Psyllid ID: psy10114


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------82
MSSPCIIPLPLVPILAFSLYWTNILLPIIVHIVLHVTSRVFIYWKLPSNRTYSAYWVYLPNWKVGLPTLCINTLAFSLYWTNILLPIIVHILLHVTSRVFIYWKLPSNRTYSAYWVYLPNWKVGLPTLCINTLLFHHRHHSTSVLRLHVVLMVLNDVFTSILRVLCDYYYVLGRYCFALDLPIYLAAWLSCQTSLWVEYGFKSISCLHYVNLYGLLGLWTLLWPRTPLEFKLGLRENGSTPLNPPSTIMGDDECEMSNYYLKRLVTTVTPPKLLHTSSASHTPKRHHAATEENSNTDLDSRKLSKVQRNLMTHDFSSHRNKHLDQNMNMDLENENNEMEMENLATEDENTAPPLDLYDIMSPAYRSTSANLEVKADRYIPSRCGEKWQTRFSFIPDNRTCSVVPKKTREVSGETSRDGLAYTCLLRNELLGANIEGVKGQCDEKRVIFSPDRRNLFQYLPAPESRMNIEATSPYSLSPVGPKSQKLLRSPRKATRKISRIPFKVLDAPELQDDFYLNLVDWSSQNVLSVGLGSCVYLWSACTSQVTRLCDLSADGNSVTSVAWNERGNLVAVGTHHGYVQVWDVSVAKQVHKLVGHTARVGALAWNGDMLSSGSRDRMILQRDVRTPNSQSERRLVGHRQEVCGLKWSPDNQYLASGGNDNRLYVWNLHSMSPLQTYTEHLAAVKAIAWSPHHHGLLASGGGTADRCIRFWNTLTGQPMQCVDTGSQVCNLAWSKHSSELVSTHGYSQNQILVWKYPTLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKVRSQRESKSVLNLFSSIR
cccccccccccHHHHHHHHHHHHHHHHHEEEEEEEEEcEEEEEEEcccccEEEEEEEEEcccccccccEEEEccHHHHHHHHHHHHHHHHHHHHcccEEEEEEEcccccEEEEEEEEEcccccccccEEEEEEEcccccccccEEEEEEEHHHHHHHHHHHHHHHHHHEEEEcEEEEcccHHHHHHHHHccccEEEEEEEcEEEEEEEEEHHHHHccEEEEEEEcccccccccccccccccccccccccccccccccccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccEEEEEEcccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccEEEEccccccEEEEcccccccccccccccEEEEEEcccccEEEEcccccEEEcccccccEEEcccccccEEEEEEEccccEEEEEEcccEEEEEEcccccEEEEEEcccccccEEEEEEcccccEEEEEEccccEEEEEccccEEEEEcccccccEEEEEEcccEEEEEEccccEEEEEccccccEEEEEEccccccEEEEEEcccccEEEEEEccccEEEEccccccEEEEcccccccEEEEEEccccccEEEEccccccccEEEEEcccccEEEEEcccccEEEEEEcccccEEEEccccccccEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEEcccccEEEEEcccccccccccccccccccccc
cccccEcccccHHHHHHHHHHHHHHHHHEEEEEEEHccEEEEEEEccccccEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcEEEEEEEccccccEEEEEEEcccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccHHHHccccEEHHHHHHHHHHHccccEcccccccEEEEcccccccccccccccccccccccHHHHHHHHHHccccccccccEEEEEEEcccccEEEEEccccccEEEEEEEccccccEEEEEccccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEcccccccEEEcccccccccEEEEcccccccEEEEEEcccccEEEEEEcccccEEEEcccccEEEEEEEEccccccEEEEEcccccEEEEEEcccccEEEEEccccEEEEEccccccEEEEEEcccccEEEEcccccEEEEEEcccccEEEEcccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEEEccccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEEcccccEEEEEEcccEEEEcccccEEEEEEcccccccEEEEEccccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEccccccEEEEEEcccccEEEEEcccccccEEEEEEcccccEEEEEcccccEEEEEEcccccEEEEEccccccEEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEccccEEEEEEEcc
msspciiplplvpiLAFSLYWTNILLPIIVHIVLHVTSRVFIywklpsnrtysAYWVylpnwkvglptlCINTLAFSLYWTNILLPIIVHILLHVTSRVFIywklpsnrtysAYWVylpnwkvglptlCINTllfhhrhhstsVLRLHVVLMVLNDVFTSILRVLCDYYYVLGRYCFALDLPIYLAAWLSCQTSLWVEYGFKSISCLHYVNLYGLLGLwtllwprtplefklglrengstplnppstimgddecemSNYYLKRLVttvtppkllhtssashtpkrhhaateensntdldsrKLSKVQRNLMthdfsshrnkhldqnmnmdlenennememenlatedentappldlydimspayrstsanlevkadryipsrcgekwqtrfsfipdnrtcsvvpkktrevsgetsrdglAYTCLLRNELLganiegvkgqcdekrvifspdrrnlfqylpapesrmnieatspyslspvgpksqkllrsprkatrkisripfkvldapelqddfylnlvdwssqnvlSVGLGSCVYLWSACTSQVTrlcdlsadgnsvtSVAWNERGNLVAVGTHHGYVQVWDVSVAKQVHKLVGHTARVGAlawngdmlssgsrdrmilqrdvrtpnsqserrlvghrqevcglkwspdnqylasggndnrLYVWNLHSMSPLQTYTEHLAAVKAiawsphhhgllasgggtadRCIRFWntltgqpmqcvdtgsqvCNLAWSKHSSelvsthgysqnqilvwkyptltqvAKLTGHSYRVLYLAmspdgeaivtgagdETLRFWNVFSKVRSQRESKSVLNLFSSIR
msspciipLPLVPILAFSLYWTNILLPIIVHIVLHVTSRVFIYWKLPSNRTYSAYWVYLPNWKVGLPTLCINTLAFSLYWTNILLPIIVHILLHVTSRVFIYWKLPSNRTYSAYWVYLPNWKVGLPTLCINTLLFHHRHHSTSVLRLHVVLMVLNDVFTSILRVLCDYYYVLGRYCFALDLPIYLAAWLSCQTSLWVEYGFKSISCLHYVNLYGLLGLWTLLWPRTPLEFKLGlrengstplnppstimgdDECEMSNYYLKRLVTTVTPPKLLHtssashtpkrhhaateensntdldsrKLSKVQRNLMThdfsshrnkhldqNMNMDLENENNEMEMENLATEDENTAPPLDLYDIMSPAYRstsanlevkadryipsrcgEKWQTrfsfipdnrtcsvvpkktrevsgetsrdglaYTCLLRNELLGaniegvkgqcDEKRVIFSPDRRNLFQYlpapesrmnieatspyslspvgpksqkllrsprkatrkisripfkvldapeLQDDFYLNLVDWSSQNVLSVGLGSCVYLWSACTSQVTRLCDLSADGNSVTSVAWNERGNLVAVGTHHGYVQVWDVSVAKQVHKLVGHTarvgalawngdmlssgsrdrmilqrdvrtpnsqserrlvghrqevcglkwspdnqylaSGGNDNRLYVWNLHSMSPLQTYTEHLAAVKAIAWSPHHHGLLASGGGTADRCIRFWNTLTGQPMQCVDTGSQVCNLAWSKHSSELVSTHGYSQNQILVWKYPTLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFskvrsqresksvlnlfssir
MSSPCiiplplvpilAFSLYWTNillpiivhivlhvTSRVFIYWKLPSNRTYSAYWVYLPNWKVGLPTLCINTLAFSLYWTNillpiivhillhvTSRVFIYWKLPSNRTYSAYWVYLPNWKVGLPTLCINTLLFHHRHHSTSVLRLHVVLMVLNDVFTSILRVLCDYYYVLGRYCFALDLPIYLAAWLSCQTSLWVEYGFKSISCLHYVNlygllglwtllwprtplEFKLGLRENGSTPLNPPSTIMGDDECEMSNYYLKRLVTTVTPPKLLHTSSASHTPKRHHAATEENSNTDLDSRKLSKVQRNLMTHDFSSHRNKHLDQnmnmdlenennememenlATEDENTAPPLDLYDIMSPAYRSTSANLEVKADRYIPSRCGEKWQTRFSFIPDNRTCSVVPKKTREVSGETSRDGLAYTCLLRNELLGANIEGVKGQCDEKRVIFSPDRRNLFQYLPAPESRMNIEATSPYSLSPVGPKSQKLLRSPRKATRKISRIPFKVLDAPELQDDFYLNLVDWSSQNVLSVGLGSCVYLWSACTSQVTRLCDLSADGNSVTSVAWNERGNLVAVGTHHGYVQVWDVSVAKQVHKLVGHTARVGALAWNGDMLSSGSRDRMILQRDVRTPNSQSERRLVGHRQEVCGLKWSPDNQYLASGGNDNRLYVWNLHSMSPLQTYTEHLAAVKAIAWSPHHHGLLASGGGTADRCIRFWNTLTGQPMQCVDTGSQVCNLAWSKHSSELVSTHGYSQNQILVWKYPTLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKVRSQRESKSVLNLFSSIR
****CIIPLPLVPILAFSLYWTNILLPIIVHIVLHVTSRVFIYWKLPSNRTYSAYWVYLPNWKVGLPTLCINTLAFSLYWTNILLPIIVHILLHVTSRVFIYWKLPSNRTYSAYWVYLPNWKVGLPTLCINTLLFHHRHHSTSVLRLHVVLMVLNDVFTSILRVLCDYYYVLGRYCFALDLPIYLAAWLSCQTSLWVEYGFKSISCLHYVNLYGLLGLWTLLWPRTPLEFKLGL******************ECEMSNYYLKRLVTTVT**************************************************************************************LYDIMSPAYR*TSANLEVKADRYIPSRCGEKWQTRFSFIPDNRTCSVVP***********RDGLAYTCLLRNELLGANIEGVKGQCDEKRVIFSPDRRNLFQYL**************************************SRIPFKVLDAPELQDDFYLNLVDWSSQNVLSVGLGSCVYLWSACTSQVTRLCDLSADGNSVTSVAWNERGNLVAVGTHHGYVQVWDVSVAKQVHKLVGHTARVGALAWNGDML**************************GHRQEVCGLKWSPDNQYLASGGNDNRLYVWNLHSMSPLQTYTEHLAAVKAIAWSPHHHGLLASGGGTADRCIRFWNTLTGQPMQCVDTGSQVCNLAWSKHSSELVSTHGYSQNQILVWKYPTLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKV*****************
***PCIIPLPLVPILAFSLYWTNILLPIIVHIVLHVTSRVFIYWKLPSNRTYSAYWVYLPNWKVGLPTLCINTLAFSLYWTNILLPIIVHILLHVTSRVFIYWKLPSNRTYSAYWVYLPNWKVGLPTLCINTLLFHHRHHSTSVLRLHVVLMVLNDVFTSILRVLCDYYYVLGRYCFALDLPIYLAAWLSCQTSLWVEYGFKSISCLHYVNLYGLLGLWTLLWPRTPL*****************************************************************************************************************************************************YIPSRCGEKWQTRF*****************************YTCLLRNELLGA**********************************************************RKATRKISRIPFKVLDAPELQDDFYLNLVDWSSQNVLSVGLGSCVYLWSACTSQVTRLCDLSADGNSVTSVAWNERGNLVAVGTHHGYVQVWDVSVAKQVHKLVGHTARVGALAWNGDMLSSGSRDRMILQRDVRTPNSQSERRLVGHRQEVCGLKWSPDNQYLASGGNDNRLYVWNLHSMSPLQTYTEHLAAVKAIAWSPHHHGLLASGGGTADRCIRFWNTLTGQPMQCVDTGSQVCNLAWSKHSSELVSTHGYSQNQILVWKYPTLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWN*****************FSSIR
MSSPCIIPLPLVPILAFSLYWTNILLPIIVHIVLHVTSRVFIYWKLPSNRTYSAYWVYLPNWKVGLPTLCINTLAFSLYWTNILLPIIVHILLHVTSRVFIYWKLPSNRTYSAYWVYLPNWKVGLPTLCINTLLFHHRHHSTSVLRLHVVLMVLNDVFTSILRVLCDYYYVLGRYCFALDLPIYLAAWLSCQTSLWVEYGFKSISCLHYVNLYGLLGLWTLLWPRTPLEFKLGLRENGSTPLNPPSTIMGDDECEMSNYYLKRLVTTVTPPKLLH************************SRKLSKVQRNLMTHDFSSHRNKHLDQNMNMDLENENNEMEMENLATEDENTAPPLDLYDIMSPAYRSTSANLEVKADRYIPSRCGEKWQTRFSFIPDNRTCSVV************RDGLAYTCLLRNELLGANIEGVKGQCDEKRVIFSPDRRNLFQYLPAPESRMNIEATSPY*******************TRKISRIPFKVLDAPELQDDFYLNLVDWSSQNVLSVGLGSCVYLWSACTSQVTRLCDLSADGNSVTSVAWNERGNLVAVGTHHGYVQVWDVSVAKQVHKLVGHTARVGALAWNGDMLSSGSRDRMILQRDV**********LVGHRQEVCGLKWSPDNQYLASGGNDNRLYVWNLHSMSPLQTYTEHLAAVKAIAWSPHHHGLLASGGGTADRCIRFWNTLTGQPMQCVDTGSQVCNLAWSKHSSELVSTHGYSQNQILVWKYPTLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKV********VLNLFSSIR
**SPCIIPLPLVPILAFSLYWTNILLPIIVHIVLHVTSRVFIYWKLPSNRTYSAYWVYLPNWKVGLPTLCINTLAFSLYWTNILLPIIVHILLHVTSRVFIYWKLPSNRTYSAYWVYLPNWKVGLPTLCINTLLFHHRHHSTSVLRLHVVLMVLNDVFTSILRVLCDYYYVLGRYCFALDLPIYLAAWLSCQTSLWVEYGFKSISCLHYVNLYGLLGLWTLLWPRTPLEFKLGLRENGSTPLNPPSTIMGDDECEMSNYYLKRLVTTVTPPKLLHTSSASHTPKRHHAATEENSNTDLDSRKLSKVQRNLMTHDFSSHRNKHLDQNMNMDLENENNEMEMENLATEDENTAPPLDLYDIMSPAYRSTSANLEVKADRYIPSRCGEKWQTRFSFIPDNRTCSVVPKKTREVSGETSRDGLAYTCLLRNELLGANIEGVKGQCDEKRVIFSPDRRNLFQYLPAPESRMNIEATSPYSLSPVGPKSQKLLRSPRKATRKISRIPFKVLDAPELQDDFYLNLVDWSSQNVLSVGLGSCVYLWSACTSQVTRLCDLSADGNSVTSVAWNERGNLVAVGTHHGYVQVWDVSVAKQVHKLVGHTARVGALAWNGDMLSSGSRDRMILQRDVRTPNSQSERRLVGHRQEVCGLKWSPDNQYLASGGNDNRLYVWNLHSMSPLQTYTEHLAAVKAIAWSPHHHGLLASGGGTADRCIRFWNTLTGQPMQCVDTGSQVCNLAWSKHSSELVSTHGYSQNQILVWKYPTLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKVRSQRESKSVLNLFSSIR
oooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHoooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSPCIIPLPLVPILAFSLYWTNILLPIIVHIVLHVTSRVFIYWKLPSNRTYSAYWVYLPNWKVGLPTLCINTLAFSLYWTNILLPIIVHILLHVTSRVFIYWKLPSNRTYSAYWVYLPNWKVGLPTLCINTLLFHHRHHSTSVLRLHVVLMVLNDVFTSILRVLCDYYYVLGRYCFALDLPIYLAAWLSCQTSLWVEYGFKSISCLHYVNLYGLLGLWTLLWPRTPLEFKLGLRENGSTPLNPPSTIMGDDECEMSNYYLKRLVTTVTPPKLLHTSSASHTPKRHHAATEENSNTDLDSRKLSKVQRNLMTHDFSSHRNxxxxxxxxxxxxxxxxxxxxxxxxxxxxNTAPPLDLYDIMSPAYRSTSANLEVKADRYIPSRCGEKWQTRFSFIPDNRTCSVVPKKTREVSGETSRDGLAYTCLLRNELLGANIEGVKGQCDEKRVIFSPDRRNLFQYLPAPESRMNIEATSPYSLSPVGPKSQKLLRSPRKATRKISRIPFKVLDAPELQDDFYLNLVDWSSQNVLSVGLGSCVYLWSACTSQVTRLCDLSADGNSVTSVAWNERGNLVAVGTHHGYVQVWDVSVAKQVHKLVGHTARVGALAWNGDMLSSGSRDRMILQRDVRTPNSQSERRLVGHRQEVCGLKWSPDNQYLASGGNDNRLYVWNLHSMSPLQTYTEHLAAVKAIAWSPHHHGLLASGGGTADRCIRFWNTLTGQPMQCVDTGSQVCNLAWSKHSSELVSTHGYSQNQILVWKYPTLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKVRSQRESKSVLNLFSSIR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query819 2.2.26 [Sep-21-2011]
Q9R1K5493 Fizzy-related protein hom yes N/A 0.581 0.965 0.696 0.0
Q9UM11496 Fizzy-related protein hom yes N/A 0.582 0.961 0.687 0.0
Q8L3Z8483 Protein FIZZY-RELATED 2 O yes N/A 0.507 0.861 0.561 1e-133
Q8VZS9475 Protein FIZZY-RELATED 1 O no N/A 0.500 0.863 0.564 1e-127
Q54KM3754 Anaphase-promoting comple yes N/A 0.415 0.450 0.571 1e-118
Q8LPL5481 Protein FIZZY-RELATED 3 O no N/A 0.367 0.625 0.669 1e-118
O94423421 Meiotic fizzy-related pro yes N/A 0.489 0.952 0.477 1e-110
O13286556 WD repeat-containing prot no N/A 0.429 0.633 0.522 1e-102
Q54MZ3499 Anaphase-promoting comple no N/A 0.406 0.667 0.515 5e-97
P53197566 APC/C activator protein C yes N/A 0.416 0.602 0.485 2e-93
>sp|Q9R1K5|FZR_MOUSE Fizzy-related protein homolog OS=Mus musculus GN=Fzr1 PE=1 SV=1 Back     alignment and function desciption
 Score =  686 bits (1771), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/488 (69%), Positives = 394/488 (80%), Gaps = 12/488 (2%)

