYYYVLGRYCFALDLPIYLAAWLSCQTSLWVEYGFKSISCLHYVNLYGLLGLWTLLWPRTPLEFKLGL******************ECEMSNYYLKRLVTTVT**************************************************************************************LYDIMSPAYR*TSANLEVKADRYIPSRCGEKWQTRFSFIPDNRTCSVV************RDGLAYTCLLRNELLGANIEGVKGQCDEKRVIFSPDRRNLFQYL*******************************RKATRKISRIPFKVLDAPELQDDFYLNLVDWSSQNVLSVGLGSCVYLWSACTSQVTRLCDLSADGNSVTSVAWNERGNLVAVGTHHGYVQVWDVSVAKQVHKLVGHTARVGALAWNGDMLSSGSRDRMILQRDVRTPNSQSERRLVGHRQEVCGLKWSPDNQYLASGGNDNRLYVWNLHSMSPLQTYTEHLAAVKAIAWSPHHHGLLASGGGTADRCIRFWNTLTGQPMQCVDTGSQVCNLAWSKHSSELVSTHGYSQNQILVWKYPTLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKV************FSSIR

xxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MSSPCIIPLPLVPILAFSLYWTNILLPIIVHIVLHVTSRVFIYWKLPSNRTYSAYWVYLPNWKVGLPTLCINTLAFSLYWTNILLPIIVHILLHVTSRVFIYWKLPSNRTYSAYWVYLPNWKVGLPTLCINTLLFHHRHHSTSVLRLHVVLMVLNDVFTSILRVLCDYYYVLGRYCFALDLPIYLAAWLSCQTSLWVEYGFKSISCLHYVNLYGLLGLWTLLWPRTPLEFKLGLRENGSTPLNPPSTIMGDDECEMSNYYLKRLVTTVTPPKLLHTSSASHTPKRHHAATEENSNTDLDSRKLSKVQRNLMTHDFSSHRNxxxxxxxxxxxxxxxxxxxxxxxxxxxxNTAPPLDLYDIMSPAYRSTSANLEVKADRYIPSRCGEKWQTRFSFIPDNRTCSVVPKKTREVSGETSRDGLAYTCLLRNELLGANIEGVKGQCDEKRVIFSPDRRNLFQYLPAPESRMNIEATSPYSLSPVGPKSQKLLRSPRKATRKISRIPFKVLDAPELQDDFYLNLVDWSSQNVLSVGLGSCVYLWSACTSQVTRLCDLSADGNSVTSVAWNERGNLVAVGTHHGYVQVWDVSVAKQVHKLVGHTARVGALAWNGDMLSSGSRDRMILQRDVRTPNSQSERRLVGHRQEVCGLKWSPDNQYLASGGNDNRLYVWNLHSMSPLQTYTEHLAAVKAIAWSPHHHGLLASGGGTADRCIRFWNTLTGQPMQCVDTGSQVCNLAWSKHSSELVSTHGYSQNQILVWKYPTLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKVRSQRESKSVLNLFSSIR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Fizzy-related protein homolog	Key regulator of ligase activity of the anaphase promoting complex/cyclosome (APC/C), which confers substrate specificity upon the complex. Associates with the APC/C in late mitosis, in replacement of CDC20, and activates the APC/C during anaphase and telophase. The APC/C remains active in degrading substrates to ensure that positive regulators of the cell cycle do not accumulate prematurely. At the G1/S transition FZR1 is phosphorylated, leading to its dissociation from the APC/C. Following DNA damage, it is required for the G2 DNA damage checkpoint: its dephosphorylation and reassociation with the APC/C leads to the ubiquitination of PLK1, preventing entry into mitosis.	confident	Q9UM11
Fizzy-related protein homolog	Key regulator of ligase activity of the anaphase promoting complex/cyclosome (APC/C), which confers substrate specificity upon the complex. Associates with the APC/C in late mitosis, in replacement of CDC20, and activates the APC/C during anaphase and telophase. The APC/C remains active in degrading substrates to ensure that positive regulators of the cell cycle do not accumulate prematurely. At the G1/S transition FZR1 is phosphorylated, leading to its dissociation from the APC/C. Following DNA damage, it is required for the G2 DNA damage checkpoint: its dephosphorylation and reassociation with the APC/C leads to the ubiquitination of PLK1, preventing entry into mitosis.	confident	Q9R1K5
Protein FIZZY-RELATED 2	Activator protein that regulates the ubiquitin ligase activity and substrate specificity of the anaphase promoting complex/cyclosome (APC/C). Necessary and sufficient for endoreduplication and correct cell expansion.	confident	Q8L3Z8

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0008150 [BP]	biological_process	confident
GO:0040020 [BP]	regulation of meiosis	probable	GO:0051445, GO:0051726, GO:2000241, GO:0010564, GO:0050794, GO:0065007, GO:0008150, GO:0050789
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0010001 [BP]	glial cell differentiation	probable	GO:0032502, GO:0009987, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0042063, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0022008, GO:0007275, GO:0044699, GO:0048856
