Diaphorina citri psyllid: psy10122

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330

MKTAAIIYVTRNPKDTCVSYYHHCQLLEGYRGNFEDFFKIFLDGLGTYTRDLIHCRQICNTIIYVTRNPKDTCVSYYHHCQLLEGYRGNFEDFFKIFLDGLVCFGPFWEHVLEFWEASKRNPENILFLKYEDMKKDLKSIIQRTGKFLDHPLSTPDILQLEDHLSFESMKENRATNYELVIEINKENNLIDKEKCERGAFMRSGKIGGWKALMTNEMSNQVDLWTKDNLAGYLSMVLDFEPISGQSTDGTRILNTQFISPFRTGYVRCKGVCMPEYYVNFAEDIINDLKSIIQQTGKFLDHPLSTPDILQLEDHLSFESMKENQHIADSC

ccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccEEcHHHHHcccccccccHHHHHHHHHccccccccHHHHHHHHHHHcccccccEEEEEcHHHHHcHHHHHHHHHHHccccccHHHHHHHHHHccHHHHHccccccHHHHHHHHccccccccccccccccECccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccccEEcccEEcccccccccccHHHcccccccccHHHHHHcHHHHHHHHHHHHccccccHHHHHHHHHccHHHHHccccccccc

**TAAIIYVTRNPKDTCVSYYHHCQLLEGYRGNFEDFFKIFLDGLGTYTRDLIHCRQICNTIIYVTRNPKDTCVSYYHHCQLLEGYRGNFEDFFKIFLDGLVCFGPFWEHVLEFWEASKRNPENILFLKYEDMKKDLKSIIQRTGKFLDHPLSTPDILQLEDHLSFESMKENRATNYELVIEINKENNLIDKEKCERGAFMRSGKIGGWKALMTNEMSNQVDLWTKDNLAGYLSMVLDFEPISGQSTDGTRILNTQFISPFRTGYVRCKGVCMPEYYVNFAEDIINDLKSIIQQTGKFLDHPLSTPDILQLEDHLSFESMKE********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0044281 [BP]	small molecule metabolic process	probable	GO:0044710, GO:0008150, GO:0008152
GO:0000166 [MF]	nucleotide binding	probable	GO:0097159, GO:0036094, GO:0003674, GO:0005488, GO:1901363, GO:1901265
GO:0080118 [MF]	brassinosteroid sulfotransferase activity	probable	GO:0003824, GO:0016740, GO:0016782, GO:0008146, GO:0003674
GO:0008210 [BP]	estrogen metabolic process	probable	GO:0042445, GO:0044710, GO:0006629, GO:0044238, GO:0009987, GO:0044237, GO:0010817, GO:0071704, GO:0008150, GO:0008202, GO:0008152, GO:0065007, GO:0065008, GO:0034754, GO:1901360
GO:0004062 [MF]	aryl sulfotransferase activity	probable	GO:0003824, GO:0016740, GO:0016782, GO:0008146, GO:0003674
GO:0006805 [BP]	xenobiotic metabolic process	probable	GO:0051716, GO:0008152, GO:0050896, GO:0009987, GO:0044763, GO:0009410, GO:0044237, GO:0071466, GO:0008150, GO:0070887, GO:0042221, GO:0044699
GO:0009812 [BP]	flavonoid metabolic process	probable	GO:0071704, GO:0008150, GO:0008152
GO:0047364 [MF]	desulfoglucosinolate sulfotransferase activity	probable	GO:0003824, GO:0016740, GO:0016782, GO:0008146, GO:0003674
GO:0051923 [BP]	sulfation	probable	GO:0008150, GO:0009987, GO:0006790, GO:0008152, GO:0044237
GO:0043229 [CC]	intracellular organelle	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0043226
GO:0004304 [MF]	estrone sulfotransferase activity	probable	GO:0003824, GO:0016740, GO:0016782, GO:0008146, GO:0003674
GO:0044444 [CC]	cytoplasmic part	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0018958 [BP]	phenol-containing compound metabolic process	probable	GO:0009987, GO:0006725, GO:0044237, GO:0071704, GO:0008150, GO:0008152, GO:1901360, GO:1901615
GO:0047894 [MF]	flavonol 3-sulfotransferase activity	probable	GO:0003824, GO:0016740, GO:0016782, GO:0008146, GO:0003674

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1Q1Q, chain A
Confidence level:very confident
Coverage over the Query: 57-239
View the alignment between query and template
View the model in PyMOL

Template: 3CKL, chain A
Confidence level:very confident
Coverage over the Query: 252-329
View the alignment between query and template
View the model in PyMOL

Template: 3RNL, chain A
Confidence level:confident
Coverage over the Query: 32-152
View the alignment between query and template
View the model in PyMOL

Template: 3RNL, chain A
Confidence level:confident
Coverage over the Query: 2-97
View the alignment between query and template
View the model in PyMOL