Query: 340 MENLATEDENTAPPL-DLYDIMSPAYRSTSANLEVKADRYIPSRCGEKWQTRFSFIPDNR 398
           +  +  ++ENT P + ++   ++PA    S+  +   DR+IPSR G  W   F  I +N 
Sbjct: 10  LRQIIIQNENTVPCVSEMRRTLTPANSPVSSPSK-HGDRFIPSRAGANWSVNFHRINENE 68

Query: 399 TCSVVPKKTREVSGETSRDGLAYTCLLRNELLGANIEGVKG-QCDEKRVIFS-PDRRNLF 456
                 +K ++ + +  +DGLAY+ LL+NELLGA IE V+  Q +++R+  S P+ + LF
Sbjct: 69  KSPSQNRKAKDATSDNGKDGLAYSALLKNELLGAGIEKVQDPQTEDRRLQPSTPEHKGLF 128

Query: 457 QY-----LPAPESRMNIEATSPYSLSPVGPKSQKLLRSPRKATRKISRIPFKVLDAPELQ 511
            Y       +P+   ++   SPYSLSPV  KSQKLLRSPRK TRKIS+IPFKVLDAPELQ
Sbjct: 129 TYSLSSKRSSPDDGNDV---SPYSLSPVSNKSQKLLRSPRKPTRKISKIPFKVLDAPELQ 185

Query: 512 DDFYLNLVDWSSQNVLSVGLGSCVYLWSACTSQVTRLCDLSADGNSVTSVAWNERGNLVA 571
           DDFYLNLVDWSS NVLSVGLG+CVYLWSACTSQVTRLCDLS +G+SVTSV W+ERGNLVA
Sbjct: 186 DDFYLNLVDWSSLNVLSVGLGTCVYLWSACTSQVTRLCDLSVEGDSVTSVGWSERGNLVA 245

Query: 572 VGTHHGYVQVWDVSVAKQVHKLVGHTARVGALAWNGDMLSSGSRDRMILQRDVRTPNSQS 631
           VGTH G+VQ+WD +  K++  L GHTARVGALAWN D LSSGSRDRMILQRD+RTP  QS
Sbjct: 246 VGTHKGFVQIWDAAAGKKLSMLEGHTARVGALAWNADQLSSGSRDRMILQRDIRTPPLQS 305

Query: 632 ERRLVGHRQEVCGLKWSPDNQYLASGGNDNRLYVWNLHSMSPLQTYTEHLAAVKAIAWSP 691
           ERRL GHRQEVCGLKWS D+Q LASGGNDN+L VWN  S+SP+Q YTEHLAAVKAIAWSP
Sbjct: 306 ERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSSLSPVQQYTEHLAAVKAIAWSP 365

Query: 692 HHHGLLASGGGTADRCIRFWNTLTGQPMQCVDTGSQVCNLAWSKHSSELVSTHGYSQNQI 751
           H HGLLASGGGTADRCIRFWNTLTGQP+QC+DTGSQVCNLAWSKH++ELVSTHGYSQNQI
Sbjct: 366 HQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLAWSKHANELVSTHGYSQNQI 425

Query: 752 LVWKYPTLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKVRSQRESKSV 811
           LVWKYP+LTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSK RS +ES SV
Sbjct: 426 LVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKTRSTKESVSV 485

Query: 812 LNLFSSIR 819
           LNLF+ IR
Sbjct: 486 LNLFTRIR 493




Key regulator of ligase activity of the anaphase promoting complex/cyclosome (APC/C), which confers substrate specificity upon the complex. Associates with the APC/C in late mitosis, in replacement of CDC20, and activates the APC/C during anaphase and telophase. The APC/C remains active in degrading substrates to ensure that positive regulators of the cell cycle do not accumulate prematurely. At the G1/S transition FZR1 is phosphorylated, leading to its dissociation from the APC/C. Following DNA damage, it is required for the G2 DNA damage checkpoint: its dephosphorylation and reassociation with the APC/C leads to the ubiquitination of PLK1, preventing entry into mitosis.
Mus musculus (taxid: 10090)
>sp|Q9UM11|FZR_HUMAN Fizzy-related protein homolog OS=Homo sapiens GN=FZR1 PE=1 SV=2 Back     alignment and function description
>sp|Q8L3Z8|FZR2_ARATH Protein FIZZY-RELATED 2 OS=Arabidopsis thaliana GN=FZR2 PE=1 SV=1 Back     alignment and function description
>sp|Q8VZS9|FZR1_ARATH Protein FIZZY-RELATED 1 OS=Arabidopsis thaliana GN=FZR1 PE=1 SV=1 Back     alignment and function description
>sp|Q54KM3|CDH1_DICDI Anaphase-promoting complex subunit cdh1 OS=Dictyostelium discoideum GN=cdh1 PE=3 SV=1 Back     alignment and function description
>sp|Q8LPL5|FZR3_ARATH Protein FIZZY-RELATED 3 OS=Arabidopsis thaliana GN=FZR3 PE=1 SV=1 Back     alignment and function description
>sp|O94423|MFR1_SCHPO Meiotic fizzy-related protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfr1 PE=1 SV=1 Back     alignment and function description
>sp|O13286|SRW1_SCHPO WD repeat-containing protein srw1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=srw1 PE=1 SV=1 Back     alignment and function description
>sp|Q54MZ3|CDC20_DICDI Anaphase-promoting complex subunit cdc20 OS=Dictyostelium discoideum GN=cdc20 PE=1 SV=1 Back     alignment and function description
>sp|P53197|CDH1_YEAST APC/C activator protein CDH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDH1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query819
156537047489 PREDICTED: fizzy-related protein homolog 0.542 0.907 0.828 0.0
383856405486 PREDICTED: fizzy-related protein homolog 0.588 0.991 0.786 0.0
350417684486 PREDICTED: fizzy-related protein homolog 0.590 0.995 0.779 0.0
340728011486 PREDICTED: fizzy-related protein homolog 0.588 0.991 0.782 0.0
332018767494 Fizzy-related protein-like protein [Acro 0.559 0.927 0.819 0.0
307165943494 Fizzy-related protein-like protein [Camp 0.540 0.896 0.835 0.0
307212148493 Fizzy-related protein-like protein [Harp 0.540 0.898 0.837 0.0
322790516494 hypothetical protein SINV_04616 [Solenop 0.540 0.896 0.837 0.0
91077232483 PREDICTED: similar to retina aberrant in 0.561 0.952 0.769 0.0
194764131478 GF20850 [Drosophila ananassae] gi|190619 0.557 0.956 0.763 0.0
>gi|156537047|ref|XP_001601463.1| PREDICTED: fizzy-related protein homolog [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  769 bits (1986), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/444 (82%), Positives = 404/444 (90%)

Query: 376 DRYIPSRCGEKWQTRFSFIPDNRTCSVVPKKTREVSGETSRDGLAYTCLLRNELLGANIE 435
           DR+IP+R G  WQT FS I ++    VV KKTRE +GE SRDG+AY+CLL+NELLGA+IE
Sbjct: 46  DRFIPTRLGNNWQTTFSMISESNRTGVVNKKTRENNGEGSRDGIAYSCLLKNELLGASIE 105

Query: 436 GVKGQCDEKRVIFSPDRRNLFQYLPAPESRMNIEATSPYSLSPVGPKSQKLLRSPRKATR 495
            VKGQC+E+R++     +NLF++    + +  ++ TSPYSLSP+  KSQKLLRSPRKATR
Sbjct: 106 DVKGQCEERRILSPLAGKNLFKFTTPTKDKALLDQTSPYSLSPLSAKSQKLLRSPRKATR 165

Query: 496 KISRIPFKVLDAPELQDDFYLNLVDWSSQNVLSVGLGSCVYLWSACTSQVTRLCDLSADG 555
           KISRIPFKVLDAPELQDDFYLNLVDWSSQNVLSVGLGSCVYLWSACTSQVTRLCDLS DG
Sbjct: 166 KISRIPFKVLDAPELQDDFYLNLVDWSSQNVLSVGLGSCVYLWSACTSQVTRLCDLSGDG 225

Query: 556 NSVTSVAWNERGNLVAVGTHHGYVQVWDVSVAKQVHKLVGHTARVGALAWNGDMLSSGSR 615
           NSVTSVAWNERGNLVAVGT+ GY+QVWDV+V KQV+KL GH+ARVGALAWNG++LSSGSR
Sbjct: 226 NSVTSVAWNERGNLVAVGTNLGYIQVWDVAVNKQVNKLQGHSARVGALAWNGEVLSSGSR 285

Query: 616 DRMILQRDVRTPNSQSERRLVGHRQEVCGLKWSPDNQYLASGGNDNRLYVWNLHSMSPLQ 675
           DR+IL RDVRTP   SER+L  HRQEVCGLKWSPDNQYLASGGNDNRLYVWNLHS+SP+Q
Sbjct: 286 DRLILLRDVRTPCLVSERKLGAHRQEVCGLKWSPDNQYLASGGNDNRLYVWNLHSLSPVQ 345

Query: 676 TYTEHLAAVKAIAWSPHHHGLLASGGGTADRCIRFWNTLTGQPMQCVDTGSQVCNLAWSK 735
           TYTEHLAAVKAIAWSPHHHGLLASGGGTADRCIRFWNTLTGQPMQCVDTGSQVCNLAWSK
Sbjct: 346 TYTEHLAAVKAIAWSPHHHGLLASGGGTADRCIRFWNTLTGQPMQCVDTGSQVCNLAWSK 405

Query: 736 HSSELVSTHGYSQNQILVWKYPTLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRF 795
           HSSELVSTHGYSQNQILVWKYP+LTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRF
Sbjct: 406 HSSELVSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRF 465