GO:0005680 [CC]	anaphase-promoting complex	probable	GO:0043234, GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0000151, GO:0000152, GO:0005622, GO:0044446, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0031461, GO:0043227, GO:0043226, GO:0044422
GO:0031572 [BP]	G2 DNA damage checkpoint	probable	GO:0010948, GO:0050789, GO:0044699, GO:0051716, GO:0031570, GO:0010564, GO:0065007, GO:0048519, GO:0009987, GO:0050794, GO:0006974, GO:1901987, GO:0006950, GO:0008150, GO:1901988, GO:0000077, GO:0000075, GO:0051726, GO:0050896, GO:0033554, GO:0044763, GO:0048523
GO:0031965 [CC]	nuclear membrane	probable	GO:0005575, GO:0005635, GO:0031090, GO:0005634, GO:0016020, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0005623, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0008054 [BP]	cyclin catabolic process	probable	GO:0044248, GO:0043632, GO:0044267, GO:1901575, GO:0044265, GO:0044260, GO:0043161, GO:0071704, GO:0006508, GO:0044238, GO:0009987, GO:0019941, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0009056, GO:0009057, GO:0051603, GO:0019538, GO:0010498, GO:0044237, GO:0043170, GO:0006511
GO:0031145 [BP]	anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process	probable	GO:0044248, GO:0043632, GO:0044267, GO:1901575, GO:0044265, GO:0044260, GO:0043161, GO:0071704, GO:0006508, GO:0044238, GO:0009987, GO:0019941, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0009056, GO:0009057, GO:0051603, GO:0019538, GO:0010498, GO:0044237, GO:0043170, GO:0006511
GO:0090302 [MF]	mitotic anaphase-promoting complex activity	probable	GO:0019787, GO:0016879, GO:0004842, GO:0016881, GO:0003824, GO:0003674, GO:0016874
GO:0005814 [CC]	centriole	probable	GO:0005737, GO:0005856, GO:0015630, GO:0043228, GO:0005575, GO:0043232, GO:0005813, GO:0044464, GO:0044444, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0044430, GO:0044450, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0051488 [BP]	activation of anaphase-promoting complex activity	probable	GO:0009893, GO:0019222, GO:0031325, GO:0031323, GO:0051438, GO:0050789, GO:0043085, GO:0080090, GO:0051340, GO:0010604, GO:0051246, GO:0051247, GO:0032270, GO:0044093, GO:0031399, GO:0031396, GO:0065007, GO:0065009, GO:0031398, GO:0060255, GO:0050790, GO:0050794, GO:0048518, GO:0008150, GO:0032268, GO:0051443, GO:0031401, GO:0051351, GO:0048522
GO:0030424 [CC]	axon	probable	GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0090344 [BP]	negative regulation of cell aging	probable	GO:0051093, GO:0090342, GO:0050793, GO:0050794, GO:0008150, GO:0065007, GO:0048519, GO:0050789, GO:0048523
GO:0008284 [BP]	positive regulation of cell proliferation	probable	GO:0042127, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0051301 [BP]	cell division	probable	GO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0031536 [BP]	positive regulation of exit from mitosis	probable	GO:0090068, GO:0007346, GO:0051726, GO:0033043, GO:0010564, GO:0050794, GO:0051783, GO:0065007, GO:0008150, GO:0048518, GO:0051128, GO:0007096, GO:0007088, GO:0050789, GO:0048522
GO:0048610 [BP]	cellular process involved in reproduction	probable	GO:0009987, GO:0008150, GO:0000003
GO:0001745 [BP]	compound eye morphogenesis	probable	GO:0048749, GO:0032502, GO:0009887, GO:0032501, GO:0044707, GO:0007423, GO:0048592, GO:0048856, GO:0044767, GO:0048513, GO:0001654, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0045732 [BP]	positive regulation of protein catabolic process	probable	GO:0009896, GO:0009894, GO:0009893, GO:0080090, GO:0060255, GO:0051246, GO:0051247, GO:0042176, GO:0065007, GO:0048518, GO:0008150, GO:0019222, GO:0050789, GO:0010604