Query: 796 WNVFSKVRSQRESKSVLNLFSSIR 819
           WNVFSK RSQ+E+KSVLNLF+SIR
Sbjct: 466 WNVFSKARSQKENKSVLNLFTSIR 489




Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|383856405|ref|XP_003703699.1| PREDICTED: fizzy-related protein homolog [Megachile rotundata] Back     alignment and taxonomy information
>gi|350417684|ref|XP_003491543.1| PREDICTED: fizzy-related protein homolog [Bombus impatiens] Back     alignment and taxonomy information
>gi|340728011|ref|XP_003402326.1| PREDICTED: fizzy-related protein homolog [Bombus terrestris] Back     alignment and taxonomy information
>gi|332018767|gb|EGI59332.1| Fizzy-related protein-like protein [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307165943|gb|EFN60270.1| Fizzy-related protein-like protein [Camponotus floridanus] Back     alignment and taxonomy information
>gi|307212148|gb|EFN88002.1| Fizzy-related protein-like protein [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|322790516|gb|EFZ15378.1| hypothetical protein SINV_04616 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|91077232|ref|XP_968256.1| PREDICTED: similar to retina aberrant in pattern CG3000-PA isoform 1 [Tribolium castaneum] gi|270002085|gb|EEZ98532.1| hypothetical protein TcasGA2_TC001036 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|194764131|ref|XP_001964185.1| GF20850 [Drosophila ananassae] gi|190619110|gb|EDV34634.1| GF20850 [Drosophila ananassae] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query819
FB|FBgn0262699478 rap "retina aberrant in patter 0.556 0.953 0.760 1.1e-190
ZFIN|ZDB-GENE-040426-712495 fzr1 "fizzy/cell division cycl 0.578 0.957 0.714 1.6e-182
UNIPROTKB|Q32L05493 FZR1 "Uncharacterized protein" 0.577 0.959 0.713 5.4e-182
UNIPROTKB|Q5H7B9493 FZR1 "Uncharacterized protein" 0.577 0.959 0.713 5.4e-182
MGI|MGI:1926790493 Fzr1 "fizzy/cell division cycl 0.577 0.959 0.711 1.1e-181
UNIPROTKB|E2R4Z3496 FZR1 "Uncharacterized protein" 0.577 0.953 0.707 2.7e-180
UNIPROTKB|Q9UM11496 FZR1 "Fizzy-related protein ho 0.577 0.953 0.705 5.5e-180
UNIPROTKB|H9L1Y1503 Gga.913 "Uncharacterized prote 0.557 0.908 0.675 1.3e-164
WB|WBGene00001510702 fzr-1 [Caenorhabditis elegans 0.426 0.497 0.684 9.1e-141
TAIR|locus:2137030475 CCS52A2 "AT4G11920" [Arabidops 0.549 0.947 0.538 8e-124
FB|FBgn0262699 rap "retina aberrant in pattern" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1848 (655.6 bits), Expect = 1.1e-190, P = 1.1e-190
 Identities = 355/467 (76%), Positives = 395/467 (84%)

Query:   361 SPAYRSTSANLE-----VKADRYIPSRCGEKWQTRFSFI-PDNRTCSVVPKKTREVSGET 414
             SP  R+   N E        DR+IP R    WQT F+ I   N       KK R+  GET
Sbjct:    15 SPVARNLFNNFESSTTPTSLDRFIPCRAYNNWQTNFASINKSNDNSPQTSKKQRDC-GET 73

Query:   415 SRDGLAYTCLLRNELLGANIEGVKGQCDEKRV-IFSPD-RRNLFQYLPAPESRMNIEATS 472
             +RD LAY+CLL+NELLG+ I+ VK   +E+    ++P  +R+LF+Y  +P ++ +     
Sbjct:    74 ARDSLAYSCLLKNELLGSAIDDVKTAGEERNENAYTPAAKRSLFKY-QSP-TKQDYNGEC 131

Query:   473 PYSLSPVGPKSQKLLRSPRKATRKISRIPFKVLDAPELQDDFYLNLVDWSSQNVLSVGLG 532
             PYSLSPV  KSQKLLRSPRKATRKISRIPFKVLDAPELQDDFYLNLVDWSSQNVL+VGLG
Sbjct:   132 PYSLSPVSAKSQKLLRSPRKATRKISRIPFKVLDAPELQDDFYLNLVDWSSQNVLAVGLG 191

Query:   533 SCVYLWSACTSQVTRLCDLSADGNSVTSVAWNERGNLVAVGTHHGYVQVWDVSVAKQVHK 592
             SCVYLWSACTSQVTRLCDLS D N+VTSV+WNERGN VAVGTHHGYV VWDV+  KQ++K
Sbjct:   192 SCVYLWSACTSQVTRLCDLSPDANTVTSVSWNERGNTVAVGTHHGYVTVWDVAANKQINK 251

Query:   593 LVGHTARVGALAWNGDMLSSGSRDRMILQRDVRTPNSQSERRLVGHRQEVCGLKWSPDNQ 652
             L GH+ARVGALAWN D+LSSGSRDR I+QRD RTP  QSERRL GHRQEVCGLKWSPDNQ
Sbjct:   252 LNGHSARVGALAWNSDILSSGSRDRWIIQRDTRTPQLQSERRLAGHRQEVCGLKWSPDNQ 311

Query:   653 YLASGGNDNRLYVWNLHSMSPLQTYTEHLAAVKAIAWSPHHHGLLASGGGTADRCIRFWN 712
             YLASGGNDNRLYVWN HS++P+Q+YTEH+AAVKAIAWSPHHHGLLASGGGTADRCIRFWN
Sbjct:   312 YLASGGNDNRLYVWNQHSVNPVQSYTEHMAAVKAIAWSPHHHGLLASGGGTADRCIRFWN 371

Query:   713 TLTGQPMQCVDTGSQVCNLAWSKHSSELVSTHGYSQNQILVWKYPTLTQVAKLTGHSYRV 772
             TLTGQPMQCVDTGSQVCNLAWSKHSSELVSTHGYSQNQILVWKYP+LTQVAKLTGHSYRV
Sbjct:   372 TLTGQPMQCVDTGSQVCNLAWSKHSSELVSTHGYSQNQILVWKYPSLTQVAKLTGHSYRV 431

Query:   773 LYLAMSPDGEAIVTGAGDETLRFWNVFSKVRSQRESKSVLNLFSSIR 819
             LYLA+SPDGEAIVTGAGDETLRFWNVFSK RSQ+E+KSVLNLF++IR
Sbjct:   432 LYLALSPDGEAIVTGAGDETLRFWNVFSKARSQKENKSVLNLFANIR 478




GO:0008054 "cyclin catabolic process" evidence=IDA
GO:0005819 "spindle" evidence=IDA
GO:0030163 "protein catabolic process" evidence=IMP
GO:0005813 "centrosome" evidence=IDA
GO:0005737 "cytoplasm" evidence=IDA
GO:0010458 "exit from mitosis" evidence=IMP
GO:0000080 "G1 phase of mitotic cell cycle" evidence=IMP
GO:0008347 "glial cell migration" evidence=IMP
GO:0031536 "positive regulation of exit from mitosis" evidence=IMP
GO:0001745 "compound eye morphogenesis" evidence=IMP
GO:0007455 "eye-antennal disc morphogenesis" evidence=IMP
GO:0031145 "anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process" evidence=IDA
GO:0005680 "anaphase-promoting complex" evidence=IDA
GO:0090302 "mitotic anaphase-promoting complex activity" evidence=IDA
GO:0005814 "centriole" evidence=IDA
GO:0010001 "glial cell differentiation" evidence=IDA
GO:0030424 "axon" evidence=IDA
ZFIN|ZDB-GENE-040426-712 fzr1 "fizzy/cell division cycle 20 related 1 (Drosophila)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q32L05 FZR1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q5H7B9 FZR1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1926790 Fzr1 "fizzy/cell division cycle 20 related 1 (Drosophila)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2R4Z3 FZR1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UM11 FZR1 "Fizzy-related protein homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H9L1Y1 Gga.913 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
WB|WBGene00001510 fzr-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
TAIR|locus:2137030 CCS52A2 "AT4G11920" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9UM11FZR_HUMANNo assigned EC number0.68770.58240.9616yesN/A
Q8L3Z8FZR2_ARATHNo assigned EC number0.56170.50790.8612yesN/A
Q54KM3CDH1_DICDINo assigned EC number0.57140.41510.4509yesN/A
Q9R1K5FZR_MOUSENo assigned EC number0.69670.58110.9655yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query819
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 8e-41
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 4e-39
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 1e-36
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 7e-35
cd00200 289 cd00200, WD40, WD40 domain, found in a number of e 4e-27
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 1e-20
COG2319 466 COG2319, COG2319, FOG: WD40 repeat [General functi 4e-15
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 3e-07
smart0032040 smart00320, WD40, WD40 repeats 4e-07
smart0032040 smart00320, WD40, WD40 repeats 6e-05
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 1e-04
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 1e-04
smart0032040 smart00320, WD40, WD40 repeats 1e-04
PLN00181793 PLN00181, PLN00181, protein SPA1-RELATED; Provisio 0.001
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
 Score =  151 bits (383), Expect = 8e-41
 Identities = 85/288 (29%), Positives = 138/288 (47%), Gaps = 22/288 (7%)

Query: 519 VDWSSQN--VLSVGLGSCVYLWSACTSQV-TRLCDLSADGNSVTSVAWNERGNLVAVGTH 575
           V +S     + +      + +W   T ++   L   +     V + A    G  +A G+ 
Sbjct: 15  VAFSPDGKLLATGSGDGTIKVWDLETGELLRTLKGHTGPVRDVAASAD---GTYLASGSS 71

Query: 576 HGYVQVWDVSVAKQVHKLVGHTARVGALAW--NGDMLSSGSRDRMILQRDVRTPNSQSER 633
              +++WD+   + V  L GHT+ V ++A+  +G +LSS SRD+ I   DV T   +   
Sbjct: 72  DKTIRLWDLETGECVRTLTGHTSYVSSVAFSPDGRILSSSSRDKTIKVWDVETG--KCLT 129

Query: 634 RLVGHRQEVCGLKWSPDNQYLASGGNDNRLYVWNLHSMSPLQTYTEHLAAVKAIAWSPHH 693
            L GH   V  + +SPD  ++AS   D  + +W+L +   + T T H   V ++A+SP  
Sbjct: 130 TLRGHTDWVNSVAFSPDGTFVASSSQDGTIKLWDLRTGKCVATLTGHTGEVNSVAFSPDG 189

Query: 694 HGLLASGGGTADRCIRFWNTLTGQPMQCVDT----GSQVCNLAWSKHSSELVSTHGYSQN 749
             LL+S     D  I+ W+  TG+   C+ T     + V ++A+S     L S  G    
Sbjct: 190 EKLLSSSS---DGTIKLWDLSTGK---CLGTLRGHENGVNSVAFSPDGYLLAS--GSEDG 241

Query: 750 QILVWKYPTLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWN 797
            I VW   T   V  L+GH+  V  LA SPDG+ + +G+ D T+R W+
Sbjct: 242 TIRVWDLRTGECVQTLSGHTNSVTSLAWSPDGKRLASGSADGTIRIWD 289


Length = 289

>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|177776 PLN00181, PLN00181, protein SPA1-RELATED; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 819
KOG0305|consensus484 100.0
KOG0650|consensus733 100.0
KOG0271|consensus480 100.0
KOG0271|consensus480 100.0
KOG0272|consensus459 100.0
KOG0286|consensus343 100.0
KOG0279|consensus315 100.0
KOG0272|consensus459 100.0
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 100.0
KOG0273|consensus524 100.0
KOG0315|consensus311 99.98
KOG0284|consensus464 99.97
KOG0295|consensus406 99.97
KOG0291|consensus 893 99.97
KOG0263|consensus707 99.97
KOG0266|consensus456 99.97
KOG0265|consensus338 99.97
KOG0273|consensus524 99.97
KOG0281|consensus499 99.97
KOG0291|consensus 893 99.97
PF08145260 BOP1NT: BOP1NT (NUC169) domain; InterPro: IPR01295 99.96
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.96
KOG0296|consensus399 99.96
KOG0645|consensus312 99.96
KOG0295|consensus406 99.96
KOG0279|consensus315 99.96
KOG0285|consensus460 99.96
KOG0286|consensus343 99.96
KOG0318|consensus603 99.96
PLN00181793 protein SPA1-RELATED; Provisional 99.96
KOG0263|consensus707 99.96
KOG0319|consensus 775 99.96
KOG0266|consensus456 99.96
KOG0285|consensus460 99.96
KOG0318|consensus 603 99.96
KOG0315|consensus311 99.96
KOG0284|consensus 464 99.95
KOG0293|consensus519 99.95
KOG0278|consensus334 99.95
KOG0274|consensus537 99.95
KOG0316|consensus307 99.95
KOG0316|consensus307 99.95
KOG0281|consensus499 99.95
PTZ00421 493 coronin; Provisional 99.95
KOG0306|consensus 888 99.95
KOG0276|consensus 794 99.94
PLN00181793 protein SPA1-RELATED; Provisional 99.94
KOG0282|consensus503 99.94
KOG0319|consensus 775 99.94
KOG0313|consensus423 99.94
KOG0275|consensus508 99.94
KOG0276|consensus 794 99.94
KOG0292|consensus 1202 99.93
KOG0265|consensus338 99.93
KOG0288|consensus459 99.93
KOG0645|consensus312 99.93
KOG0283|consensus 712 99.93
KOG0310|consensus 487 99.93
KOG0277|consensus311 99.93
KOG0643|consensus327 99.93
KOG0282|consensus503 99.93
KOG0292|consensus 1202 99.92
KOG0294|consensus362 99.92
KOG0306|consensus 888 99.92
KOG0289|consensus506 99.92
KOG0313|consensus423 99.92
PTZ00421 493 coronin; Provisional 99.92
KOG0296|consensus399 99.91
KOG1446|consensus311 99.91
KOG0640|consensus430 99.91
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.91
KOG1446|consensus311 99.91
KOG0310|consensus 487 99.91
KOG0973|consensus 942 99.91
KOG1407|consensus313 99.91
KOG0277|consensus311 99.91
PTZ00420 568 coronin; Provisional 99.91
KOG1408|consensus 1080 99.9
KOG0275|consensus508 99.9
KOG1407|consensus313 99.9
PTZ00420 568 coronin; Provisional 99.9
KOG0293|consensus519 99.9
KOG0274|consensus537 99.9
KOG0301|consensus 745 99.9
KOG0268|consensus 433 99.89
KOG0973|consensus 942 99.89
KOG0772|consensus 641 99.89
KOG0308|consensus 735 99.89
KOG0288|consensus459 99.89
KOG0264|consensus422 99.89
KOG1539|consensus 910 99.89
KOG0299|consensus479 99.89
KOG0300|consensus481 99.88
KOG0646|consensus 476 99.88
KOG0268|consensus433 99.88
KOG0305|consensus484 99.87
KOG0641|consensus350 99.87
KOG0308|consensus 735 99.87
KOG0264|consensus422 99.87
KOG1332|consensus299 99.87
KOG1274|consensus 933 99.87
KOG0639|consensus705 99.86
KOG0647|consensus347 99.86
KOG0643|consensus327 99.86
KOG0647|consensus347 99.86
KOG0278|consensus334 99.86
KOG0299|consensus479 99.86
KOG1036|consensus323 99.86
KOG2106|consensus626 99.86
KOG0641|consensus350 99.86
KOG0269|consensus 839 99.85
KOG0283|consensus712 99.85
KOG1036|consensus323 99.85
KOG1274|consensus 933 99.85
KOG1332|consensus299 99.84
KOG0300|consensus481 99.84
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.83
KOG0269|consensus 839 99.83
KOG0321|consensus 720 99.83
KOG0289|consensus506 99.83
KOG0639|consensus705 99.83
KOG4283|consensus397 99.83
KOG4378|consensus 673 99.83
KOG0267|consensus 825 99.82
KOG0640|consensus430 99.82
KOG2048|consensus 691 99.82
KOG0301|consensus 745 99.81
KOG2096|consensus420 99.81
KOG0646|consensus 476 99.8
KOG0267|consensus 825 99.8
KOG2055|consensus514 99.8
KOG0270|consensus463 99.8
KOG2445|consensus361 99.8
KOG4283|consensus 397 99.8
KOG1273|consensus405 99.8
KOG0294|consensus362 99.79
KOG0772|consensus 641 99.79
COG2319466 FOG: WD40 repeat [General function prediction only 99.79
KOG0270|consensus463 99.79
KOG1408|consensus 1080 99.79
KOG2048|consensus 691 99.78
KOG4378|consensus 673 99.78
KOG4328|consensus498 99.78
KOG2106|consensus 626 99.78
KOG0302|consensus440 99.77
COG2319466 FOG: WD40 repeat [General function prediction only 99.76
KOG0302|consensus440 99.76
KOG0307|consensus 1049 99.76
KOG4328|consensus498 99.76
KOG0307|consensus 1049 99.76
KOG1539|consensus 910 99.75
KOG0642|consensus577 99.74
KOG1063|consensus764 99.74
KOG1063|consensus 764 99.74
KOG1188|consensus376 99.73
PRK11028330 6-phosphogluconolactonase; Provisional 99.72
KOG2055|consensus514 99.72
KOG1009|consensus434 99.72
KOG1034|consensus385 99.72
KOG1587|consensus555 99.72
KOG0650|consensus733 99.71
KOG1538|consensus 1081 99.71
KOG1445|consensus 1012 99.71
KOG2919|consensus406 99.7
KOG0303|consensus 472 99.69
KOG2445|consensus361 99.69
KOG0321|consensus 720 99.69
KOG2096|consensus420 99.69
KOG2919|consensus406 99.66
KOG0303|consensus 472 99.65
KOG1034|consensus385 99.64
KOG1273|consensus 405 99.64
KOG0322|consensus323 99.63
KOG0290|consensus364 99.63
KOG0649|consensus325 99.61
KOG0290|consensus364 99.61
KOG1007|consensus370 99.61
KOG0644|consensus 1113 99.6
KOG2110|consensus 391 99.6
KOG4227|consensus 609 99.58
KOG1517|consensus1387 99.58
KOG1188|consensus376 99.57
PRK01742429 tolB translocation protein TolB; Provisional 99.57
KOG1524|consensus 737 99.56
KOG1538|consensus 1081 99.54
KOG0642|consensus577 99.53
KOG1009|consensus434 99.53
KOG1587|consensus555 99.53
KOG1240|consensus1431 99.52
KOG1445|consensus 1012 99.52
PRK03629429 tolB translocation protein TolB; Provisional 99.52
KOG1310|consensus 758 99.52
PRK11028330 6-phosphogluconolactonase; Provisional 99.52
KOG0644|consensus 1113 99.51
KOG0649|consensus325 99.51
KOG1007|consensus370 99.51
KOG1523|consensus361 99.5
PRK01742429 tolB translocation protein TolB; Provisional 99.49
KOG2110|consensus391 99.48
KOG1524|consensus 737 99.48
KOG2139|consensus445 99.48
PRK05137435 tolB translocation protein TolB; Provisional 99.48
PRK04922433 tolB translocation protein TolB; Provisional 99.47
KOG1963|consensus 792 99.47
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.46
KOG0771|consensus398 99.45
KOG2111|consensus346 99.45
PRK04922433 tolB translocation protein TolB; Provisional 99.44
KOG1240|consensus1431 99.44
PRK05137435 tolB translocation protein TolB; Provisional 99.44
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.44
PRK02889427 tolB translocation protein TolB; Provisional 99.43
KOG1517|consensus1387 99.42
KOG1523|consensus361 99.42
KOG1334|consensus 559 99.41
KOG1963|consensus 792 99.41
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.39
KOG2139|consensus445 99.37
KOG0322|consensus323 99.37
KOG2394|consensus 636 99.36
PRK03629429 tolB translocation protein TolB; Provisional 99.36
KOG1310|consensus 758 99.36
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.35
KOG3881|consensus412 99.33
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.33
KOG1334|consensus559 99.33
KOG1272|consensus 545 99.3
KOG2315|consensus 566 99.3
KOG2111|consensus346 99.3
KOG0771|consensus398 99.29
PRK02889427 tolB translocation protein TolB; Provisional 99.29
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.29
PRK00178430 tolB translocation protein TolB; Provisional 99.28
KOG4497|consensus447 99.27
KOG1272|consensus 545 99.26
PRK00178430 tolB translocation protein TolB; Provisional 99.25
PRK04792448 tolB translocation protein TolB; Provisional 99.23
KOG1354|consensus433 99.23
KOG3881|consensus412 99.22
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.22
KOG2321|consensus 703 99.19
KOG2394|consensus 636 99.19
PRK01029428 tolB translocation protein TolB; Provisional 99.19
KOG0280|consensus339 99.18
COG4946668 Uncharacterized protein related to the periplasmic 99.16
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.13
KOG4497|consensus447 99.13
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 99.12
PRK04792448 tolB translocation protein TolB; Provisional 99.12
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.12
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.1
KOG4547|consensus 541 99.1
KOG1409|consensus404 99.09
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 99.09
KOG4547|consensus 541 99.08
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.08
KOG2321|consensus 703 99.06
PRK01029428 tolB translocation protein TolB; Provisional 99.06
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 99.04
KOG0309|consensus 1081 99.03
KOG2041|consensus 1189 98.98
KOG4227|consensus 609 98.97
KOG1064|consensus2439 98.97
KOG0974|consensus 967 98.93
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 98.93
KOG0974|consensus 967 98.93
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 98.91
KOG2041|consensus 1189 98.9
KOG2314|consensus 698 98.85
KOG1354|consensus433 98.84
KOG0280|consensus339 98.82
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.8
KOG1912|consensus 1062 98.8
KOG2315|consensus 566 98.79
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.79
PRK04043419 tolB translocation protein TolB; Provisional 98.78
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.76
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.75
KOG1064|consensus2439 98.74
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.73
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.72
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 98.71
PRK04043419 tolB translocation protein TolB; Provisional 98.7
KOG4190|consensus1034 98.65
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.64
KOG4190|consensus1034 98.61
KOG4532|consensus344 98.61
KOG1409|consensus 404 98.55
KOG4532|consensus344 98.53
KOG2314|consensus 698 98.53
KOG1832|consensus 1516 98.53
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.53
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.52
KOG3914|consensus 390 98.51
COG4946 668 Uncharacterized protein related to the periplasmic 98.46
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 98.45
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.44
KOG1912|consensus 1062 98.43
KOG0882|consensus 558 98.38
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.38
KOG3914|consensus390 98.36
KOG1920|consensus 1265 98.32
KOG1275|consensus 1118 98.31
KOG1645|consensus463 98.26
KOG4714|consensus319 98.26
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.24
KOG1275|consensus 1118 98.24
KOG2695|consensus425 98.19
COG5170 460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.18
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.17
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.15
KOG2695|consensus425 98.13
PF11768 545 DUF3312: Protein of unknown function (DUF3312); In 98.1
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.1
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 98.09
KOG2114|consensus 933 98.07
KOG0309|consensus 1081 98.05
KOG4714|consensus319 98.05
KOG1832|consensus1516 98.04
KOG0882|consensus 558 98.03
PRK02888 635 nitrous-oxide reductase; Validated 98.02
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 97.93
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 97.92
KOG2066|consensus 846 97.91
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 97.91
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.9
KOG2114|consensus 933 97.88
PRK02888 635 nitrous-oxide reductase; Validated 97.86
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 97.86
KOG1920|consensus 1265 97.82
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 97.82
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 97.81
KOG4649|consensus354 97.81
KOG3621|consensus 726 97.8
COG3391381 Uncharacterized conserved protein [Function unknow 97.8
KOG2066|consensus 846 97.79
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 97.78
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 97.74
KOG1008|consensus 783 97.72
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 97.71
COG0823425 TolB Periplasmic component of the Tol biopolymer t 97.71
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 97.66
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 97.65
KOG3617|consensus 1416 97.64
COG0823425 TolB Periplasmic component of the Tol biopolymer t 97.63
KOG4649|consensus354 97.61
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 97.53
KOG1008|consensus 783 97.5
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 97.48
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 97.41
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 97.39
KOG1645|consensus463 97.37
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 97.37
PF04841 410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 97.36
COG3391381 Uncharacterized conserved protein [Function unknow 97.28
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 97.16
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.07
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 97.02
PHA02713557 hypothetical protein; Provisional 96.92
smart0032040 WD40 WD40 repeats. Note that these repeats are per 96.86
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 96.84
KOG4441|consensus571 96.79
COG3386307 Gluconolactonase [Carbohydrate transport and metab 96.78
KOG4441|consensus571 96.73
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 96.66
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 96.64
PHA02713557 hypothetical protein; Provisional 96.58
KOG3621|consensus 726 96.54
COG5276370 Uncharacterized conserved protein [Function unknow 96.52
PRK13616591 lipoprotein LpqB; Provisional 96.49
PRK10115 686 protease 2; Provisional 96.46
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 96.38
KOG3617|consensus 1416 96.34
KOG4499|consensus310 96.22
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 96.16
PRK13616591 lipoprotein LpqB; Provisional 96.16
KOG4640|consensus 665 96.15
smart0032040 WD40 WD40 repeats. Note that these repeats are per 96.11
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 96.06
KOG4640|consensus 665 96.02
KOG2395|consensus644 96.02
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 95.91
COG3386307 Gluconolactonase [Carbohydrate transport and metab 95.87
KOG2079|consensus 1206 95.83
PHA03098534 kelch-like protein; Provisional 95.79
KOG1897|consensus 1096 95.7
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 95.63
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 95.58
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 95.49
KOG1897|consensus 1096 95.46
PF08553 794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 95.42
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 95.36
COG3204316 Uncharacterized protein conserved in bacteria [Fun 95.36
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 95.24
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 95.23
COG3490366 Uncharacterized protein conserved in bacteria [Fun 95.12
COG3490366 Uncharacterized protein conserved in bacteria [Fun 95.03
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 95.0
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 94.93
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 94.88
PHA03098534 kelch-like protein; Provisional 94.84
KOG2079|consensus 1206 94.59
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 94.58
COG1520370 FOG: WD40-like repeat [Function unknown] 94.56
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 94.48
KOG2444|consensus238 94.14
PRK13684334 Ycf48-like protein; Provisional 93.83
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 93.8
COG3204316 Uncharacterized protein conserved in bacteria [Fun 93.77
PHA02790480 Kelch-like protein; Provisional 93.73
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 93.24
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 93.18
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 93.11
KOG2395|consensus 644 93.09
PRK10115 686 protease 2; Provisional 93.03
KOG3630|consensus 1405 92.37
COG3823262 Glutamine cyclotransferase [Posttranslational modi 92.36
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 92.35
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 91.85
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 91.83
PHA02790480 Kelch-like protein; Provisional 91.83
PF14727418 PHTB1_N: PTHB1 N-terminus 91.73
KOG4499|consensus310 91.5
COG5276370 Uncharacterized conserved protein [Function unknow 91.49
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 91.47
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 91.41
KOG2444|consensus238 91.16
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 90.65
COG5167776 VID27 Protein involved in vacuole import and degra 90.57
TIGR02604 367 Piru_Ver_Nterm putative membrane-bound dehydrogena 90.24
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 89.37
KOG1983|consensus 993 89.07
KOG3630|consensus 1405 88.9
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 88.71
COG3292 671 Predicted periplasmic ligand-binding sensor domain 88.58
KOG1898|consensus 1205 88.31
KOG2247|consensus 615 88.14
KOG2247|consensus 615 87.98
PLN02153341 epithiospecifier protein 86.81
PF14727418 PHTB1_N: PTHB1 N-terminus 86.27
PF02333381 Phytase: Phytase; InterPro: IPR003431 Phytase (3.1 86.03
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 85.71
PLN02193470 nitrile-specifier protein 85.3
PLN00033398 photosystem II stability/assembly factor; Provisio 84.33
COG5290 1243 IkappaB kinase complex, IKAP component [Transcript 84.26
KOG1916|consensus 1283 84.23
PLN02153341 epithiospecifier protein 84.05
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 83.94
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 83.68
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 83.62
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 83.25
PLN00033398 photosystem II stability/assembly factor; Provisio 82.8
KOG4460|consensus 741 80.95
PF11715 547 Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 80.35
>KOG0305|consensus Back     alignment and domain information
Probab=100.00  E-value=2.7e-57  Score=508.77  Aligned_cols=438  Identities=52%  Similarity=0.885  Sum_probs=377.5

Q ss_pred             CCCCCCceeCCCCC-ccchhhhccccCCCCCCCCCCCcccccCccccccHHHHHHHHhcccCCCcCCCCCCCCCcccccC
Q psy10114        371 LEVKADRYIPSRCG-EKWQTRFSFIPDNRTCSVVPKKTREVSGETSRDGLAYTCLLRNELLGANIEGVKGQCDEKRVIFS  449 (819)
Q Consensus       371 ~~~~~dRfiP~r~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~el~~~~~~~~~~~~~~~~~~~~  449 (819)
                      ...++|||||+|.+ .+++..++.+..    ...+.+ +...+.....+..+..++++|++++. . ...+.....-+..
T Consensus        42 ~~~~~~rf~P~r~~~~~~~~~~~~~~~----~~~~~~-~~~~~~~~~~~~~~~~l~~~e~~~~~-~-~~~~~~~~~~~~~  114 (484)
T KOG0305|consen   42 SSKVGDRFIPSRLSSEEFNRNFKYIGS----FSRPNK-RSALDTGRESSSLAASLLRSELFKSN-K-ITSEQSLRALPDE  114 (484)
T ss_pred             ccccCCccCCcccchhhcccccccccc----cccccc-ccccccccccchhhhhhhhhhhhccC-c-cchhhhhhhccCC
Confidence            35789999999998 588888776643    111111 11101111234566689999999987 2 2222222222455