GO:0008347 [BP]	glial cell migration	probable	GO:0040011, GO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0048870, GO:0009987, GO:0048869, GO:0032501, GO:0030154, GO:0042063, GO:0006928, GO:0008150, GO:0051674, GO:0044763, GO:0007275, GO:0048731, GO:0022008, GO:0016477, GO:0051179, GO:0044699
GO:0000084 [BP]	S phase of mitotic cell cycle	probable	GO:0051325, GO:0044699, GO:0000278, GO:0009987, GO:0051329, GO:0008150, GO:0022402, GO:0022403, GO:0044763, GO:0007049, GO:0051320
GO:0000080 [BP]	G1 phase of mitotic cell cycle	probable	GO:0051325, GO:0044699, GO:0000278, GO:0008150, GO:0009987, GO:0051329, GO:0051318, GO:0022402, GO:0022403, GO:0044763, GO:0007049
GO:0010458 [BP]	exit from mitosis	probable	GO:0006996, GO:0044699, GO:0000278, GO:0071840, GO:0009987, GO:0000280, GO:0016043, GO:0008150, GO:0044763, GO:0048285, GO:0022402, GO:0007067, GO:0007049
GO:0048468 [BP]	cell development	probable	GO:0032502, GO:0048856, GO:0048869, GO:0030154, GO:0044767, GO:0044763, GO:0008150, GO:0009987, GO:0044699
GO:0045335 [CC]	phagocytic vesicle	probable	GO:0005737, GO:0005575, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0030139, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0051437 [BP]	positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle	probable	GO:0009893, GO:0019222, GO:0031325, GO:0031323, GO:0051439, GO:0051438, GO:0050789, GO:0007049, GO:0080090, GO:0051340, GO:0010604, GO:0051246, GO:0051247, GO:0032270, GO:0044699, GO:0031398, GO:0031399, GO:0031396, GO:0065007, GO:0065009, GO:0043085, GO:0009987, GO:0000278, GO:0060255, GO:0050790, GO:0050794, GO:0048518, GO:0044763, GO:0032268, GO:0051443, GO:0022402, GO:0031401, GO:0051351, GO:0008150, GO:0044093, GO:0048522
GO:0051436 [BP]	negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle	probable	GO:0009892, GO:0080090, GO:0019222, GO:0031324, GO:0031323, GO:0031399, GO:0022402, GO:0051438, GO:0043086, GO:0044699, GO:0051248, GO:0051340, GO:0010605, GO:0051246, GO:0050789, GO:0065007, GO:0007049, GO:0044092, GO:0031396, GO:0031397, GO:0065009, GO:0009987, GO:0000278, GO:0060255, GO:0051439, GO:0050790, GO:0050794, GO:0044763, GO:0048519, GO:0051444, GO:0032269, GO:0032268, GO:0031400, GO:0051352, GO:0008150, GO:0048523
GO:0070979 [BP]	protein K11-linked ubiquitination	probable	GO:0071704, GO:0044267, GO:0044238, GO:0044260, GO:0032446, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0016567, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0000209
GO:0005654 [CC]	nucleoplasm	probable	GO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0007455 [BP]	eye-antennal disc morphogenesis	probable	GO:0048563, GO:0048569, GO:0009887, GO:0009791, GO:0002165, GO:0032501, GO:0009653, GO:0007275, GO:0044699, GO:0007552, GO:0048513, GO:0032502, GO:0048707, GO:0035214, GO:0044767, GO:0008150, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0009886, GO:0048731
GO:0019953 [BP]	sexual reproduction	probable	GO:0008150, GO:0000003
GO:0070306 [BP]	lens fiber cell differentiation	probable	GO:0032502, GO:0030154, GO:0044707, GO:0007423, GO:0048869, GO:0032501, GO:0060429, GO:0009888, GO:0048731, GO:0044767, GO:0048513, GO:0001654, GO:0008150, GO:0030855, GO:0002088, GO:0044763, GO:0009987, GO:0043010, GO:0007275, GO:0044699, GO:0048856
GO:0005816 [CC]	spindle pole body	probable	GO:0043234, GO:0005575, GO:0005819, GO:0032991, GO:0005622, GO:0043232, GO:0005856, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0044430, GO:0044422, GO:0044424, GO:0043228, GO:0000922, GO:0043226, GO:0015630

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4GGA, chain A
Confidence level:very confident
Coverage over the Query: 494-804
View the alignment between query and template
View the model in PyMOL