Q ss_pred             CCccccccccCCCCCCCCcCCCCceeeCCCCccchhhhcCCcccceeccCCCceeecCCCcCCcceEEEEEecCCeEEEE
Q psy10114        450 PDRRNLFQYLPAPESRMNIEATSPYSLSPVGPKSQKLLRSPRKATRKISRIPFKVLDAPELQDDFYLNLVDWSSQNVLSV  529 (819)
Q Consensus       450 p~~~~Lf~y~~~~~~~~~~~~~~~~~lsP~s~~s~~Ll~s~~k~~r~I~~~P~kvLdap~l~dDfyv~~ldwS~~~LLa~  529 (819)
                      |.++++|.|....+.+ ......++...|.......+..++++..|+++..|+++||||++++|||.+.++|+..+++++
T Consensus       115 ~~~~~i~~~~~~~~~~-~~~~~~~~~~~~~~~s~~~~~~~~r~~~r~~~~~p~rvLDaP~l~dDfY~nlldWss~n~laV  193 (484)
T KOG0305|consen  115 PNRDRILTYKSKAPRP-RSRTQEPDSVYPSAESSIRLLSSPRKLKRKIPQTPYRVLDAPGLQDDFYLNLLDWSSANVLAV  193 (484)
T ss_pred             ccccceeEecccCCCC-ccccccccccccccccccccccccccccCcccCChhhhccCCcccccHhhhHhhcccCCeEEE
Confidence            5568999999877653 234455556667777777788888999999999999999999999999999999999999999


Q ss_pred             ECCCeEEEEEcCCCceEEEEeccCCCCCeEEEEEcCCCCEEEEEecCceEEEeecCCceEEEEEec-CCCCeEEEEeCCc
Q psy10114        530 GLGSCVYLWSACTSQVTRLCDLSADGNSVTSVAWNERGNLVAVGTHHGYVQVWDVSVAKQVHKLVG-HTARVGALAWNGD  608 (819)
Q Consensus       530 g~Dg~V~LWd~~tg~~~~l~~l~~h~~~VtsLafSpdG~~LAsGs~DGtI~IWDl~tgk~i~tl~g-Hs~~V~sLawng~  608 (819)
                      +.+..|++|+..++++..++++.  ++.|+++.|+++|.+||+|..+|.|.|||.++.+.++.+.+ |.++|.+++|++.
T Consensus       194 alg~~vylW~~~s~~v~~l~~~~--~~~vtSv~ws~~G~~LavG~~~g~v~iwD~~~~k~~~~~~~~h~~rvg~laW~~~  271 (484)
T KOG0305|consen  194 ALGQSVYLWSASSGSVTELCSFG--EELVTSVKWSPDGSHLAVGTSDGTVQIWDVKEQKKTRTLRGSHASRVGSLAWNSS  271 (484)
T ss_pred             EecceEEEEecCCCceEEeEecC--CCceEEEEECCCCCEEEEeecCCeEEEEehhhccccccccCCcCceeEEEeccCc
Confidence            99999999999999999988876  78999999999999999999999999999999999999998 9999999999999


Q ss_pred             eeeeccCCCeEEEEECCCCCccceEEEecccCCeEEEEECCCCCEEEEEECCCeEEEEECCCCceeEEEecCCCCEEEEE
Q psy10114        609 MLSSGSRDRMILQRDVRTPNSQSERRLVGHRQEVCGLKWSPDNQYLASGGNDNRLYVWNLHSMSPLQTYTEHLAAVKAIA  688 (819)
Q Consensus       609 ~LaSGS~DGtI~IWDi~t~~~~~v~~l~gH~~~VtsLafSpdg~~LaSGS~DGtI~IWDl~t~~~i~t~~~h~~~VtsLa  688 (819)
                      .+.+|+.||.|.++|++..+.... .+.+|.++||+++|++|++++|+|++|+.+.|||....+++..+.+|.++|++++
T Consensus       272 ~lssGsr~~~I~~~dvR~~~~~~~-~~~~H~qeVCgLkws~d~~~lASGgnDN~~~Iwd~~~~~p~~~~~~H~aAVKA~a  350 (484)
T KOG0305|consen  272 VLSSGSRDGKILNHDVRISQHVVS-TLQGHRQEVCGLKWSPDGNQLASGGNDNVVFIWDGLSPEPKFTFTEHTAAVKALA  350 (484)
T ss_pred             eEEEecCCCcEEEEEEecchhhhh-hhhcccceeeeeEECCCCCeeccCCCccceEeccCCCccccEEEeccceeeeEee
Confidence            999999999999999999875433 6899999999999999999999999999999999999999999999999999999


Q ss_pred             EcCCCCeEEEEEccCCCCeEEEEECCCCceeEEEcCCCCeEEEEEccCCCEEEEEEecCCCeEEEEECCCCcEEEEEecC
Q psy10114        689 WSPHHHGLLASGGGTADRCIRFWNTLTGQPMQCVDTGSQVCNLAWSKHSSELVSTHGYSQNQILVWKYPTLTQVAKLTGH  768 (819)
Q Consensus       689 fSPdg~~LLaSGgGs~DgtIrIWDl~tg~~v~~l~~~s~V~sLafSpdg~~LastsGssDg~I~IWDl~s~k~l~sl~gH  768 (819)
                      |+|....++|+|||+.|++|++||..+|+.+..++++++|+++.|++..+++++++|+.++.|.||++++.+++..+.+|
T Consensus       351 wcP~q~~lLAsGGGs~D~~i~fwn~~~g~~i~~vdtgsQVcsL~Wsk~~kEi~sthG~s~n~i~lw~~ps~~~~~~l~gH  430 (484)
T KOG0305|consen  351 WCPWQSGLLATGGGSADRCIKFWNTNTGARIDSVDTGSQVCSLIWSKKYKELLSTHGYSENQITLWKYPSMKLVAELLGH  430 (484)
T ss_pred             eCCCccCceEEcCCCcccEEEEEEcCCCcEecccccCCceeeEEEcCCCCEEEEecCCCCCcEEEEeccccceeeeecCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCEEEEEEecCCCEEEEEeCCCcEEEEECCCCceecc---ccccccchhccCC
Q psy10114        769 SYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKVRSQR---ESKSVLNLFSSIR  819 (819)
Q Consensus       769 ~~~VtsLafSpDG~~LaSGS~DGtIrIWdl~s~~~~~k---~~~s~l~~fs~IR  819 (819)
                      ..+|.++++||||..+++|+.|++++||++++....+.   +..+.+..+..+|
T Consensus       431 ~~RVl~la~SPdg~~i~t~a~DETlrfw~~f~~~~~~~~~~~~~s~~~~~~~iR  484 (484)
T KOG0305|consen  431 TSRVLYLALSPDGETIVTGAADETLRFWNLFDERPKSTKKKENTSVLSLTSGIR  484 (484)
T ss_pred             cceeEEEEECCCCCEEEEecccCcEEeccccCCCCccccccccccccccccccC
Confidence            99999999999999999999999999999998544333   3455666666665



>KOG0650|consensus Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>PF08145 BOP1NT: BOP1NT (NUC169) domain; InterPro: IPR012953 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG1897|consensus Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>KOG1897|consensus Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>KOG3630|consensus Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>KOG1983|consensus Back     alignment and domain information
>KOG3630|consensus Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>COG3292 Predicted periplasmic ligand-binding sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1898|consensus Back     alignment and domain information
>KOG2247|consensus Back     alignment and domain information
>KOG2247|consensus Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3 Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>COG5290 IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG1916|consensus Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>KOG4460|consensus Back     alignment and domain information
>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query819
4gga_A420 Structural Analysis Of Human Cdc20 Supports Multi-S 1e-90
4ggd_A431 Structural Analysis Of Human Cdc20 Supports Multisi 1e-90
4ggc_A318 Structural Analysis Of Human Cdc20 Supports Multi-S 2e-89
4aez_A401 Crystal Structure Of Mitotic Checkpoint Complex Len 3e-76
2ymu_A577 Structure Of A Highly Repetitive Propeller Structur 3e-20
2ymu_A 577 Structure Of A Highly Repetitive Propeller Structur 1e-17
1p22_A435 Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex 1e-16
1vyh_C410 Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 3e-13
1vyh_C 410 Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 2e-06
3sfz_A 1249 Crystal Structure Of Full-Length Murine Apaf-1 Leng 3e-13
3sfz_A 1249 Crystal Structure Of Full-Length Murine Apaf-1 Leng 3e-08
3shf_A 1256 Crystal Structure Of The R265s Mutant Of Full-Lengt 4e-13
3shf_A 1256 Crystal Structure Of The R265s Mutant Of Full-Lengt 3e-08
2g99_A308 Structural Basis For The Specific Recognition Of Me 4e-13
2g99_A 308 Structural Basis For The Specific Recognition Of Me 4e-10
3emh_A318 Structural Basis Of Wdr5-Mll Interaction Length = 3 4e-13
3emh_A 318 Structural Basis Of Wdr5-Mll Interaction Length = 3 5e-10
2xl2_A334 Wdr5 In Complex With An Rbbp5 Peptide Recruited To 4e-13
2xl2_A 334 Wdr5 In Complex With An Rbbp5 Peptide Recruited To 5e-10
2cnx_A315 Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2. 5e-13
2cnx_A 315 Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2. 8e-10
2h9l_A329 Wdr5delta23 Length = 329 5e-13
2h9l_A 329 Wdr5delta23 Length = 329 4e-10
2h68_A312 Histone H3 Recognition And Presentation By The Wdr5 5e-13
2h68_A 312 Histone H3 Recognition And Presentation By The Wdr5 4e-10
3smr_A312 Crystal Structure Of Human Wd Repeat Domain 5 With 5e-13
3smr_A 312 Crystal Structure Of Human Wd Repeat Domain 5 With 4e-10
2gnq_A336 Structure Of Wdr5 Length = 336 5e-13
2gnq_A 336 Structure Of Wdr5 Length = 336 5e-10
2h9m_A313 Wdr5 In Complex With Unmodified H3k4 Peptide Length 5e-13
2h9m_A 313 Wdr5 In Complex With Unmodified H3k4 Peptide Length 4e-10
4a7j_A318 Symmetric Dimethylation Of H3 Arginine 2 Is A Novel 5e-13
4a7j_A 318 Symmetric Dimethylation Of H3 Arginine 2 Is A Novel 4e-10
2g9a_A311 Structural Basis For The Specific Recognition Of Me 5e-13
2g9a_A 311 Structural Basis For The Specific Recognition Of Me 4e-10
2h13_A317 Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length 7e-13
2h13_A 317 Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length 5e-10
3psl_A318 Fine-Tuning The Stimulation Of Mll1 Methyltransfera 7e-13
3psl_A 318 Fine-Tuning The Stimulation Of Mll1 Methyltransfera 5e-10
2co0_A315 Wdr5 And Unmodified Histone H3 Complex At 2.25 Angs 9e-13
2co0_A 315 Wdr5 And Unmodified Histone H3 Complex At 2.25 Angs 9e-10
3mxx_A315 Crystal Structure Of Wdr5 Mutant (S62a) Length = 31 1e-12
3mxx_A 315 Crystal Structure Of Wdr5 Mutant (S62a) Length = 31 1e-09
3dm0_A694 Maltose Binding Protein Fusion With Rack1 From A. T 2e-12
3izb_a319 Localization Of The Small Subunit Ribosomal Protein 2e-12
3jyv_R313 Structure Of The 40s Rrna And Proteins And PE TRNA 2e-12
3rfg_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 2e-12
3rfh_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 2e-12
1erj_A393 Crystal Structure Of The C-Terminal Wd40 Domain Of 6e-12
3n0e_A315 Crystal Structure Of Wdr5 Mutant (W330y) Length = 3 7e-12
3n0e_A 315 Crystal Structure Of Wdr5 Mutant (W330y) Length = 3 5e-10
3n0d_A315 Crystal Structure Of Wdr5 Mutant (W330f) Length = 3 9e-12
3n0d_A 315 Crystal Structure Of Wdr5 Mutant (W330f) Length = 3 5e-10
1a0r_B340 Heterotrimeric Complex Of PhosducinTRANSDUCIN BETA- 9e-12
1a0r_B 340 Heterotrimeric Complex Of PhosducinTRANSDUCIN BETA- 2e-05
1trj_A314 Homology Model Of Yeast Rack1 Protein Fitted Into 1 1e-11
1got_B340 Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimer 1e-11
1got_B 340 Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimer 2e-05
3sn6_B351 Crystal Structure Of The Beta2 Adrenergic Receptor- 1e-11
3sn6_B 351 Crystal Structure Of The Beta2 Adrenergic Receptor- 2e-05
1gg2_B340 G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Bet 1e-11
1gg2_B 340 G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Bet 2e-05
2bcj_B340 Crystal Structure Of G Protein-coupled Receptor Kin 1e-11
2bcj_B 340 Crystal Structure Of G Protein-coupled Receptor Kin 2e-05
2ovp_B445 Structure Of The Skp1-Fbw7 Complex Length = 445 2e-11
2xyi_A430 Crystal Structure Of Nurf55 In Complex With A H4 Pe 4e-11
3c99_A432 Structural Basis Of Histone H4 Recognition By P55 L 5e-11
2yba_A422 Crystal Structure Of Nurf55 In Complex With Histone 5e-11
3iza_B 1263 Structure Of An Apoptosome-Procaspase-9 Card Comple 5e-11
3iza_B 1263 Structure Of An Apoptosome-Procaspase-9 Card Comple 2e-07
3frx_A319 Crystal Structure Of The Yeast Orthologue Of Rack1, 1e-10
3zey_7318 High-resolution Cryo-electron Microscopy Structure 2e-10
2xzm_R343 Crystal Structure Of The Eukaryotic 40s Ribosomal S 6e-10
4aow_A340 Crystal Structure Of The Human Rack1 Protein At A R 8e-10
2zkq_a317 Structure Of A Mammalian Ribosomal 40s Subunit With 9e-10
3cfs_B414 Structural Basis Of The Interaction Of Rbap46RBAP48 2e-09
3cfs_B414 Structural Basis Of The Interaction Of Rbap46RBAP48 1e-07
2yno_A310 Yeast Betaprime Cop 1-304h6 Length = 310 2e-09
2ynn_A304 Yeast Betaprime Cop 1-304 With Ktktn Motif Length = 2e-09
3gfc_A425 Crystal Structure Of Histone-Binding Protein Rbbp4 2e-09
3gfc_A425 Crystal Structure Of Histone-Binding Protein Rbbp4 3e-08
2pbi_B354 The Multifunctional Nature Of Gbeta5RGS9 REVEALED F 4e-09
3fm0_A 345 Crystal Structure Of Wd40 Protein Ciao1 Length = 34 5e-09
3cfv_B414 Structural Basis Of The Interaction Of Rbap46RBAP48 5e-09
3cfv_B414 Structural Basis Of The Interaction Of Rbap46RBAP48 1e-07
2ynp_A 604 Yeast Betaprime Cop 1-604 With Ktktn Motif Length = 6e-09
3mkq_A 814 Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subco 7e-09
3iz6_a380 Localization Of The Small Subunit Ribosomal Protein 8e-08
1nr0_A611 Two Seven-Bladed Beta-Propeller Domains Revealed By 1e-06
1nr0_A 611 Two Seven-Bladed Beta-Propeller Domains Revealed By 2e-06
3jro_A 753 Nup84-Nup145c-Sec13 Edge Element Of The Npc Lattice 7e-06
3mks_B 464 Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH 8e-06
3ow8_A321 Crystal Structure Of The Wd Repeat-Containing Prote 9e-06
3ow8_A321 Crystal Structure Of The Wd Repeat-Containing Prote 6e-04
3jrp_A 379 Sec13 With Nup145c (Aa109-179) Insertion Blade Leng 2e-05
1gxr_A337 Wd40 Region Of Human Groucho/tle1 Length = 337 2e-05
2aq5_A402 Crystal Structure Of Murine Coronin-1 Length = 402 3e-05
2b4e_A402 Crystal Structure Of Murine Coronin-1: Monoclinic F 3e-05
2pm6_B297 Crystal Structure Of Yeast Sec1331 EDGE ELEMENT OF 3e-05
1nex_B 464 Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Comp 5e-05
1nex_B 464 Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Comp 1e-04
2pm9_B297 Crystal Structure Of Yeast Sec1331 VERTEX ELEMENT O 5e-05
2hes_X330 Cytosolic Iron-sulphur Assembly Protein- 1 Length = 7e-05
2pm7_B297 Crystal Structure Of Yeast Sec1331 EDGE ELEMENT OF 1e-04
4a11_B408 Structure Of The Hsddb1-Hscsa Complex Length = 408 2e-04
2pm9_A416 Crystal Structure Of Yeast Sec1331 VERTEX ELEMENT O 3e-04
>pdb|4GGA|A Chain A, Structural Analysis Of Human Cdc20 Supports Multi-Site Degron Recognition By ApcC Length = 420 Back     alignment and structure

Iteration: 1

Score = 331 bits (849), Expect = 1e-90, Method: Compositional matrix adjust. Identities = 164/330 (49%), Positives = 217/330 (65%), Gaps = 8/330 (2%) Query: 489 SPRKATRKISRIPFKVLDAPELQDDFYLNLVDWSSQNVLSVGLGSCVYLWSACTSQVTRL 548 S RK R I +P ++LDAPE+++D+YLNLVDWSS NVL+V L + VYLWSA + + +L Sbjct: 81 SSRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQL 140 Query: 549 CDLSADGNSVTSVAWNERGNLVAVGTHHGYVQVWDVSVAKQVHKLVGHTARVGALAWNGD 608 + G ++SVAW + GN +AVGT VQ+WDV K++ + H+ARVG+L+WN Sbjct: 141 LQMEQPGEYISSVAWIKEGNYLAVGTSSAEVQLWDVQQQKRLRNMTSHSARVGSLSWNSY 200 Query: 609 MLSSGSRDRMILQRDVRTPNSQSERRLVGHRQEVCGLKWSPDNQYLASGGNDNRLYVW-- 666 +LSSGSR I DVR L GH QEVCGL+W+PD ++LASGGNDN + VW Sbjct: 201 ILSSGSRSGHIHHHDVRVAEHHVAT-LSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPS 259 Query: 667 --NLHSMSPLQTYTEHLAAVKAIAWSPHHHGLLASGGGTADRCIRFWNTLTGQPMQCVDT 724 PLQT+T+H AVKA+AW P +LA+GGGT+DR IR WN +G + VD Sbjct: 260 APGEGGWVPLQTFTQHQGAVKAVAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDA 319 Query: 725 GSQVCNLAWSKHSSELVSTHGYSQNQILVWKYPTLTQVAKLTGHSYRVLYLAMSPDGEAI 784 SQVC++ WS H EL+S HG++QNQ+++WKYPT+ +VA+L GH+ RVL L MSPDG + Sbjct: 320 HSQVCSILWSPHYKELISGHGFAQNQLVIWKYPTMAKVAELKGHTSRVLSLTMSPDGATV 379 Query: 785 VTGAGDETLRFWNVFS---KVRSQRESKSV 811 + A DETLR W F R +RE S Sbjct: 380 ASAAADETLRLWRCFELDPARRREREKASA 409
>pdb|4GGD|A Chain A, Structural Analysis Of Human Cdc20 Supports Multisite Degron Recognition By ApcC. Length = 431 Back     alignment and structure
>pdb|4GGC|A Chain A, Structural Analysis Of Human Cdc20 Supports Multi-Site Degron Recognition By ApcC Length = 318 Back     alignment and structure
>pdb|4AEZ|A Chain A, Crystal Structure Of Mitotic Checkpoint Complex Length = 401 Back     alignment and structure
>pdb|2YMU|A Chain A, Structure Of A Highly Repetitive Propeller Structure Length = 577 Back     alignment and structure
>pdb|2YMU|A Chain A, Structure Of A Highly Repetitive Propeller Structure Length = 577 Back     alignment and structure
>pdb|1P22|A Chain A, Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex: Destruction Motif Binding And Lysine Specificity On The Scfbeta-Trcp1 Ubiquitin Ligase Length = 435 Back     alignment and structure
>pdb|1VYH|C Chain C, Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 Back     alignment and structure
>pdb|1VYH|C Chain C, Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 Back     alignment and structure
>pdb|3SFZ|A Chain A, Crystal Structure Of Full-Length Murine Apaf-1 Length = 1249 Back     alignment and structure
>pdb|3SFZ|A Chain A, Crystal Structure Of Full-Length Murine Apaf-1 Length = 1249 Back     alignment and structure
>pdb|3SHF|A Chain A, Crystal Structure Of The R265s Mutant Of Full-Length Murine Apaf-1 Length = 1256 Back     alignment and structure
>pdb|3SHF|A Chain A, Crystal Structure Of The R265s Mutant Of Full-Length Murine Apaf-1 Length = 1256 Back     alignment and structure
>pdb|2G99|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 308 Back     alignment and structure
>pdb|2G99|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 308 Back     alignment and structure
>pdb|3EMH|A Chain A, Structural Basis Of Wdr5-Mll Interaction Length = 318 Back     alignment and structure
>pdb|3EMH|A Chain A, Structural Basis Of Wdr5-Mll Interaction Length = 318 Back     alignment and structure
>pdb|2XL2|A Chain A, Wdr5 In Complex With An Rbbp5 Peptide Recruited To Novel Site Length = 334 Back     alignment and structure
>pdb|2XL2|A Chain A, Wdr5 In Complex With An Rbbp5 Peptide Recruited To Novel Site Length = 334 Back     alignment and structure
>pdb|2CNX|A Chain A, Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2.1 Angstrom Length = 315 Back     alignment and structure
>pdb|2CNX|A Chain A, Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2.1 Angstrom Length = 315 Back     alignment and structure
>pdb|2H9L|A Chain A, Wdr5delta23 Length = 329 Back     alignment and structure
>pdb|2H9L|A Chain A, Wdr5delta23 Length = 329 Back     alignment and structure
>pdb|2H68|A Chain A, Histone H3 Recognition And Presentation By The Wdr5 Module Of The Mll1 Complex Length = 312 Back     alignment and structure
>pdb|2H68|A Chain A, Histone H3 Recognition And Presentation By The Wdr5 Module Of The Mll1 Complex Length = 312 Back     alignment and structure
>pdb|3SMR|A Chain A, Crystal Structure Of Human Wd Repeat Domain 5 With Compound Length = 312 Back     alignment and structure
>pdb|3SMR|A Chain A, Crystal Structure Of Human Wd Repeat Domain 5 With Compound Length = 312 Back     alignment and structure
>pdb|2GNQ|A Chain A, Structure Of Wdr5 Length = 336 Back     alignment and structure
>pdb|2GNQ|A Chain A, Structure Of Wdr5 Length = 336 Back     alignment and structure
>pdb|2H9M|A Chain A, Wdr5 In Complex With Unmodified H3k4 Peptide Length = 313 Back     alignment and structure
>pdb|2H9M|A Chain A, Wdr5 In Complex With Unmodified H3k4 Peptide Length = 313 Back     alignment and structure
>pdb|4A7J|A Chain A, Symmetric Dimethylation Of H3 Arginine 2 Is A Novel Histone Mark That Supports Euchromatin Maintenance Length = 318 Back     alignment and structure
>pdb|4A7J|A Chain A, Symmetric Dimethylation Of H3 Arginine 2 Is A Novel Histone Mark That Supports Euchromatin Maintenance Length = 318 Back     alignment and structure
>pdb|2G9A|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 311 Back     alignment and structure
>pdb|2G9A|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 311 Back     alignment and structure
>pdb|2H13|A Chain A, Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length = 317 Back     alignment and structure
>pdb|2H13|A Chain A, Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length = 317 Back     alignment and structure
>pdb|3PSL|A Chain A, Fine-Tuning The Stimulation Of Mll1 Methyltransferase Activity By A Histone H3 Based Peptide Mimetic Length = 318 Back     alignment and structure
>pdb|3PSL|A Chain A, Fine-Tuning The Stimulation Of Mll1 Methyltransferase Activity By A Histone H3 Based Peptide Mimetic Length = 318 Back     alignment and structure
>pdb|2CO0|A Chain A, Wdr5 And Unmodified Histone H3 Complex At 2.25 Angstrom Length = 315 Back     alignment and structure
>pdb|2CO0|A Chain A, Wdr5 And Unmodified Histone H3 Complex At 2.25 Angstrom Length = 315 Back     alignment and structure
>pdb|3MXX|A Chain A, Crystal Structure Of Wdr5 Mutant (S62a) Length = 315 Back     alignment and structure
>pdb|3MXX|A Chain A, Crystal Structure Of Wdr5 Mutant (S62a) Length = 315 Back     alignment and structure
>pdb|3DM0|A Chain A, Maltose Binding Protein Fusion With Rack1 From A. Thaliana Length = 694 Back     alignment and structure
>pdb|3IZB|AA Chain a, Localization Of The Small Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 319 Back     alignment and structure
>pdb|3JYV|R Chain R, Structure Of The 40s Rrna And Proteins And PE TRNA FOR EUKARYOTIC Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 313 Back     alignment and structure
>pdb|3RFG|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P63 Length = 319 Back     alignment and structure
>pdb|3RFH|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P21 Length = 319 Back     alignment and structure
>pdb|1ERJ|A Chain A, Crystal Structure Of The C-Terminal Wd40 Domain Of Tup1 Length = 393 Back     alignment and structure
>pdb|3N0E|A Chain A, Crystal Structure Of Wdr5 Mutant (W330y) Length = 315 Back     alignment and structure
>pdb|3N0E|A Chain A, Crystal Structure Of Wdr5 Mutant (W330y) Length = 315 Back     alignment and structure
>pdb|3N0D|A Chain A, Crystal Structure Of Wdr5 Mutant (W330f) Length = 315 Back     alignment and structure
>pdb|3N0D|A Chain A, Crystal Structure Of Wdr5 Mutant (W330f) Length = 315 Back     alignment and structure
>pdb|1A0R|B Chain B, Heterotrimeric Complex Of PhosducinTRANSDUCIN BETA-Gamma Length = 340 Back     alignment and structure
>pdb|1A0R|B Chain B, Heterotrimeric Complex Of PhosducinTRANSDUCIN BETA-Gamma Length = 340 Back     alignment and structure
>pdb|1TRJ|A Chain A, Homology Model Of Yeast Rack1 Protein Fitted Into 11.7a Cryo-em Map Of Yeast 80s Ribosome Length = 314 Back     alignment and structure
>pdb|1GOT|B Chain B, Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimera And The Gt-Beta-Gamma Subunits Length = 340 Back     alignment and structure
>pdb|1GOT|B Chain B, Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimera And The Gt-Beta-Gamma Subunits Length = 340 Back     alignment and structure
>pdb|3SN6|B Chain B, Crystal Structure Of The Beta2 Adrenergic Receptor-Gs Protein Complex Length = 351 Back     alignment and structure
>pdb|3SN6|B Chain B, Crystal Structure Of The Beta2 Adrenergic Receptor-Gs Protein Complex Length = 351 Back     alignment and structure
>pdb|1GG2|B Chain B, G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Beta_1 Gamma_2 With Gdp Bound Length = 340 Back     alignment and structure
>pdb|1GG2|B Chain B, G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Beta_1 Gamma_2 With Gdp Bound Length = 340 Back     alignment and structure
>pdb|2BCJ|B Chain B, Crystal Structure Of G Protein-coupled Receptor Kinase 2 In Complex With Galpha-q And Gbetagamma Subunits Length = 340 Back     alignment and structure
>pdb|2BCJ|B Chain B, Crystal Structure Of G Protein-coupled Receptor Kinase 2 In Complex With Galpha-q And Gbetagamma Subunits Length = 340 Back     alignment and structure
>pdb|2OVP|B Chain B, Structure Of The Skp1-Fbw7 Complex Length = 445 Back     alignment and structure
>pdb|2XYI|A Chain A, Crystal Structure Of Nurf55 In Complex With A H4 Peptide Length = 430 Back     alignment and structure
>pdb|3C99|A Chain A, Structural Basis Of Histone H4 Recognition By P55 Length = 432 Back     alignment and structure
>pdb|2YBA|A Chain A, Crystal Structure Of Nurf55 In Complex With Histone H3 Length = 422 Back     alignment and structure
>pdb|3FRX|A Chain A, Crystal Structure Of The Yeast Orthologue Of Rack1, Asc1. Length = 319 Back     alignment and structure
>pdb|3ZEY|7 Chain 7, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 318 Back     alignment and structure
>pdb|2XZM|R Chain R, Crystal Structure Of The Eukaryotic 40s Ribosomal Subunit In Complex With Initiation Factor 1. This File Contains The 40s Subunit And Initiation Factor For Molecule 1 Length = 343 Back     alignment and structure
>pdb|4AOW|A Chain A, Crystal Structure Of The Human Rack1 Protein At A Resolution Of 2.45 Angstrom Length = 340 Back     alignment and structure
>pdb|2ZKQ|AA Chain a, Structure Of A Mammalian Ribosomal 40s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 317 Back     alignment and structure
>pdb|3CFS|B Chain B, Structural Basis Of The Interaction Of Rbap46RBAP48 WITH Histone H4 Length = 414 Back     alignment and structure
>pdb|3CFS|B Chain B, Structural Basis Of The Interaction Of Rbap46RBAP48 WITH Histone H4 Length = 414 Back     alignment and structure
>pdb|2YNO|A Chain A, Yeast Betaprime Cop 1-304h6 Length = 310 Back     alignment and structure
>pdb|2YNN|A Chain A, Yeast Betaprime Cop 1-304 With Ktktn Motif Length = 304 Back     alignment and structure
>pdb|3GFC|A Chain A, Crystal Structure Of Histone-Binding Protein Rbbp4 Length = 425 Back     alignment and structure
>pdb|3GFC|A Chain A, Crystal Structure Of Histone-Binding Protein Rbbp4 Length = 425 Back     alignment and structure
>pdb|2PBI|B Chain B, The Multifunctional Nature Of Gbeta5RGS9 REVEALED FROM ITS CRYSTAL Structure Length = 354 Back     alignment and structure
>pdb|3FM0|A Chain A, Crystal Structure Of Wd40 Protein Ciao1 Length = 345 Back     alignment and structure
>pdb|3CFV|B Chain B, Structural Basis Of The Interaction Of Rbap46RBAP48 WITH Histone H4 Length = 414 Back     alignment and structure
>pdb|3CFV|B Chain B, Structural Basis Of The Interaction Of Rbap46RBAP48 WITH Histone H4 Length = 414 Back     alignment and structure
>pdb|2YNP|A Chain A, Yeast Betaprime Cop 1-604 With Ktktn Motif Length = 604 Back     alignment and structure
>pdb|3MKQ|A Chain A, Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subcomplex Of The Copi Vesicular Coat Length = 814 Back     alignment and structure
>pdb|3IZ6|AA Chain a, Localization Of The Small Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 380 Back     alignment and structure
>pdb|1NR0|A Chain A, Two Seven-Bladed Beta-Propeller Domains Revealed By The Structure Of A C. Elegans Homologue Of Yeast Actin Interacting Protein 1 (Aip1). Length = 611 Back     alignment and structure
>pdb|1NR0|A Chain A, Two Seven-Bladed Beta-Propeller Domains Revealed By The Structure Of A C. Elegans Homologue Of Yeast Actin Interacting Protein 1 (Aip1). Length = 611 Back     alignment and structure
>pdb|3JRO|A Chain A, Nup84-Nup145c-Sec13 Edge Element Of The Npc Lattice Length = 753 Back     alignment and structure
>pdb|3MKS|B Chain B, Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH AN ALLOSTERIC Inhibitor Scf-I2 Length = 464 Back     alignment and structure
>pdb|3OW8|A Chain A, Crystal Structure Of The Wd Repeat-Containing Protein 61 Length = 321 Back     alignment and structure
>pdb|3OW8|A Chain A, Crystal Structure Of The Wd Repeat-Containing Protein 61 Length = 321 Back     alignment and structure
>pdb|3JRP|A Chain A, Sec13 With Nup145c (Aa109-179) Insertion Blade Length = 379 Back     alignment and structure
>pdb|1GXR|A Chain A, Wd40 Region Of Human Groucho/tle1 Length = 337 Back     alignment and structure
>pdb|2AQ5|A Chain A, Crystal Structure Of Murine Coronin-1 Length = 402 Back     alignment and structure
>pdb|2B4E|A Chain A, Crystal Structure Of Murine Coronin-1: Monoclinic Form Length = 402 Back     alignment and structure
>pdb|2PM6|B Chain B, Crystal Structure Of Yeast Sec1331 EDGE ELEMENT OF THE Copii Vesicular Coat, Native Version Length = 297 Back     alignment and structure
>pdb|1NEX|B Chain B, Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Complex Length = 464 Back     alignment and structure
>pdb|1NEX|B Chain B, Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Complex Length = 464 Back     alignment and structure
>pdb|2PM9|B Chain B, Crystal Structure Of Yeast Sec1331 VERTEX ELEMENT OF THE Copii Vesicular Coat Length = 297 Back     alignment and structure
>pdb|2HES|X Chain X, Cytosolic Iron-sulphur Assembly Protein- 1 Length = 330 Back     alignment and structure
>pdb|2PM7|B Chain B, Crystal Structure Of Yeast Sec1331 EDGE ELEMENT OF THE Copii Vesicular Coat, Selenomethionine Version Length = 297 Back     alignment and structure
>pdb|4A11|B Chain B, Structure Of The Hsddb1-Hscsa Complex Length = 408 Back     alignment and structure
>pdb|2PM9|A Chain A, Crystal Structure Of Yeast Sec1331 VERTEX ELEMENT OF THE Copii Vesicular Coat Length = 416 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query819
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 100.0
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 100.0
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 100.0
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 100.0
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 100.0
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
2pm7_B297 Protein transport protein SEC13, protein transport 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
4e54_B435 DNA damage-binding protein 2; beta barrel, double 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 100.0
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 100.0
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 100.0
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
3jrp_A379 Fusion protein of protein transport protein SEC13 100.0
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 100.0
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 100.0
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 100.0
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 100.0
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.98
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.98
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.98
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.98
2pm7_B297 Protein transport protein SEC13, protein transport 99.98
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 99.98
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.97
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.97
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.97
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.97
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.97
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.97
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.97
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.97
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.97
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.97
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.97
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.97
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.97
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.97
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.97
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.97
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 99.97
3jrp_A379 Fusion protein of protein transport protein SEC13 99.97
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.97
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 99.97
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.97
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.97
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.97
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.97
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.97
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.96
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.96
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.96
3jro_A 753 Fusion protein of protein transport protein SEC13 99.96
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.96
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.96
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.96
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.96
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.95
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.95
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.95
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.95
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.95
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.95
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.95
3jro_A 753 Fusion protein of protein transport protein SEC13 99.95
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.95
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.95
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.95
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.94
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.94
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.94
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.93
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.92
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.92
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.91
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.91
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.91
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.9
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.9
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.9
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.89
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.89
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.89
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.88
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.87
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.86
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.86
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.86
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.86
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.85
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.84
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.84
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.83
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.83
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.83
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.83
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.8
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.8
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.8
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.8
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.8
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.79
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.79
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.79
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.78
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.77
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.77
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.75
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.75
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.73
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.7
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.7
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.7
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.7
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.68
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.67
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.67
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.66
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.66
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.66
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.65
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.64
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.63
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.59
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.59
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.58
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.58
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.57
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 99.55
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.55
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.53
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.52
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.51
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.51
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.51
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.5
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.5
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.5
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.46
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.45
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.45
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.45
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.42
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.4
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.39
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.37
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.37
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.36
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.34
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.31
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.3
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 99.29
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.29
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.28
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 99.28
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.23
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.23
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 99.21
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.2
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.2
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 99.19
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 99.19
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.19
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 99.17
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 99.16
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.16
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.12
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 99.11
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 99.06
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 99.06
2qe8_A343 Uncharacterized protein; structural genomics, join 99.05
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.03
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 98.99
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.96
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.96
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.93
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 98.92
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.9
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.9
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 98.89
2ece_A462 462AA long hypothetical selenium-binding protein; 98.86
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.85
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.85
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 98.85
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 98.84
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 98.83
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.77
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.76
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 98.76
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 98.75
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.71
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 98.71
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.67
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.67
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 98.64
2qe8_A343 Uncharacterized protein; structural genomics, join 98.63
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 98.63
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.55
2ece_A462 462AA long hypothetical selenium-binding protein; 98.55
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.53
2p4o_A306 Hypothetical protein; putative lactonase, structur 98.52
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 98.51
4a2l_A 795 BT_4663, two-component system sensor histidine kin 98.5
4a2l_A 795 BT_4663, two-component system sensor histidine kin 98.47
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 98.47
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.46
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 98.39
3v65_B386 Low-density lipoprotein receptor-related protein; 98.34
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.34
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 98.34
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 98.33
3v9f_A 781 Two-component system sensor histidine kinase/RESP 98.32
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 98.29
3v9f_A 781 Two-component system sensor histidine kinase/RESP 98.29
3p5b_L400 Low density lipoprotein receptor variant; B-propel 98.26
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.26
3v65_B386 Low-density lipoprotein receptor-related protein; 98.22
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.15
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.14
3p5b_L400 Low density lipoprotein receptor variant; B-propel 98.12
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 98.11
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 98.07
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 98.06
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 98.06
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 98.04
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 98.03
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 97.99
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 97.96
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 97.86
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 97.82
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 97.8
2p4o_A306 Hypothetical protein; putative lactonase, structur 97.74
3kya_A496 Putative phosphatase; structural genomics, joint c 97.72
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 97.69
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 97.66
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 97.66
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 97.66
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 97.59
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 97.59
3ei3_A 1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 97.58
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 97.53
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 97.51
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 97.51
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 97.47
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 97.42
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 97.4
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 97.39
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 97.36
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 97.35
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 97.32
1bpo_A 494 Protein (clathrin); clathrin endocytosis beta-prop 97.29
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 97.25
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 97.21
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 97.21
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 97.12
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 97.03
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 97.02
3kya_A496 Putative phosphatase; structural genomics, joint c 96.88
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 96.87
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 96.83
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 96.75
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 96.74
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 96.69
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 96.64
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 96.6
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 96.59
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 96.47
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 96.36
3ott_A 758 Two-component system sensor histidine kinase; beta 96.36
1bpo_A494 Protein (clathrin); clathrin endocytosis beta-prop 96.34
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 96.22
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 96.14
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 95.96
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 95.88
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 95.8
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 95.7
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 95.69
3sbq_A 638 Nitrous-oxide reductase; beta-propeller, cupredoxi 95.64
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 95.56
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 95.41
3pbp_A452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 95.28
2be1_A339 Serine/threonine-protein kinase/endoribonuclease; 95.15
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 95.02
2be1_A339 Serine/threonine-protein kinase/endoribonuclease; 94.93
3ott_A 758 Two-component system sensor histidine kinase; beta 94.93
3ei3_A 1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 94.63
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 94.53
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 94.28
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 93.87
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 93.62
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 93.45
2g8s_A 353 Glucose/sorbosone dehydrogenases; bladed beta-prop 93.07
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 92.9
3sbq_A 638 Nitrous-oxide reductase; beta-propeller, cupredoxi 91.95
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 91.1
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 90.11
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 89.91
4hvt_A 711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 86.88
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 83.69
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
Probab=100.00  E-value=1.1e-51  Score=457.86  Aligned_cols=318  Identities=51%  Similarity=0.922  Sum_probs=294.4

Q ss_pred             cCCcccceeccCCCceeecCCCcCCcceEEEEEecCCeEEEEECCCeEEEEEcCCCceEEEEeccCCCCCeEEEEEcCCC
Q psy10114        488 RSPRKATRKISRIPFKVLDAPELQDDFYLNLVDWSSQNVLSVGLGSCVYLWSACTSQVTRLCDLSADGNSVTSVAWNERG  567 (819)
Q Consensus       488 ~s~~k~~r~I~~~P~kvLdap~l~dDfyv~~ldwS~~~LLa~g~Dg~V~LWd~~tg~~~~l~~l~~h~~~VtsLafSpdG  567 (819)
                      .++++..|+|+..|+++||||++++|||+++++|+.++++++|.|++|+|||+.+++..+++.+.+|.+.|++++|+|+|
T Consensus        80 ~~~~~~~r~i~~~p~~~l~ap~~~~d~y~~~l~wS~~n~lAvgld~tV~lWd~~tg~~~~~~~~~~~~~~V~sv~fspdg  159 (420)
T 4gga_A           80 GSSRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGEYISSVAWIKEG  159 (420)
T ss_dssp             ------CCCCCSSCSEEEECTTCCCCTTCBCEEECTTSEEEEEETTEEEEEETTTCCEEEEEECCSTTCCEEEEEECTTS
T ss_pred             CCccCCCcccCCCCceEEECCCCcccccceeEEECCCCEEEEEeCCEEEEEECCCCCEEEEEEecCCCCcEEEEEECCCC
Confidence            35567789999999999999999999999999999999999999999999999999999888888899999999999999


Q ss_pred             CEEEEEecCceEEEeecCCceEEEEEecCCCCeEEEEeCCceeeeccCCCeEEEEECCCCCccceEEEecccCCeEEEEE
Q psy10114        568 NLVAVGTHHGYVQVWDVSVAKQVHKLVGHTARVGALAWNGDMLSSGSRDRMILQRDVRTPNSQSERRLVGHRQEVCGLKW  647 (819)
Q Consensus       568 ~~LAsGs~DGtI~IWDl~tgk~i~tl~gHs~~V~sLawng~~LaSGS~DGtI~IWDi~t~~~~~v~~l~gH~~~VtsLaf  647 (819)
                      ++||+|+.||.|+|||+++++.++.+.+|...+.++++++..+++|+.|+.+++||..... .....+.+|...++++.|
T Consensus       160 ~~lasgs~Dg~v~iWd~~~~~~~~~~~~h~~~v~~~s~~~~~l~sgs~d~~i~~~d~~~~~-~~~~~~~~h~~~~~~~~~  238 (420)
T 4gga_A          160 NYLAVGTSSAEVQLWDVQQQKRLRNMTSHSARVGSLSWNSYILSSGSRSGHIHHHDVRVAE-HHVATLSGHSQEVCGLRW  238 (420)
T ss_dssp             SEEEEEETTSCEEEEETTTTEEEEEECCCSSCEEEEEEETTEEEEEETTSEEEEEETTSSS-CEEEEEECCSSCEEEEEE
T ss_pred             CEEEEEECCCeEEEEEcCCCcEEEEEeCCCCceEEEeeCCCEEEEEeCCCceeEeeecccc-eeeEEecccccceeeeee
Confidence            9999999999999999999999999999999999999999999999999999999998766 356788999999999999


Q ss_pred             CCCCCEEEEEECCCeEEEEECCCCc----eeEEEecCCCCEEEEEEcCCCCeEEEEEccCCCCeEEEEECCCCceeEEEc
Q psy10114        648 SPDNQYLASGGNDNRLYVWNLHSMS----PLQTYTEHLAAVKAIAWSPHHHGLLASGGGTADRCIRFWNTLTGQPMQCVD  723 (819)
Q Consensus       648 Spdg~~LaSGS~DGtI~IWDl~t~~----~i~t~~~h~~~VtsLafSPdg~~LLaSGgGs~DgtIrIWDl~tg~~v~~l~  723 (819)
                      +++++++++++.||.+++||..+++    .+.....|.+.|.+++|+|++..++++++|+.|++|++||+.+++....+.
T Consensus       239 ~~~g~~l~s~~~D~~v~i~~~~~~~~~~~~~~~~~~~~~~V~~~~~~p~~~~~la~~~gs~D~~I~iwd~~t~~~~~~~~  318 (420)
T 4gga_A          239 APDGRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVKAVAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVD  318 (420)
T ss_dssp             CTTSSEEEEEETTSCEEEEESSCCSSCSCCSEEECCCSSCEEEEEECTTCTTEEEEEECTTTCEEEEEETTTTEEEEEEE
T ss_pred             cCCCCeeeeeeccccceEEeeccccccceeeeeecccCCceeeeeeCCCcccEEEEEeecCCCEEEEEeCCccccceeec
Confidence            9999999999999999999998765    456778899999999999999999998888899999999999999999999


Q ss_pred             CCCCeEEEEEccCCCEEEEEEecCCCeEEEEECCCCcEEEEEecCCCCEEEEEEecCCCEEEEEeCCCcEEEEECCCCce
Q psy10114        724 TGSQVCNLAWSKHSSELVSTHGYSQNQILVWKYPTLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKVR  803 (819)
Q Consensus       724 ~~s~V~sLafSpdg~~LastsGssDg~I~IWDl~s~k~l~sl~gH~~~VtsLafSpDG~~LaSGS~DGtIrIWdl~s~~~  803 (819)
                      ....+.++.|+++++.+++++|+.|+.|++||+++++++.++.+|.+.|++++|+|||++|+||+.||+|+|||+++...
T Consensus       319 ~~~~v~~~~~~~~~~~lv~~sg~~d~~I~iwd~~~~~~v~~l~gH~~~V~~l~~spdg~~l~S~s~D~tvriWdv~~~~~  398 (420)
T 4gga_A          319 AHSQVCSILWSPHYKELISGHGFAQNQLVIWKYPTMAKVAELKGHTSRVLSLTMSPDGATVASAAADETLRLWRCFELDP  398 (420)
T ss_dssp             CSSCEEEEEEETTTTEEEEEECTTTCCEEEEETTTCCEEEEECCCSSCEEEEEECTTSSCEEEEETTTEEEEECCSCSSC
T ss_pred             cccceeeeeecCCCCeEEEEEecCCCEEEEEECCCCcEEEEEcCCCCCEEEEEEcCCCCEEEEEecCCeEEEEECCCCCc
Confidence            99999999999999999998888999999999999999999999999999999999999999999999999999987654


Q ss_pred             ecc
Q psy10114        804 SQR  806 (819)
Q Consensus       804 ~~k  806 (819)
                      ..+
T Consensus       399 ~~~  401 (420)
T 4gga_A          399 ARR  401 (420)
T ss_dssp             C--
T ss_pred             cch
Confidence            433



>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 819
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 3e-31
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 1e-21
d1vyhc1 317 b.69.4.1 (C:92-408) Platelet-activating factor ace 6e-17
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 1e-16
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 6e-04
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 5e-29
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 9e-15
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 4e-22
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 5e-13
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 2e-17
d1k8kc_ 371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 2e-10
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 3e-07
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 7e-07
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 2e-16
d2ovrb2 342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 1e-12
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 1e-11
d2ovrb2 342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 2e-04
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 3e-16
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 3e-09
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 2e-07
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 2e-15
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 7e-13
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 8e-11
d1gxra_ 337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 3e-07
d1gxra_ 337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 8e-04
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 1e-14
d1k32a3 360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 3e-09
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 3e-08
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 5e-07
d1k32a3 360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 8e-04
d1mdah_368 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 4e-14
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 7e-14
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 1e-08
d1pbyb_ 337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 9e-08
d1pbyb_ 337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 2e-07
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 1e-04
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 9e-13
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 3e-06
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 1e-05
d1yfqa_ 342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 9e-04
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 1e-12
d1sq9a_ 393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 6e-10
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 8e-10
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 4e-12
d1nexb2 355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 2e-11
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 1e-05
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 5e-05
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 1e-04
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 3e-04
d1qksa2 432 b.70.2.1 (A:136-567) C-terminal (heme d1) domain o 5e-12
d1qksa2 432 b.70.2.1 (A:136-567) C-terminal (heme d1) domain o 3e-04
d1qksa2432 b.70.2.1 (A:136-567) C-terminal (heme d1) domain o 3e-04
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 9e-12
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 3e-11
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 5e-11
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 7e-07
d1pgua1 325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 2e-06
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 3e-04
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 2e-10
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 3e-08
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 5e-04
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 3e-10
d1jmxb_ 346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 8e-10
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 2e-06
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 4e-06
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 0.003
d1nr0a2 299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 8e-10
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 3e-08
d1nr0a2 299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 0.002
d1l0qa2301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 1e-08
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 2e-07
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 1e-06
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 9e-06
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 0.001
d1hzua2426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 1e-06
d1hzua2 426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 1e-05
d1ri6a_ 333 b.69.11.1 (A:) Putative isomerase YbhE {Escherichi 1e-04
d1ri6a_333 b.69.11.1 (A:) Putative isomerase YbhE {Escherichi 1e-04
d1qnia2441 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-ter 3e-04
d2dg1a1319 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus 0.001
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Platelet-activating factor acetylhydrolase IB subunit alpha
species: Mouse (Mus musculus) [TaxId: 10090]
 Score =  122 bits (306), Expect = 3e-31
 Identities = 62/308 (20%), Positives = 109/308 (35%), Gaps = 66/308 (21%)

Query: 551 LSADGNSVTSVAWNERGNLVAVGTHHGYVQVWDVSVAKQVHKLVGHTARVGALAW----- 605
           LS   + VT V ++   +++   +    ++VWD         L GHT  V  +++     
Sbjct: 13  LSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGK 72

Query: 606 ---------------------------------------NGDMLSSGSRDRMILQRDVRT 626
                                                  NGD + S SRD+ I   +V+T
Sbjct: 73  LLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVSIMPNGDHIVSASRDKTIKMWEVQT 132

Query: 627 PNSQSERRLVGHRQEVCGLKWSPDNQYLASGGNDNRLYVWNLHSMSPLQTYTEHLAAVKA 686
                 +   GHR+ V  ++ + D   +AS  ND  + VW + +        EH   V+ 
Sbjct: 133 G--YCVKTFTGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVATKECKAELREHRHVVEC 190

Query: 687 IAWSPHHHGLLASGG-----------------GTADRCIRFWNTLTGQPMQCVDT-GSQV 728
           I+W+P       S                   G+ D+ I+ W+  TG  +  +    + V
Sbjct: 191 ISWAPESSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWV 250

Query: 729 CNLAWSKHSSELVSTHGYSQNQILVWKYPTLTQVAKLTGHSYRVLYLAMSPDGEAIVTGA 788
             + +      ++S        + VW Y     +  L  H + V  L        +VTG+
Sbjct: 251 RGVLFHSGGKFILS--CADDKTLRVWDYKNKRCMKTLNAHEHFVTSLDFHKTAPYVVTGS 308

Query: 789 GDETLRFW 796
            D+T++ W
Sbjct: 309 VDQTVKVW 316


>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 368 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Length = 432 Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Length = 432 Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Length = 432 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Length = 333 Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Length = 333 Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Length = 441 Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Length = 319 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query819
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.98
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.98
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.98
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.97
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.97
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.97
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.97
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.96
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.96
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.96
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.95
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.95
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.95
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.94
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.94
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.94
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.94
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.93
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.93
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.92
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.92
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.88
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.87
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.85
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.84
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.84
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.82
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.8
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.79
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.75
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.73
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.68
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.64
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.59
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.58
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.55
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.53
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.46
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.41
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.37
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.19
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.02
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.0
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.97
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 98.93
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.88
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.86
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.85
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.84
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.84
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.74
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.55
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.52
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.5
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.41
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.41
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 98.38
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 98.31
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.29
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 98.22
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.22
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 97.83
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 97.73
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 97.71
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.69
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 97.61
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 97.57
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 97.52
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 97.42
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 97.41
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 97.31
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 97.21
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 97.21
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 97.19
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 97.18
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 97.16
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 97.12
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 97.03
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 96.96
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 96.88
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 96.86
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 96.83
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 96.24
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 95.75
d1xipa_381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 93.92
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 91.77
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 91.6
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 91.08
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 90.8
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 89.86
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 89.37
d1xipa_ 381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 88.56
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 88.15
d1crua_ 450 Soluble quinoprotein glucose dehydrogenase {Acinet 80.73
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Groucho/tle1, C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=1.8e-35  Score=313.68  Aligned_cols=277  Identities=22%  Similarity=0.282  Sum_probs=240.8

Q ss_pred             CcceEEEEEecC--CeEEEEECCCeEEEEEcCCCce---EEEEeccCCCCCeEEEEEcCCCCEEEEEecCceEEEeecCC
Q psy10114        512 DDFYLNLVDWSS--QNVLSVGLGSCVYLWSACTSQV---TRLCDLSADGNSVTSVAWNERGNLVAVGTHHGYVQVWDVSV  586 (819)
Q Consensus       512 dDfyv~~ldwS~--~~LLa~g~Dg~V~LWd~~tg~~---~~l~~l~~h~~~VtsLafSpdG~~LAsGs~DGtI~IWDl~t  586 (819)
                      +.-.+.+++|++  +.+++|+ ||.|+|||+.+++.   .......+|.+.|.+++|+|+|++|++|+.||.|++||+..
T Consensus        50 H~~~V~~v~fs~~g~~latg~-dg~V~iWd~~~~~~~~~~~~~~~~~h~~~I~~v~~s~dg~~l~s~~~dg~i~iwd~~~  128 (337)
T d1gxra_          50 HGEVVCAVTISNPTRHVYTGG-KGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLAA  128 (337)
T ss_dssp             CSSCCCEEEECSSSSEEEEEC-BSEEEEEETTSTTCCSCSEEEECSCTTSBEEEEEECTTSSEEEEEESSSEEEEEECCC
T ss_pred             CCCcEEEEEECCCCCEEEEEE-CCEEEEEEccCCcccceeEEeeecCCCCcEEEEEEcCCCCEEEEeecccccccccccc
Confidence            334466677774  4676665 89999999876532   23344567889999999999999999999999999999874


Q ss_pred             --ceEEEEEecCCCCeEEEEe--CCceeeeccCCCeEEEEECCCCCccceEEEecccCCeEEEEECCCCCEEEEEECCCe
Q psy10114        587 --AKQVHKLVGHTARVGALAW--NGDMLSSGSRDRMILQRDVRTPNSQSERRLVGHRQEVCGLKWSPDNQYLASGGNDNR  662 (819)
Q Consensus       587 --gk~i~tl~gHs~~V~sLaw--ng~~LaSGS~DGtI~IWDi~t~~~~~v~~l~gH~~~VtsLafSpdg~~LaSGS~DGt  662 (819)
                        ++....+.+|...+.+++|  ++..+++++.|+.|++||+++++  ......+|...|.+++|+++++.+++|+.|+.
T Consensus       129 ~~~~~~~~~~~~~~~v~~~~~~~~~~~l~s~~~d~~i~~~~~~~~~--~~~~~~~~~~~v~~l~~s~~~~~~~~~~~d~~  206 (337)
T d1gxra_         129 PTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQT--LVRQFQGHTDGASCIDISNDGTKLWTGGLDNT  206 (337)
T ss_dssp             C--EEEEEEECSSSCEEEEEECTTSSEEEEEETTSCEEEEETTTTE--EEEEECCCSSCEEEEEECTTSSEEEEEETTSE
T ss_pred             cccccccccccccccccccccccccccccccccccccccccccccc--cccccccccccccccccccccccccccccccc
Confidence              4567778899999999999  46699999999999999998865  45677889999999999999999999999999


Q ss_pred             EEEEECCCCceeEEEecCCCCEEEEEEcCCCCeEEEEEccCCCCeEEEEECCCCceeEEEcCCCCeEEEEEccCCCEEEE
Q psy10114        663 LYVWNLHSMSPLQTYTEHLAAVKAIAWSPHHHGLLASGGGTADRCIRFWNTLTGQPMQCVDTGSQVCNLAWSKHSSELVS  742 (819)
Q Consensus       663 I~IWDl~t~~~i~t~~~h~~~VtsLafSPdg~~LLaSGgGs~DgtIrIWDl~tg~~v~~l~~~s~V~sLafSpdg~~Las  742 (819)
                      |++||+++++.+..+. +...|.+++|+|+++.+++ |+  .|+.+++||+++++......+...|.+++|+|+++.+++
T Consensus       207 v~i~d~~~~~~~~~~~-~~~~i~~l~~~~~~~~l~~-~~--~d~~i~i~d~~~~~~~~~~~~~~~i~~v~~s~~g~~l~s  282 (337)
T d1gxra_         207 VRSWDLREGRQLQQHD-FTSQIFSLGYCPTGEWLAV-GM--ESSNVEVLHVNKPDKYQLHLHESCVLSLKFAYCGKWFVS  282 (337)
T ss_dssp             EEEEETTTTEEEEEEE-CSSCEEEEEECTTSSEEEE-EE--TTSCEEEEETTSSCEEEECCCSSCEEEEEECTTSSEEEE
T ss_pred             ccccccccceeecccc-cccceEEEEEcccccccce-ec--cccccccccccccccccccccccccceEEECCCCCEEEE
Confidence            9999999999887765 7899999999999986655 43  799999999999998888888999999999999999998


Q ss_pred             EEecCCCeEEEEECCCCcEEEEEecCCCCEEEEEEecCCCEEEEEeCCCcEEEEEC
Q psy10114        743 THGYSQNQILVWKYPTLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNV  798 (819)
Q Consensus       743 tsGssDg~I~IWDl~s~k~l~sl~gH~~~VtsLafSpDG~~LaSGS~DGtIrIWdl  798 (819)
                        |+.||.|++||..+++.+..+. |.+.|.+++|+|||++|++|+.||+|++||+
T Consensus       283 --~s~Dg~i~iwd~~~~~~~~~~~-~~~~v~~~~~s~d~~~l~t~s~D~~I~vWdl  335 (337)
T d1gxra_         283 --TGKDNLLNAWRTPYGASIFQSK-ESSSVLSCDISVDDKYIVTGSGDKKATVYEV  335 (337)
T ss_dssp             --EETTSEEEEEETTTCCEEEEEE-CSSCEEEEEECTTSCEEEEEETTSCEEEEEE
T ss_pred             --EeCCCeEEEEECCCCCEEEEcc-CCCCEEEEEEeCCCCEEEEEeCCCeEEEEEE
Confidence              7789999999999999987765 7889999999999999999999999999996



>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure